CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_023134	Paenibacillus larvae subsp. larvae DSM 25430, complete sequence	1 crisprs	cmr1gr7,cas10,cmr3gr5,cmr5gr11,cmr6gr7,csa3,c2c10_CAS-V-U3,cas14j,DinG,DEDDh,cas3	2	6	35	1
NC_023147	Paenibacillus larvae subsp. larvae DSM 25430 plasmid pPLA2_10, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_023134_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_023134_1

1647332-1647898

Orphan

I-C

Consensus_repeat	Method
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	PILER-CR
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	CRISPRCasFinder
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CRT

8 spacers

The CRISPR arrays of NC_023134_1

>merge|NC_023134|1|1647332-1647898|PILER-CR,CRISPRCasFinder,CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAATTTGTTTCGATGCTATATTTATACGCATCAATAGTCGCATCCTACGCGGATGCGTGGATTGAAATAAGGGAGGGGATTTTCAGACTCAGTTTAGACTATACGTCGCATCCTACGCGGATGCGTGGATTGAAATATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTACGTCGCATCCTACGCGGATGCGTGGATTGAAATACTAGAGCAATGAGCATTAACGGGATTCCAATCAGTCGCATCCTACGCGGATGCGTGGATTGAAATAAGGGAGGGGATTTTCAGACTCAGTTTAGACTATACGTCGCATCCTACGCGGATGCGTGGATTGAAATATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTACGTCGCATCCTACGCGGATGCGTGGATTGAAATACTAGAGCAATGAGCATTAACGGGATTCCAATCAGTCGCATCCTACGCGGATGCGTGGATTGAAATCAATTAAGCCGACCGCCATATAGCGTGGCTATGTCGCATCCTACGCGAATAGTTGAATTGCAAAT

>NC_023134|1|1|1647332-1647833|PILER-CR
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TTGTTTCGATGCTATATTTATACGCATCAATA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT

>NC_023134|1|1|1647332-1647898|CRISPRCasFinder
GTCGCATCCTACGCGGATGCGTGGATTGAAATT	TGTTTCGATGCTATATTTATACGCATCAATA
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	AGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	TTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	CTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	AGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	TTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	CTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAATC	AATTAAGCCGACCGCCATATAGCGTGGCTAT
GTCGCATCCTACGCGAATAGTTGAATTGCAAAT

>NC_023134|1|1|1647332-1647897|CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TTGTTTCGATGCTATATTTATACGCATCAATA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CAATTAAGCCGACCGCCATATAGCGTGGCTAT
GTCGCATCCTACGCGAATAGTTGAATTGCAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_023134.1\|WP_024093998.1\|1648900_1649221_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379233
NC_023134.1\|WP_023483541.1\|1640371_1641118_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_023134.1\|WP_023483488.1\|1646193_1646826_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|274926
NC_023134.1\|WP_023484254.1\|1652431_1652986_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|226614
NC_023134.1\|WP_051427842.1\|1641704_1642079_+\|cyanase	unknown	unknown	gnl\|CDD\|235079
NC_023134.1\|WP_024093995.1\|1644743_1645967_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_023134.1\|WP_036654307.1\|1651084_1651843_-\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|378279
NC_023134.1\|WP_024093994.1\|1643986_1644409_+\|hypothetical-protein	unknown	unknown	unknown
NC_023134.1\|WP_158442236.1\|1642564_1643428_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|131952
NC_023134.1\|WP_024093999.1\|1649278_1649578_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225511
NC_023134.1\|WP_077584958.1\|1648535_1648742_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|379098
NC_023134.1\|WP_193373146.1\|1642327_1642480_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|178053
NC_023134.1\|WP_080548081.1\|1653712_1653886_-\|DUF3951-domain-containing-protein	unknown	unknown	gnl\|CDD\|315734
NC_023134.1\|WP_080675819.1\|1648019_1648415_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_023134.1\|WP_042118951.1\|1644437_1644632_+\|hypothetical-protein	unknown	unknown	unknown
NC_023134.1\|WP_024094003.1\|1654485_1657434_+\|formate-dehydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|225918
NC_023134.1\|WP_023484252.1\|1657436_1657928_+\|DUF1641-domain-containing-protein	unknown	unknown	gnl\|CDD\|225283
NC_023134.1\|WP_042119539.1\|1650707_1651064_-\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198398
NC_023134.1\|WP_144083309.1\|1643582_1643825_+\|hypothetical-protein	unknown	unknown	unknown
NC_023134.1\|WP_023483542.1\|1641162_1641585_+\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679

