CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_022239	Streptococcus anginosus C238, complete sequence	1 crisprs	cas3,csa3,RT,DinG,WYL,PD-DExK,csm6,DEDDh	0	0	8	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_022239_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022239_1

2164731-2164817

Orphan

Consensus_repeat	Method
AGCAGTATCGTACTTAGTTTGAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022239_1

>merge|NC_022239|1|2164731-2164817|CRISPRCasFinder
AGCAGTATCGTACTTAGTTTGAGCCTCAGCCAACTTAGCTTTAGCATCTTGGTCTGCTTTAACAGCAGTATCGTACTTAGTTTGAGC

>NC_022239|1|1|2164731-2164817|CRISPRCasFinder
AGCAGTATCGTACTTAGTTTGAGC	CTCAGCCAACTTAGCTTTAGCATCTTGGTCTGCTTTAAC
AGCAGTATCGTACTTAGTTTGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_022239.1\|WP_000097742.1\|2171949_2172213_+\|MerR-family-transcriptional-regulator	unknown	unknown	unknown
NC_022239.1\|WP_000164875.1\|2166881_2167217_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_022239.1\|WP_000025442.1\|2168768_2169071_+\|hypothetical-protein	unknown	unknown	unknown
NC_022239.1\|WP_003038367.1\|2154038_2154851_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227808
NC_022239.1\|WP_003037138.1\|2169554_2170310_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|214640
NC_022239.1\|WP_020999887.1\|2159080_2160835_-\|aspartate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234775
NC_022239.1\|WP_003038405.1\|2158158_2159094_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NC_022239.1\|WP_003038390.1\|2155861_2157937_+\|type-I-pullulanase	unknown	unknown	gnl\|CDD\|273975
NC_022239.1\|WP_001019353.1\|2172309_2173575_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NC_022239.1\|WP_003037133.1\|2174657_2175521_-\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
NC_022239.1\|WP_003038340.1\|2154861_2155848_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380517
NC_022239.1\|WP_000790956.1\|2167251_2168028_-\|hypothetical-protein	unknown	unknown	unknown
NC_022239.1\|WP_000222854.1\|2170617_2171871_+\|replication-initiation-factor-domain-containing-protein	unknown	unknown	gnl\|CDD\|367101
NC_022239.1\|WP_000852727.1\|2163379_2163847_-\|hypothetical-protein	unknown	unknown	unknown
NC_022239.1\|WP_000388454.1\|2168428_2168725_+\|hypothetical-protein	unknown	unknown	unknown
NC_022239.1\|WP_000901060.1\|2169070_2169577_+\|hypothetical-protein	unknown	unknown	unknown
NC_022239.1\|WP_003026692.1\|2162948_2163098_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|179075
NC_022239.1\|WP_003027825.1\|2160954_2161161_-\|hypothetical-protein	unknown	unknown	unknown
NC_022239.1\|WP_003038327.1\|2161241_2162522_-\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234586
NC_022239.1\|WP_003026691.1\|2162750_2162933_+\|50S-ribosomal-protein-L32	unknown	unknown	gnl\|CDD\|234901

Protein	Function_ID	Function_description	E-value
NC_022239.1\|WP_000164875.1\|2166881_2167217_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.28916e-10
NC_022239.1\|WP_001019353.1\|2172309_2173575_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.90804e-32
NC_022239.1\|WP_003038367.1\|2154038_2154851_+\|hypothetical-protein	gnl\|CDD\|227808	COG5521, COG5521, Predicted integral membrane protein [Function unknown].	3.1331e-75
NC_022239.1\|WP_003037138.1\|2169554_2170310_+\|ATP-binding-protein	gnl\|CDD\|214640	smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.	0.00750585
NC_022239.1\|WP_020999887.1\|2159080_2160835_-\|aspartate--tRNA-ligase	gnl\|CDD\|234775	PRK00476, aspS, aspartyl-tRNA synthetase; Validated.	0
NC_022239.1\|WP_003038405.1\|2158158_2159094_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	2.25954e-87
NC_022239.1\|WP_003038390.1\|2155861_2157937_+\|type-I-pullulanase	gnl\|CDD\|273975	TIGR02104, pulA_typeI, pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.	0
NC_022239.1\|WP_003037133.1\|2174657_2175521_-\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	8.51246e-82
NC_022239.1\|WP_003038340.1\|2154861_2155848_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380517	cd06294, PBP1_MalR-like, ligand-binding domain of maltose transcription regulator MalR which is a member of the LacI-GalR family repressors. This group includes the ligand-binding domain of maltose transcription regulator MalR which is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	6.89819e-101
NC_022239.1\|WP_000222854.1\|2170617_2171871_+\|replication-initiation-factor-domain-containing-protein	gnl\|CDD\|367101	pfam02486, Rep_trans, Replication initiation factor. Plasmid replication is initiated by the replication initiation factor (REP). This family represents a probable topoisomerase that makes a sequence-specific single-stranded nick in the plasmid DNA at the origin of replication. Human proteins also belong to this family, including myelin transcription factor 2 and cerebrin-50.	2.64643e-13
NC_022239.1\|WP_003026692.1\|2162948_2163098_+\|50S-ribosomal-protein-L33	gnl\|CDD\|179075	PRK00595, rpmG, 50S ribosomal protein L33; Validated.	4.75512e-18
NC_022239.1\|WP_003038327.1\|2161241_2162522_-\|histidine--tRNA-ligase	gnl\|CDD\|234586	PRK00037, hisS, histidyl-tRNA synthetase; Reviewed.	0
NC_022239.1\|WP_003026691.1\|2162750_2162933_+\|50S-ribosomal-protein-L32	gnl\|CDD\|234901	PRK01110, rpmF, 50S ribosomal protein L32; Validated.	2.07885e-18

>NC_022239.1|WP_000852727.1|2163379_2163847_-|hypothetical-protein
MAEVTTIVYRLGSQYDEKMSAISVFDAHLFHAKCHGDKVLFTVPTQNNTKVGKKVEKIDNIILTLKDGSKSLFAKVDNHGVFSEKDKEGELNPYKLPSQWTLSEEIEQGYTWFTLKGVKEISEEELNSYKSTNEREYPLLQSISGASCRIYVTEK
>NC_022239.1|WP_003026692.1|2162948_2163098_+|50S-ribosomal-protein-L33
MRVNITLEHKASGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVVFTEVK
>NC_022239.1|WP_003026691.1|2162750_2162933_+|50S-ribosomal-protein-L32
MAVPARRTSKAKKNKRRTHYKITAPSVHFDETTGDYSRSHRVSLKGYYKGRKIAKAAAAE
>NC_022239.1|WP_003038327.1|2161241_2162522_-|histidine--tRNA-ligase
MKLQKPKGTQDILPQESFKWQYVEEFARKTFKKYHYAEIRTPLFEHYEVISRSVGDTTDIVTKEMYDFYDKGDRHITLRPEGTAPVVRSYVENKLFAPEVQKPVKLYYMGSMFRYERPQAGRLREFHQIGVECFGSNNPATDVETIAMAAQFFNEIGIQGVTLQLNSLGNAESRAAYRQALIDYLTPLKDSLSKDSQRRLEENPLRVLDSKEKEDKLAVENAPSILDYLDEESQTHFQAVRSMLESLGIPYVINTNMVRGLDYYNHTIFEFTADVAGNELTICAGGRYDSLVAYFGGPETAGFGFGMGVERLLLVLEKQGVALPLEDSLDVYVAVLGDGANNKALEIVQALRKQGFTAERDYLNRKLKAQFKSADTFSAKTLITLGESEIESNQVTIKNNQTREELTVSLNQIQKDFQTIFEQLGF
>NC_022239.1|WP_003027825.1|2160954_2161161_-|hypothetical-protein
MKKIIIPSVIQFLIVFLIIGGIAYFVRGDFFFRFLAPIFGLAAGLLRLASSYVVKVLHPELYDKESKR
>NC_022239.1|WP_020999887.1|2159080_2160835_-|aspartate--tRNA-ligase
MKRSMYAGRVRSEHVGQKITLKGWVSRRRDLGGLIFIDLRDREGIMQLVINPENVDKEVMKIAESLRSEYVIEVTGKVEARTQANDKLATGAVELHVEHLTVLNTAQTTPFEIKDGIEANDDTRLRYRYLDLRRPEMLANLKLRAKVTHSIRNYLDELEFIDVETPFLTKSTPEGARDYLVPSRVNQGYFYALPQSPQITKQLLMNAGFDRYYQIVKCFRDEDLRGDRQPEFTQVDLETSFLSDQEIQDITEGLIARVMKETKGIEVTLPFPRMKYDDAMALYGSDKPDTRFEMLLQDLTELVKGIDFKVFSEAPAVKAIVVKNAADSYSRKDIDKLTEQAKQYGAKGLAWVKVASGELNGSVAKFLKDLTSDLTDALQLEDNDLVLFVADTLEVANASLGTLRVRLAKDLDLIDESKFNYLWVVDWPMFEWSEEEGRYMSAHHPFTLPQADTAHELEGDLSKVRAIAYDIVLNGYELGGGSLRINHKDLQERMFKALGFSEEEATDQFGFLLEAMDYGFPPHGGLAIGLDRFVMLLAGEENIREVIAFPKNNKASDPMTQAPSIVDAKQLEELSLQVETHEEK
>NC_022239.1|WP_003038405.1|2158158_2159094_-|YitT-family-protein
MKKSKIYKRLRYYLRRLAYDFKLIRVLKSISREKYDEKISASLIYGFLSAVAVNLFFQPGHVYSSGATGLAQILAALSTRFLGFTIPVSVTFYLINIPLMILAWYQIGHKFTVFTFITVSMSSLFIQFVPEVSLTNDPIINALFGGVIMGMGIGFALRSNISSGGTDIVSLTVRKKTGRNVGNISFMVNGMIMIIAGVTFGWKYALYSMITIFVSSRVTDAVFTKQKKMQAMIITSHPEEVVDKIHNKLHRGATMVNGAEGTYNHEKKTVLITVITRAEFNEFKHIMRKVDPHAFVSVADNVHILGRFVEE
>NC_022239.1|WP_003038390.1|2155861_2157937_+|type-I-pullulanase
MAFRTFQAYLDDQSLITIELEKQFYTEQLQFTIETVDSTQTLQIRTLEEQDDFVQYSLAPLKPLDVTEHYWIYDQDRNKTFLQFRHIVRKPIFDQTFAYDGDDLGAHYTPKVTTFKLWAPISEQVLLHLQNQVYPMTLGEKGVWQIEVSGNFDRAAYYYLHKVNGHWVEVHDPYALSSESNSGVSYVVNPEKITRPIHRAATQIPITKAVIYEMSVRDFSMQKEAEFSYPGKFKSLTESPDLQEHTLGMDYVKQLGITHIQLMPVYDFGSVDENHPELVYNWGYDPMQYNLPDGSFATNPHDPYTRIVELQEAIAAYHQADISVIMDVVYNHVYDPQTYAFEKIVPGYFFRYDHNANLTNGTFCGNDVASERAMVRSYIKHSLKQWLTLYGMDGFRFDLMGILDMETMKQIAEELKFLYPNVYLYGEGWRMNTGLDSNRLAHQFNAAQLPSYGFFSDHFRNTIKETILEGSQIQDSKPIDTIENVLTANVGLTETAHFIAPQQAINYVECHDDATAFDYFAIKKPDISLNERLADARLALHITLLAQGVPFLHSGQEFFRSKNLMDNTYNAQDAINRLDWLHSIEYEKDVDFVRQLIQFRKANLLLSLETRTEIKDYCSVEWLSDSVVEYKIKEKEDQITILINFGNEAFSYPNQDKQAIFINYPEISLDVPLNTNKDSYTVPAKQVLVLK
>NC_022239.1|WP_003038340.1|2154861_2155848_+|LacI-family-DNA-binding-transcriptional-regulator
MRVTIKEVAKLAGVSPSTVTRVVQNKSSISDETKKRVRKAMKELNYHPNLNARSLVSSYTQVIGVVLPDDSDAFYQNPFFPSVFRGIAQVASEHHYAIQIATGKNEKERMEAISQMVLGKRVDGLIFLYSQENDPLVKMVSEEQFPFLILGKSLSPFIPLVDNDNIQAGYDATEYFIKKDCRNIAFIGGSKRLFVTQDRYKGYQKALEDYHLELDPQNTAFANEFLEDKGYQFTKRLLSRDTKIDAIITTDSMLAEGVCNYLNENQLSVPTLAFDSIKPKLDLTAYVDINTLELGRVSFKTILQIINDTKENRQICYRQLIPHRIIEQ