Protein	Function_ID	Function_description	E-value
NC_023134.1\|WP_024093998.1\|1648900_1649221_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379233	pfam13518, HTH_28, Helix-turn-helix domain. This helix-turn-helix domain is often found in transposases and is likely to be DNA-binding.	5.50062e-07
NC_023134.1\|WP_023483541.1\|1640371_1641118_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	4.66551e-144
NC_023134.1\|WP_158442236.1\|1642564_1643428_+\|phosphotransferase	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	4.02746e-14
NC_023134.1\|WP_023484254.1\|1652431_1652986_+\|FUSC-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	1.71031e-17
NC_023134.1\|WP_051427842.1\|1641704_1642079_+\|cyanase	gnl\|CDD\|235079	PRK02866, PRK02866, cyanate hydratase; Validated.	3.04059e-74
NC_023134.1\|WP_024093995.1\|1644743_1645967_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.525e-144
NC_023134.1\|WP_036654307.1\|1651084_1651843_-\|DUF2087-domain-containing-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	1.68649e-28
NC_023134.1\|WP_023483488.1\|1646193_1646826_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	8.34787e-98
NC_023134.1\|WP_024093999.1\|1649278_1649578_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.000117275
NC_023134.1\|WP_193373146.1\|1642327_1642480_-\|hypothetical-protein	gnl\|CDD\|178053	PLN02434, PLN02434, fatty acid hydroxylase.	1.06846e-05
NC_023134.1\|WP_080548081.1\|1653712_1653886_-\|DUF3951-domain-containing-protein	gnl\|CDD\|315734	pfam13131, DUF3951, Protein of unknown function (DUF3951). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 56 and 71 amino acids in length. There is a conserved YTP sequence motif.	8.42698e-09
NC_023134.1\|WP_080675819.1\|1648019_1648415_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	2.27235e-20
NC_023134.1\|WP_024094003.1\|1654485_1657434_+\|formate-dehydrogenase-subunit-alpha	gnl\|CDD\|225918	COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only].	0
NC_023134.1\|WP_023484252.1\|1657436_1657928_+\|DUF1641-domain-containing-protein	gnl\|CDD\|225283	COG2427, COG2427, Uncharacterized conserved protein [Function unknown].	9.5598e-20
NC_023134.1\|WP_042119539.1\|1650707_1651064_-\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198398	cd10451, GIY-YIG_LuxR_like, GIY-YIG domain of LuxR and ArsR family transcriptional regulators, and uncharacterized hypothetical proteins found in bacteria. The family includes some bacterial LuxR and ArsR family transcriptional regulators. The a C-terminal conserved domain shows sequence similarity to the N-terminal catalytic GIY-YIG domains of intron-encoded homing endonucleases. Besides, they have an N-terminally fused transcriptional regulators module, comprising the winged helix-turn-helix (wHTH) domain and uncharacterized domain DUF2087. At this point, they are distinct from GIY-YIG homing endonucleases, which typically contain a variety of C-terminally fused nuclease-associated modular DNA-binding domains (NUMODs). Moreover, some key residues relevant to catalysis in GIY-YIG endonucleases are mutanted or absent in this family, which suggests that members in this family might lose the catalytic function that GIY-YIG endonucleases possess. This family also includes many uncharacterized hypothetical proteins that consist of a standalone GIY-YIG like domain.	1.51975e-40
NC_023134.1\|WP_077584958.1\|1648535_1648742_-\|IS3-family-transposase	gnl\|CDD\|379098	pfam13276, HTH_21, HTH-like domain. This domain contains a predicted helix-turn-helix suggesting a DNA-binding function.	6.61796e-06
NC_023134.1\|WP_023483542.1\|1641162_1641585_+\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	3.01646e-33