>NC_022239.1|WP_003038367.1|2154038_2154851_+|hypothetical-protein
MLPYPFNYFSSIYGFKKPFANRKLLTWCQLIFTSIFLISLSMIPVAVQNASLKTYPLTTFVDGVFDPITKEVMDDITENAKIANHQFSYAGQQSTHNSKAGTVLLGKGNTALGEKLTLAFEPKQLVISKKGRKLANIQYQHINQAALKNKAALSAAISQDWFQQNRITVSLFLILISGFLLALNFFIVLLGATFFLYLTKKSRLFSFKTVKECYHFALNCLGLPTLIAVAAGLLFGQAMTTMITIQNILFVLYLVIIFYRTHFRDEKMKK
>NC_022239.1|WP_000164875.1|2166881_2167217_+|helix-turn-helix-transcriptional-regulator
MTKNMNLREFVAKQIRHLRLKNGMTQEYLAEKADLGFNYIYRLENKQLNVKIETIEKIMQALEVDVNTFFNIENQNKGKEFVQLIEDIENLPKEKREPTIKALRILLKQIK
>NC_022239.1|WP_000790956.1|2167251_2168028_-|hypothetical-protein
MKNKIKIEERMLVTVTLNLMHKMQDFQDFKKEQGISGAYEAKVAYLVENLHVHEKTAENLLSGKVVSHNNYLEIFPSFGSESNGDTQTKLEKFAEIISKEIENGDDNTVKEVNRILSDKLDKLDLKKIVNATFIQSLEKSSQSSLKSLKNPSKRTKTLDYAWVIWNSFFYDYISKRDDQYQIFTKFNVIEKAMDYLPLIEKIFESEENLEVFCQVAERIELFKEILPVVNEWDDWENVEKFIKSVQSRNGFDNYIDIK
>NC_022239.1|WP_000388454.1|2168428_2168725_+|hypothetical-protein
MEATQITIKGRLIGAAEVKDFTSGLRTGQTQLSIGLRTKDGRFNQTNVKADAVNVTDFTSLFDELVEIILDDVSINAYSSGNRAALSVKAKSAFIELI
>NC_022239.1|WP_000025442.1|2168768_2169071_+|hypothetical-protein
MSILHDLYETIDLNLVPYQDRTKRPILWDSRPKNLSQETDFFSGRIRVWTEPELSTTNAQFVIDQVYKNLSGVLEISYRIHDSYVDFDYQIREPKRIGEN
>NC_022239.1|WP_000901060.1|2169070_2169577_+|hypothetical-protein
MLGLFFILLQLSFLLGFLALIIWGIYQFDKMFLNQLFFNYLNSKYSPPKELPKIGSIQKNIYDMLPSLERLKVTGKIKLSDNRDFLMIQLSSDISPEQQLELENIVRGIIANHEVPYTVDYSQIDLDNGGWFANLKLETIEEATFNKNARSTEPRPQGEFDDEEYFEL
>NC_022239.1|WP_003037138.1|2169554_2170310_+|ATP-binding-protein
MKNISNSSNPLLKVGGGSPDLTSIHTLVLGSSGSGKSILVFMLIYHLWKSNTSSRFVISEMKQEDYVFAEHLPNIFLGLNALSAIDLAFQELEQRKADKTRERVPFYLVVEELTALFEMAGKDKKAYQEKIRVILYTGRSLNIKILAISQDLLATALGEGSARNQFSLIIALGAMRSSVTKGLFELEEEQEFQTNLPKGQGYLQRFDDGSSIVKIKVKKVRNIELLKQQVLTILERSIATYTEEAVDSGSL
>NC_022239.1|WP_000222854.1|2170617_2171871_+|replication-initiation-factor-domain-containing-protein
MTYVNEIEKYLQQDTNRKPTIMTSVDEVTFVIKPTEETLGEYPQHWSQIASELAEIISEKLSLPIIFGDYQALEKKAPAGYTDGFTFKGMPYYFAIAWHQTNFTMGIILKISASALSHYKTSYQDYYGEVIDVHNIAQLLYADYYDLRLSRIDLAVDYFNYSMSVNDLYQGLKNKRYIITNHKGCKNISNISAQEVNGQAQTMYIGSKKKNVNALLRIYNKYQEQLDNQGRYMHLTKYCNSWVRMEASYKGNYSNQILTLLLDIDNPQDLSKLIVNKMIDKYCFHDAETGQPLQFTSDLLKGAGIFPELKSLNSRNNDLLSTISYLMKGSGLFPLLTKIEKVWGTQARNHFIIRLIQEYETNYTPNPDVGLWLNKFSRELEKFNFEDFLEDAFQIFYQKNNITPKDSAKKPKSDVAD
>NC_022239.1|WP_000097742.1|2171949_2172213_+|MerR-family-transcriptional-regulator
MSSNNFDLKQIELMLLTVIDLLKHLNSEKNRTGIIYTQKELLDLLSISPNTLKSWENRGLKRLEPPIEGTRTVYYHIDTVLEFLSHN
>NC_022239.1|WP_001019353.1|2172309_2173575_+|site-specific-integrase
MNIEKIIHKGKTVLKKVKDNGEISYSAKSIYLGLDIKTGKPVKTTVTAKTLRSLDRKIIQAKIDFEESGSTRKETFSIATLSDLAELWFSNYETWVSSDNTLNRVRNYLDTYILPQFGQYQPDKVTSSDIQNWVNELATKSKESVDSGIKRAEKGCAKDFGAIAHKLSDIFDFGITHFELKHNPAQSIKIPPKPKSNQKRIMVLHDEDLTIWLNFVDTLPNTRANRRFKVICDSLLASGMRINELLALTIYDLDFESSEILVTKTLVWKNAKPKLGLKGKVVCKNTPKSDSGNRKIAVPYQIIEQLQNFHDEMNLYFKKNGLSKSKLIFPTIYGNYMCDRNERATLKRRLQEVGLPDYGFHLFRHTHASMMLNAGMNWKELQVRMGHKSIKTTMDIYAELAPKNQTQAVDIYLNKIAELTS
>NC_022239.1|WP_003037133.1|2174657_2175521_-|cation-transporter
MKSSKNVWIAFLLNSSFAIIEFIFGALFNSSAVLADAVHDTGDALAIGLSAFFEKISNRRDDRNYTLGYKRYSLLGAMLTSTILIVGSILILVENVPKLFAPERVNYDGMLTLGIFAIVINLAASRVVSHGHTHNESILSLHFLEDILGWLAVIFVSFILRFTNWYFLDPLLSLIISTFILSKALPKFWENVQIFLDHVPSDVNLNDLYAEIQTIENIQTVTQLNVWTTDGLEKFAMIHICMKHPEQQAETQQLIRQHLKMYGITKVTIQTDESLDEHEECCIGEQQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

377834 : 385666

environmental_halophage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036376.1\|377834_379067_+	cysteine desulfurase	Q2XUY6	environmental_halophage	2.3e-105	46.0
WP_003036412.1\|379053_379509_+	SUF system NifU family Fe-S cluster assembly protein	A0A2H4N7M4	Lake_Baikal_phage	4.8e-08	27.7
WP_020999477.1\|379904_381146_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.6e-16	24.7
WP_003036463.1\|381303_382647_+	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	4.6e-43	29.4
WP_003036464.1\|382806_383616_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003036458.1\|383615_384359_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-28	39.4
WP_003025868.1\|384467_384692_+	DUF4059 family protein	NA	NA	NA	NA
WP_003036373.1\|384754_385666_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.5e-88	53.8

DBSCAN-SWA_2

495537 : 563237

Streptococcus_phage(36.0%)

bacteriocin,tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034299.1\|495537_496302_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.0e-16	26.1
WP_003034327.1\|496301_497012_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-19	29.4
WP_003034318.1\|497158_497815_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	5.9e-84	72.2
WP_003034252.1\|497884_498748_-	YitT family protein	M1Q1P6	Streptococcus_phage	5.4e-93	57.1
WP_003034335.1\|498900_499539_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.3e-75	66.2
WP_003034303.1\|499535_500429_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.6e-82	56.1
WP_003025601.1\|500463_500781_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	8.1e-31	62.9
WP_003034333.1\|500783_501647_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.6e-108	71.1
WP_003034287.1\|501658_502168_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.2e-53	62.8
WP_003034329.1\|502185_502539_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	5.0e-37	65.0
WP_003034261.1\|502674_503298_+	endonuclease III	NA	NA	NA	NA
WP_003034343.1\|503323_504151_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.2e-120	75.5
WP_003031487.1\|504266_504500_+	hypothetical protein	NA	NA	NA	NA
WP_020999502.1\|506565_507465_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003031490.1\|507451_507730_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003034355.1\|507719_508355_+	SdpI family protein	NA	NA	NA	NA
WP_003034322.1\|508544_509000_+	DUF3290 family protein	NA	NA	NA	NA
WP_003034245.1\|508996_509629_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003034285.1\|509994_510255_-	membrane protein	NA	NA	NA	NA
WP_020999503.1\|510500_512498_+\|tRNA	methionine--tRNA ligase	A0A1V0SEZ7	Hokovirus	7.3e-85	31.5
WP_003034356.1\|513017_514199_-	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_041791067.1\|514290_514977_+	response regulator transcription factor	NA	NA	NA	NA
WP_003034278.1\|514960_515941_+	sensor histidine kinase	B5LWN0	Feldmannia_species_virus	2.7e-08	26.4
WP_003034280.1\|517025_517793_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-26	35.3
WP_003034352.1\|517785_519774_+	ABC transporter permease	NA	NA	NA	NA
WP_003034240.1\|519920_521309_+	amino acid permease	NA	NA	NA	NA
WP_080571988.1\|521566_522526_+	S41 family peptidase	A0A2P0ZL68	Lactobacillus_phage	2.7e-08	28.0
WP_003034254.1\|522585_523014_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003034292.1\|524500_524704_-	cold-shock protein	Q9AZD3	Lactococcus_phage	9.5e-25	81.5
WP_020999506.1\|524975_525797_+	hypothetical protein	NA	NA	NA	NA
WP_003034272.1\|525862_526099_+	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_003034306.1\|526091_526790_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_148290577.1\|526812_528006_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003034249.1\|528099_529479_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	7.9e-30	34.0
WP_003034235.1\|529487_530039_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003034247.1\|530049_530358_+	hypothetical protein	NA	NA	NA	NA
WP_003034289.1\|530409_531102_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_003034295.1\|531116_531425_+	DUF898 family protein	S5MNN8	Brevibacillus_phage	3.7e-12	66.0
WP_020999508.1\|531537_533079_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.8e-52	27.7
WP_003034311.1\|533352_534156_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.3e-13	35.2
WP_003034293.1\|534862_535072_+	PspC domain-containing protein	NA	NA	NA	NA
WP_020999509.1\|535158_537456_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	6.0e-83	49.9
WP_003034301.1\|537652_540004_+	HAD-IC family P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	4.8e-35	24.5
WP_003034264.1\|540048_540402_-	DUF3397 family protein	NA	NA	NA	NA
WP_003025466.1\|540564_540990_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003034269.1\|541079_541769_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_020999511.1\|542001_544671_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_003034276.1\|544667_545786_+	citrate synthase	NA	NA	NA	NA
WP_003034331.1\|545787_546975_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_003034339.1\|547198_547939_+	UMP kinase	NA	NA	NA	NA
WP_003034284.1\|547942_548500_+	ribosome recycling factor	NA	NA	NA	NA
WP_003034237.1\|548847_549702_+	RNA-binding virulence regulatory protein CvfB	NA	NA	NA	NA
WP_003034316.1\|549783_550821_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_003034324.1\|550891_551497_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.9e-60	55.2
WP_148290568.1\|551589_552940_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.1e-63	50.9
WP_003037526.1\|553011_553386_-	hypothetical protein	NA	NA	NA	NA
WP_020999513.1\|553866_556017_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	4.5e-40	28.9
WP_003037280.1\|556027_557389_+\|bacteriocin	bacteriocin secretion accessory protein	NA	NA	NA	NA
WP_003037249.1\|557485_557635_+\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA
WP_003037258.1\|557679_558987_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_003037283.1\|558991_559744_-	response regulator transcription factor	NA	NA	NA	NA
WP_003037434.1\|559906_560620_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003037422.1\|561162_561483_+	hypothetical protein	NA	NA	NA	NA
WP_003025422.1\|561490_561712_+	hypothetical protein	NA	NA	NA	NA
WP_020998893.1\|562026_562278_+	hypothetical protein	NA	NA	NA	NA
WP_003037365.1\|562675_562996_+	hypothetical protein	NA	NA	NA	NA
WP_003025420.1\|563003_563237_+\|bacteriocin	garvicin Q family class II bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_3

792687 : 801183

Streptococcus_phage(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034942.1\|792687_793905_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	1.5e-93	50.1
WP_003034902.1\|793990_794830_+	thymidylate synthase	U5J9N5	Bacillus_phage	1.4e-85	56.1
WP_003035097.1\|795016_795529_+	dihydrofolate reductase	A0A1B2IBQ4	Erwinia_phage	2.2e-22	36.3
WP_003027977.1\|795739_796972_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.1e-131	57.7
WP_003035043.1\|796983_797571_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003035004.1\|797691_798399_+	glucosaminidase domain-containing protein	Q9ZXE4	Bacillus_phage	4.3e-16	42.0
WP_003033304.1\|798635_799499_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_100207872.1\|799707_801183_+	DUF853 family protein	A0A1S5SFB5	Streptococcus_phage	2.4e-45	33.9