>NC_023134.1|WP_023483488.1|1646193_1646826_+|pyridoxamine-5'-phosphate-oxidase-family-protein
MNLCFQDVLTEEKQVRELIGNSSEVAKHKSIHHIDSYCREFIAKTPLIFISTSDKEGNCDVSPRGDAAGFVLVLDDKHLVIPERPGNRRIDSVRNILSSPRIGLIFLIPGLEETLRINGRACITKNPELMNRMQAREKTPLLGIGVEVEECYVHCAKAFKRSQTWEAGSWLNQDLLPKVSKMLVAHVNREDFTEEIIAKGLKESYEKRLY
>NC_023134.1|WP_024093995.1|1644743_1645967_-|IS256-family-transposase
MAQYQINVDSQLLHQLFLGNSQDAGVAKLLESVLNQVLQAQVSEQVEADRYERTENRKAYRNGSYPHGLHTRVGTITLSVPRIRGGKFTTELFSRYQRSEQALILAMMEMVVNGVSTRKVSQVTEELCGTEFSKSTVSDLCKRLDPIVTAWNNRSLADSLFPFVLVDAMYLKVREDGRVRSRGIMIAIGVNTEGYREVLGLMLGDTESEASWSEFFSSLKGRGLRGVDLITSDDHGGLVRAVRQQLQGVTWQRCQTHFTRNVLEASPKALKDEIHGRLRSILDAPDTGTARFLLKQTLAAYEDKAGKAMGVLESGFDDATAVLMLPERYRKRLRTTNSVERLNEEVRRRERVICIFPNRESVIRLIGALLMEQDEKWAAGKKYLDMTEYMEWRKDRPKSDAKVTRIM
>NC_023134.1|WP_042118951.1|1644437_1644632_+|hypothetical-protein
MFELIASGISAGNAAQVINAVFNGLSIVSALSLCAGIAGGAAWFLSNGIGYMIKWAGKKTIIDW
>NC_023134.1|WP_024093994.1|1643986_1644409_+|hypothetical-protein
MLLLSIAFVISAKMLKIVFKNESILKNKKKILKTYLVSNVLIFAAFIEALKIGDRKLINEIYFVSIGSKLIFSTVAVLTLISATSWNFIFASVGAIILYIIYFFANKQNTISERTRKVIARGDECLRIYSYGSRGFMPCL
>NC_023134.1|WP_144083309.1|1643582_1643825_+|hypothetical-protein
MLKISRVFYYLLKGFGEVNMKAYISVGHKAAIFLIGLSILVGFIYGFVFEDTDQIKTIGFDGLNVLETFFQIFPIILSLV
>NC_023134.1|WP_158442236.1|1642564_1643428_+|phosphotransferase
MVKPFSRRKTGPKLTTREQITRLSSYIQKLKESGYPHLPNWLVTKSGQYWVSHNGRPYYMTDWVEGSGIQSEEDYENLGRALATLHNNCKDSLPSMSRYTYKQTKLFKLQDQLFRLQLLTIRRNKSKGKWFREHGGLCIELANKSWSILRKPETKQIMEEEINHPALIHGDVTLPNIIIHPSRPFLIDWDLLRMGSTYYETAKTLLNTTNFDPANISALIKGYEQIKGLTPAERLLISAFFRLPVEAWRSARRIASGRRSPVFHILSRTWEKNLVPYDGWMNGHGNN
>NC_023134.1|WP_193373146.1|1642327_1642480_-|hypothetical-protein
MKRMHLWHHFKNEQYWYGVTNPVFDLTLHTYKDGKEVEKSGTTRNMEKLE
>NC_023134.1|WP_051427842.1|1641704_1642079_+|cyanase
MAKVIDRSEAWTASALLGQATLSNEEAEQVASLLELDQGVAECLTEVPYRGTAIQMPPTDPLLYRFYEILLVYGPGMKEIIHEKFGDGIMSAIDFEMDIKRVPDPKGDRVLMMLNGKFLPYKKF
>NC_023134.1|WP_023483542.1|1641162_1641585_+|OsmC-family-protein
MKVTTTWQGKRAFTSVGPSGYSVTMDATAAYGGDGKGATPMELILAGLAGCMGIDITMILRSTLDTIQSIEIEAEGTRDEEPPKGFTAIDLVFKINGDVPDHRIWRAIELGKEKYCAVSDSLKADIRYKLILNGKEAVKP
>NC_023134.1|WP_023483541.1|1640371_1641118_+|amino-acid-ABC-transporter-ATP-binding-protein
MIQTAGLTKSFQDTVVLKDINLQVKQNEIVVLLGPSGSGKSTLLRCINGLEELSGGTVEVNGIHIDAKMPARQRRARILEIRRETGMVFQQFNLYPHKTALGNVIESLLVVKKMRREEALKIGEQLLDRVGLADKKDVYPSRLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPELVGEVLDVMQQLAKDGMTMLVVTHEMKFARKVADRIVFMDAGIIVEEADPDAFFESPQSERARKFLKILDHE
>NC_023134.1|WP_080675819.1|1648019_1648415_-|IS3-family-transposase
MAIRLLSYVFGHSNNNSLVFQTVNKAIQAASGSRPMLHSDRGFQYTSQKFKKILEKGNIMQSMSQVGRCIDNGPMESFWGALKCEKYYLHTYHTFEDLERDIEAYIYFYNYERLQAKLNGLSPMEFRIKAA
>NC_023134.1|WP_077584958.1|1648535_1648742_-|IS3-family-transposase
MLTEAMMALYEKVGGIYGYHRLTLHICRETQQRINHKCIQRLMKLKRHSVGDSQKSKEICIVNSSARG