DBSCAN-SWA_4

890773 : 961752

Staphylococcus_phage(19.05%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033304.1\|890773_891637_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_025271701.1\|891903_894195_-	hypothetical protein	NA	NA	NA	NA
WP_003035640.1\|894546_895464_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_003035667.1\|895453_895909_+	hypothetical protein	NA	NA	NA	NA
WP_003035719.1\|895911_896214_+	hypothetical protein	NA	NA	NA	NA
WP_003035661.1\|900398_902147_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.2e-52	29.8
WP_003035633.1\|902167_903703_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	1.2e-26	23.2
WP_003035612.1\|904122_904863_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-34	39.7
WP_003035613.1\|904862_907040_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_020999576.1\|907205_908165_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003035610.1\|908255_910244_+	excinuclease ABC subunit B	NA	NA	NA	NA
WP_003035673.1\|910950_911694_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.0e-28	27.7
WP_003035628.1\|911683_913306_+	hypothetical protein	NA	NA	NA	NA
WP_003035604.1\|913448_914579_+	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_003035626.1\|914582_915314_+	acyl-[acyl-carrier-protein] thioesterase	NA	NA	NA	NA
WP_003035630.1\|915336_916110_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_003035670.1\|916099_916738_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_003035659.1\|917767_918190_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.3e-23	46.0
WP_003035683.1\|918341_919232_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.2e-07	32.2
WP_003035601.1\|919228_920206_+	YvcK family protein	A1IMD5	Streptococcus_phage	2.4e-158	84.9
WP_003035665.1\|920202_921114_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.5e-114	70.6
WP_003035639.1\|921330_923826_+	pneumococcal-type histidine triad protein	NA	NA	NA	NA
WP_003035621.1\|924067_924589_+	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_003035713.1\|924593_925862_+	uracil transporter	Q9KX94	Enterobacteria_phage	5.7e-59	35.9
WP_003035671.1\|925920_926844_+	aspartate carbamoyltransferase catalytic subunit	A7RB08	Paramecium_bursaria_Chlorella_virus	1.6e-26	31.0
WP_003024839.1\|926882_927971_+	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	4.6e-57	36.8
WP_003035715.1\|927998_931178_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_003035681.1\|931439_932678_+	MFS transporter	NA	NA	NA	NA
WP_003035642.1\|932772_933663_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.1e-07	29.2
WP_020999577.1\|935858_936767_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	4.0e-06	28.3
WP_003035669.1\|936957_937764_+	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_003035654.1\|937773_938715_+	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003035645.1\|939030_939726_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_003035649.1\|939718_940045_+	inorganic diphosphatase	NA	NA	NA	NA
WP_003035668.1\|940055_940685_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_003035663.1\|940690_941146_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_080655071.1\|941232_942753_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_003032832.1\|942749_942965_+	YozE family protein	NA	NA	NA	NA
WP_003035691.1\|943041_944106_+	PhoH family protein	W8D063	Erwinia_phage	5.5e-47	48.1
WP_003035675.1\|944233_944734_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003035616.1\|944736_945063_+	TfoX/Sxy family protein	NA	NA	NA	NA
WP_020999554.1\|945149_946085_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.2e-87	54.3
WP_003037641.1\|946216_947329_+	alanine dehydrogenase	NA	NA	NA	NA
WP_020999450.1\|947669_948605_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.1e-87	54.3
WP_003033372.1\|948729_949299_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003033377.1\|949765_950275_+	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	5.6e-66	73.2
WP_003033375.1\|950560_952291_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-44	27.8
WP_020999579.1\|952287_954024_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.9e-42	27.5
WP_003033393.1\|954141_954639_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_003033383.1\|954619_955024_+	diacylglycerol kinase	NA	NA	NA	NA
WP_020999580.1\|955091_955991_+	GTPase Era	NA	NA	NA	NA
WP_003033398.1\|956782_957253_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003033407.1\|957306_957831_+	DUF664 domain-containing protein	NA	NA	NA	NA
WP_020999581.1\|957839_958283_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003033391.1\|958290_959115_+	DNA-formamidopyrimidine glycosylase	G3MA33	Bacillus_virus	1.8e-29	33.8
WP_003033400.1\|959118_959730_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_020999582.1\|959707_960673_+	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_020999450.1\|960816_961752_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.1e-87	54.3

DBSCAN-SWA_5

1102666 : 1125359

Streptococcus_phage(95.24%)

integrase

attL 1095104:1095120|attR 1132286:1132302

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1095104:1095120	attL	NA	NA	NA	NA
WP_003036762.1\|1102666_1103512_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.3e-104	67.7
WP_003036641.1\|1103554_1104286_-	DUF3307 domain-containing protein	NA	NA	NA	NA
WP_003036713.1\|1104278_1104953_-	DNA-binding protein	NA	NA	NA	NA
WP_003031049.1\|1105113_1105854_-	NAD-dependent protein deacylase	S5M4R0	Bacillus_phage	1.9e-22	28.0
WP_003029634.1\|1105932_1107237_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	6.2e-234	93.8
WP_001291561.1\|1107834_1109052_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|1109133_1109337_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_000857133.1\|1109797_1110028_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|1110024_1110447_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_001227347.1\|1110950_1111304_+	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000336323.1\|1111363_1111531_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_000691736.1\|1111649_1113569_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_001791010.1\|1113584_1113701_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224320.1\|1113945_1114881_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_020999616.1\|1114877_1115879_-	bifunctional lysozyme/C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	3.2e-190	99.7
WP_000804748.1\|1115875_1118053_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|1118055_1120503_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|1120486_1120993_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|1120967_1121465_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|1121581_1121803_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|1121845_1123051_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|1123073_1123226_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|1123228_1124614_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|1124642_1125029_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|1125044_1125359_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
1132286:1132302	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1218553 : 1322635

Streptococcus_phage(57.58%)