>NC_023134.1|WP_024093998.1|1648900_1649221_-|helix-turn-helix-domain-containing-protein
MTKGRKTTWQERLEIVQYCLTHNQDYRKTAEQYQASCQQVYQWVKKYQDGGQEALQDGRGRKKAEEELTDADRQKLAMKKMEAEIERLRAENALLKKLEELERRGR
>NC_023134.1|WP_024093999.1|1649278_1649578_-|helix-turn-helix-domain-containing-protein
MSKVQYNAKEKFAMIEEIESGELGLMGVAYKYGISKSTLVKWRRRYDVYGLEGLEVRTKNRSYSAELKLQAVLDYLKGELSQCDIIHKYKIASRTQLSN
>NC_023134.1|WP_042119539.1|1650707_1651064_-|GIY-YIG-nuclease-family-protein
MSRINKEHRAELQQAYKELKKRAAVYQIRNTMNGKLFIDSTLNLKTLNGEKFMLNMGTHNNRSLQQEWKEFGEDAFVFEVLEELKKPENEYVDIKDELKKLKDKWLGQVQPYGEKGYN
>NC_023134.1|WP_036654307.1|1651084_1651843_-|DUF2087-domain-containing-protein
MENPDLFWGSSLKELKQGYRELETHFVCILCGRAVEKGVIYQEYGIFYEAERFTRLHIEHTHGSVFDYLIQLDKKLTGLTDHQSSLLRLFYQGKNDSQIQQELGIGSVSTIRNHRFVLKEKERQAKVFLTMMELLKEKDRHAPEFVPLDPSAKMVDDRYNITKEENEKLLHKYFPEGTDGPLTSFRSLQEKHKLVVLKEMIKRFESGKIYTEKEVNRILAAAYEDYAILRRYLIEYRFLDRKPDGSQYWKKD
>NC_023134.1|WP_023484254.1|1652431_1652986_+|FUSC-family-protein
MHKTATIYQSFITFLHKIGFSMLVFKTALAAAISWWIALLFTPEYPPYLAPIAAVLIVNITVASTLIKAFYRIVGVIYGVLINLLIGSLVSNSTIAIFLSVLLGTALTSAFRLNNQIVSQVGVSAVMALAFLKTPYYGWGRIAETILGCLVAILVNVVIAPSNNLPKAARSIRKLSEISSNQIH
>NC_023134.1|WP_080548081.1|1653712_1653886_-|DUF3951-domain-containing-protein
MIVLIAVITFKIIKNKELPSNSYTPFDYITGQSNVEFHEEKEEKEEDMAKDDNKGKT
>NC_023134.1|WP_024094003.1|1654485_1657434_+|formate-dehydrogenase-subunit-alpha
METVKFQLNGEEHETAEGTRILDFLLELGKDHPHICYSPITGPIQSCDTCMCEADGKLVRACSTTLKPGMRIRTSSEKAQIAQKEAMDRILENHMLYCTVCDNNNGNCKVHNTTEMLGIEHQSRPFRPKGYKKDMSNPFYRYDPDQCILCGRCVEACQDLQVNETLSIDWEREIPRVIWDDDKAINESSCVSCGHCVTVCPCNALMEKTMLGEAGFLTGMSEGLMNPMIDLVKAVEPGYSGIFAVSEMEAALRETRTKKTKTVCTFCGVGCSFEVWTKDRVILKIEPNEQAPVNSISTCVKGKFGWDFVNSDQRLTAPLIRRGDQFVPAGWDEAIDYIAERLGRIKEEHGGNALSFVASSKTTNEDTYLMQKLARQVFETNNVDNCSRYCQSPASDGLQNTVGYGGDSGTIRDIEQAGLVIIVGANSAEAHPVLATRVKRAHKLRGQKLIVADLHKHEMAERADLFIRPKQGTDFVWLTALAKYILDQGWHDEAFLRERVNNREEYEQMIEKYTISYAEKITGIPGEQLIQTAKMICEASGTCILWGMGVTQNVGGSHTSAAISNLLLVTGNYGRTGTGAYPLRGHNNVQGACDMGALPQWLPGYQKLADDEVRQKFEKAYGVRISPEPGLTNVGMVEAIHEGRLKGMYLMGEDMVWVDSNSNNVQEALAKLDFFVVQDVFLTKTAQFADVVLPACPSLEKDGTFTNTERRIQRLYRALEPLGDSKPDWWIIQQLANRMGANWAYKHPGDVMDEIASLVPTFAGVRYSRLEHWNSQHWPVREDGTDEPLLYTQRFNFPDGKARLSTAEYIPPVGYPSDFDLIVNNGRLLEHFHETNLTGKSKGINYKLPSVFVEISSELAGKRGLEDGSLVRLVSPYGSIKLHVLVTDRVEGNHIYVPMHSHSHENAINILSGNAVDMKTSTPAYKQTRARMEIIQKEGISPLPRHNHRFARRRPQTGVQVERKWERQDYEPIADVNVNGGQ
>NC_023134.1|WP_023484252.1|1657436_1657928_+|DUF1641-domain-containing-protein
MAKSITTITEPVLSEKEANEKAWAEVLEELSRNSEGLRSYIRLLQELHESGIMDTMKAALQSKEELAKVIVKEMNKPNNTNTINNLMAMAGTLSMLDSDVVKKMASSVSTGFHKAREENQTEEKIGLFDLMKALKDPDINRAVRFGLNFLKGMGQSLGEKGEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_023134_1	1.1\|1647364\|32\|NC_023134\|PILER-CR,CRT	1647364-1647395	32	NC_023134.1	2685213-2685244	1	0.969
NC_023134_1	1.8\|1647365\|31\|NC_023134\|CRISPRCasFinder	1647365-1647395	31	NC_023134.1	2685214-2685244	1	0.968