protease,portal,transposase,head,holin,tail,capsid,integrase

attL 1252106:1252123|attR 1329657:1329674

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003038768.1\|1218553_1219441_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	6.9e-27	29.5
WP_003038727.1\|1219477_1219777_-	hypothetical protein	NA	NA	NA	NA
WP_003038745.1\|1219786_1220086_-	hypothetical protein	NA	NA	NA	NA
WP_020999639.1\|1220155_1226974_-	DEAD/DEAH box helicase family protein	A0A248SL14	Klebsiella_phage	4.4e-214	30.9
WP_020999640.1\|1227023_1227575_-	hypothetical protein	NA	NA	NA	NA
WP_003033617.1\|1227558_1227753_-	hypothetical protein	NA	NA	NA	NA
WP_003033545.1\|1227753_1232658_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003033615.1\|1232851_1233442_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_080571981.1\|1234345_1234630_-	hypothetical protein	NA	NA	NA	NA
WP_003033642.1\|1234972_1236367_-	hypothetical protein	NA	NA	NA	NA
WP_003033540.1\|1236368_1237211_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_003033552.1\|1237207_1237801_-	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_020999641.1\|1237898_1240709_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_003033627.1\|1240705_1243057_-	DUF87 domain-containing protein	NA	NA	NA	NA
WP_020999642.1\|1243013_1243367_-	PrgI family protein	NA	NA	NA	NA
WP_003033632.1\|1243609_1244464_-	type IV secretion system protein	NA	NA	NA	NA
WP_003033591.1\|1244480_1244723_-	hypothetical protein	NA	NA	NA	NA
WP_020999644.1\|1244740_1246561_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_003033634.1\|1246560_1247049_-	hypothetical protein	NA	NA	NA	NA
WP_003033664.1\|1247124_1247706_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003033668.1\|1247708_1247942_-	hypothetical protein	NA	NA	NA	NA
WP_003033682.1\|1247938_1248334_-	hypothetical protein	NA	NA	NA	NA
WP_003033650.1\|1248343_1248529_-	hypothetical protein	NA	NA	NA	NA
WP_003033565.1\|1248512_1249865_-	DNA (cytosine-5-)-methyltransferase	A0A141E1L1	Streptococcus_phage	6.4e-125	55.3
WP_020999645.1\|1250013_1250832_-	replication initiator protein A	A0A286QNA4	Streptococcus_phage	5.8e-12	37.6
WP_003024225.1\|1251243_1251612_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_001287274.1\|1251684_1252185_-	50S ribosomal protein L10	NA	NA	NA	NA
1252106:1252123	attL	NA	NA	NA	NA
WP_003033542.1\|1254592_1255669_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003033549.1\|1256015_1256717_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_041791167.1\|1256901_1257555_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003033609.1\|1257556_1258099_-	N-acetyltransferase	NA	NA	NA	NA
WP_003033546.1\|1258202_1259873_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_003033644.1\|1260011_1260704_+	phosphopantothenate--cysteine ligase	NA	NA	NA	NA
WP_003033596.1\|1260700_1261252_+	phosphopantothenoylcysteine decarboxylase	Q9J5A8	Fowlpox_virus	1.1e-22	36.1
WP_003033598.1\|1261235_1261799_+	ECF transporter S component	NA	NA	NA	NA
WP_003033584.1\|1261977_1263696_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	6.8e-273	82.5
WP_003033655.1\|1263952_1264300_+	thiol reductase thioredoxin	NA	NA	NA	NA
WP_020999647.1\|1264414_1265584_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_148290572.1\|1265731_1266274_-\|integrase	tyrosine-type recombinase/integrase	C9E2L6	Enterococcus_phage	1.8e-30	43.3
WP_003033619.1\|1266301_1266868_-	hypothetical protein	NA	NA	NA	NA
WP_003033555.1\|1266919_1267153_-	hypothetical protein	NA	NA	NA	NA
WP_020999648.1\|1267263_1267677_-	hypothetical protein	NA	NA	NA	NA
WP_003033646.1\|1267678_1268110_-	hypothetical protein	NA	NA	NA	NA
WP_003033614.1\|1268171_1268435_-	hypothetical protein	NA	NA	NA	NA
WP_003033578.1\|1268455_1268818_-	hypothetical protein	NA	NA	NA	NA
WP_003033553.1\|1268819_1269614_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_020999649.1\|1269648_1270656_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_003033543.1\|1275585_1276020_-	hypothetical protein	NA	NA	NA	NA
WP_003033602.1\|1276030_1276258_-	hypothetical protein	NA	NA	NA	NA
WP_051148230.1\|1276274_1277180_-	conjugal transfer protein	NA	NA	NA	NA
WP_020999650.1\|1277283_1277763_-	hypothetical protein	NA	NA	NA	NA
WP_041791171.1\|1277804_1278032_-	hypothetical protein	NA	NA	NA	NA
WP_020999450.1\|1278519_1279455_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.1e-87	54.3
WP_003038002.1\|1280754_1281159_-\|holin	phage holin family protein	D0R0E9	Streptococcus_phage	8.2e-36	60.5
WP_003038021.1\|1281155_1281497_-	hypothetical protein	A0A1P8VVU3	Streptococcus_phage	7.6e-35	65.3
WP_003038024.1\|1281462_1281708_-	hypothetical protein	A0A1X9I679	Streptococcus_phage	5.7e-08	51.6
WP_020999651.1\|1281720_1285014_-	hypothetical protein	A0A1P8VVT1	Streptococcus_phage	8.2e-166	39.4
WP_003038040.1\|1285013_1285742_-	hypothetical protein	A0A1S5S982	Streptococcus_phage	2.3e-84	61.6
WP_003038035.1\|1285738_1288855_-\|tail	phage tail tape measure protein	Q6DMT2	Streptococcus_phage	4.9e-229	73.8
WP_020999653.1\|1289041_1289461_-	hypothetical protein	A0A1X9I691	Streptococcus_phage	6.3e-47	64.7
WP_003038032.1\|1289463_1290042_-	hypothetical protein	Q6DMT5	Streptococcus_phage	5.9e-88	83.8
WP_020999654.1\|1290056_1290374_-	hypothetical protein	Q6DMT6	Streptococcus_phage	2.4e-30	60.6
WP_003037999.1\|1290370_1290739_-	HK97 gp10 family phage protein	Q6DMT7	Streptococcus_phage	2.2e-27	52.2
WP_020999655.1\|1290725_1291070_-\|head,tail	head-tail adaptor protein	Q6DMT8	Streptococcus_phage	2.1e-16	44.4
WP_020999656.1\|1291069_1291363_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B0RXE3	Streptococcus_phage	9.8e-15	44.1
WP_020999657.1\|1291359_1292541_-\|capsid	phage major capsid protein	Q6DMU0	Streptococcus_phage	1.9e-173	75.4
WP_020999658.1\|1292554_1293238_-\|protease	Clp protease ClpP	E4ZFM4	Streptococcus_phage	1.0e-78	66.2
WP_003038005.1\|1293230_1294493_-\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	9.9e-205	82.2
WP_148290573.1\|1294653_1296004_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.0e-62	50.6
WP_003033986.1\|1296785_1298645_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.7e-31	27.3
WP_003034004.1\|1299366_1299498_-	membrane protein	NA	NA	NA	NA
WP_003034023.1\|1299501_1299813_-	hypothetical protein	NA	NA	NA	NA
WP_009429691.1\|1300801_1300987_-	transposon-encoded TnpW family protein	NA	NA	NA	NA
WP_020999661.1\|1301071_1302187_-	DUF1016 family protein	Q9JMP5	Wolbachia_phage	1.7e-86	44.2
WP_020999662.1\|1302362_1303076_-	hypothetical protein	A0A0S2MYA8	Enterococcus_phage	4.7e-34	43.7
WP_020999663.1\|1303157_1304798_-	MobA/MobL family protein	NA	NA	NA	NA
WP_020999664.1\|1305114_1305489_-	hypothetical protein	NA	NA	NA	NA
WP_020999665.1\|1305575_1305992_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_020999666.1\|1306277_1307633_-	MATE family efflux transporter	NA	NA	NA	NA
WP_020999667.1\|1307657_1309052_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.5e-15	33.8
WP_020999668.1\|1309044_1309746_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_009525612.1\|1309765_1310353_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_020999669.1\|1310372_1310966_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020999670.1\|1311064_1312912_-	DUF4368 domain-containing protein	D0R0F3	Streptococcus_phage	2.4e-18	27.9
WP_020999672.1\|1313580_1314729_-	Fic family protein	D7RWK9	Brochothrix_phage	2.3e-38	30.9
WP_020999673.1\|1316590_1318294_-	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	6.8e-15	24.5
WP_041791181.1\|1318286_1319960_-	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	7.6e-27	24.9
WP_003038497.1\|1320101_1320290_-	hypothetical protein	NA	NA	NA	NA
WP_003038498.1\|1320798_1321197_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_020999450.1\|1321699_1322635_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.1e-87	54.3
1329657:1329674	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2127017 : 2142480

Streptococcus_phage(64.29%)

integrase

attL 2128944:2128970|attR 2138562:2138588

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020999879.1\|2127017_2128964_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.7e-68	31.4
2128944:2128970	attL	NA	NA	NA	NA
WP_003038317.1\|2129058_2130207_-\|integrase	site-specific integrase	A0A1X9I5Y5	Streptococcus_phage	5.7e-90	46.9
WP_020999880.1\|2130363_2131368_-	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	5.3e-84	49.8
WP_003038410.1\|2131512_2131989_-	helix-turn-helix transcriptional regulator	A0A1X9I723	Streptococcus_phage	5.5e-15	42.5
WP_003038356.1\|2132150_2132348_+	helix-turn-helix transcriptional regulator	A0A1X9I5U5	Streptococcus_phage	1.3e-18	73.8
WP_003038403.1\|2132364_2132982_+	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	3.3e-12	30.6
WP_003027794.1\|2133495_2133774_+	hypothetical protein	NA	NA	NA	NA
WP_003038392.1\|2133936_2134173_+	hypothetical protein	NA	NA	NA	NA
WP_003038362.1\|2134169_2134505_+	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	1.1e-14	50.6
WP_003038376.1\|2134506_2134776_+	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	4.9e-21	61.0
WP_003038339.1\|2134784_2135591_+	phage replisome organizer N-terminal domain-containing protein	A3F622	Streptococcus_phage	7.6e-49	50.7
WP_020999881.1\|2135605_2136457_+	ATP-binding protein	A0A1X9I6C4	Streptococcus_phage	7.2e-74	50.4
WP_003038422.1\|2136705_2137146_+	ArpU family transcriptional regulator	A0A2H4JEJ9	uncultured_Caudovirales_phage	9.9e-19	40.6
WP_003038349.1\|2137676_2137868_+	type II toxin-antitoxin system HicA family toxin	A0A1X9I5T5	Streptococcus_phage	1.7e-23	83.9
WP_003038371.1\|2137903_2138284_+	type II toxin-antitoxin system HicB family antitoxin	A0A1X9I5X0	Streptococcus_phage	6.1e-49	75.2
WP_003032335.1\|2138835_2139276_+	LytTR family transcriptional regulator	NA	NA	NA	NA
2138562:2138588	attR	NA	NA	NA	NA
WP_003038399.1\|2139272_2139731_+	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_020999883.1\|2139918_2142480_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.1e-37	22.0

DBSCAN-SWA_8

2208321 : 2220157

Bacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148290575.1\|2208321_2209672_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.5e-62	50.6
WP_003038249.1\|2209748_2210363_-	LysM peptidoglycan-binding domain-containing protein	Q4Z8Z7	Staphylococcus_phage	3.3e-28	66.7
WP_020999897.1\|2210519_2211314_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_004225051.1\|2211306_2212146_-	energy-coupling factor transporter ATPase	W8CYL7	Bacillus_phage	3.9e-16	34.2
WP_003038248.1\|2212130_2212958_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	6.9e-21	30.9
WP_004225055.1\|2212959_2213499_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_004225043.1\|2213509_2214331_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003038252.1\|2214389_2215685_-	insulinase family protein	G3MBJ8	Bacillus_virus	2.1e-16	26.1
WP_004225053.1\|2215684_2216932_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	5.7e-112	50.2
WP_003038263.1\|2217107_2217488_+	S4 domain-containing protein YaaA	A0A1X9I5V8	Streptococcus_phage	2.0e-20	64.0
WP_004225039.1\|2217489_2218587_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003038256.1\|2218675_2220157_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-97	41.1

Anti-CRISPR protein detection

Acr_ID: NC_022239.1|WP_025271686.1|1542580_1542907_+|replication-initiator-protein-A

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_022239.1|WP_025271686.1|1542580_1542907_+|replication-initiator-protein-A

1542580_1542907_+

108 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|63	0.8333333333333334	1	1.0

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_022239

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information