1. spacer 1.1|1647364|32|NC_023134|PILER-CR,CRT matches to position: 2685213-2685244, mismatch: 1, identity: 0.969

ttgtttcgatgctatatttatacgcatcaata	CRISPR spacer
ttgtttcgatgctatatttgtacgcatcaata	Protospacer
*******************.************

2. spacer 1.8|1647365|31|NC_023134|CRISPRCasFinder matches to position: 2685214-2685244, mismatch: 1, identity: 0.968

tgtttcgatgctatatttatacgcatcaata	CRISPR spacer
tgtttcgatgctatatttgtacgcatcaata	Protospacer
******************.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_023134_1	1.3\|1647496\|37\|NC_023134\|PILER-CR,CRT	1647496-1647532	37	KT361653	Paenibacillus phage Paisley, complete genome	41256-41292	0	1.0
NC_023134_1	1.3\|1647496\|37\|NC_023134\|PILER-CR,CRT	1647496-1647532	37	NC_028746	Paenibacillus phage Harrison, complete genome	41333-41369	0	1.0
NC_023134_1	1.6\|1647699\|37\|NC_023134\|PILER-CR,CRT	1647699-1647735	37	KT361653	Paenibacillus phage Paisley, complete genome	41256-41292	0	1.0
NC_023134_1	1.6\|1647699\|37\|NC_023134\|PILER-CR,CRT	1647699-1647735	37	NC_028746	Paenibacillus phage Harrison, complete genome	41333-41369	0	1.0
NC_023134_1	1.10\|1647497\|36\|NC_023134\|CRISPRCasFinder	1647497-1647532	36	KT361653	Paenibacillus phage Paisley, complete genome	41257-41292	0	1.0
NC_023134_1	1.10\|1647497\|36\|NC_023134\|CRISPRCasFinder	1647497-1647532	36	NC_028746	Paenibacillus phage Harrison, complete genome	41334-41369	0	1.0
NC_023134_1	1.13\|1647700\|36\|NC_023134\|CRISPRCasFinder	1647700-1647735	36	KT361653	Paenibacillus phage Paisley, complete genome	41257-41292	0	1.0
NC_023134_1	1.13\|1647700\|36\|NC_023134\|CRISPRCasFinder	1647700-1647735	36	NC_028746	Paenibacillus phage Harrison, complete genome	41334-41369	0	1.0
NC_023134_1	1.15\|1647835\|31\|NC_023134\|CRISPRCasFinder	1647835-1647865	31	NZ_CP020329	Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence	35867-35897	2	0.935
NC_023134_1	1.15\|1647835\|31\|NC_023134\|CRISPRCasFinder	1647835-1647865	31	NZ_CP019796	Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence	29492-29522	2	0.935
NC_023134_1	1.15\|1647835\|31\|NC_023134\|CRISPRCasFinder	1647835-1647865	31	NZ_CP019661	Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence	30453-30483	2	0.935
NC_023134_1	1.15\|1647835\|31\|NC_023134\|CRISPRCasFinder	1647835-1647865	31	NZ_CP019658	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence	30454-30484	2	0.935
NC_023134_1	1.16\|1647834\|32\|NC_023134\|CRT	1647834-1647865	32	NZ_CP020329	Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence	35866-35897	3	0.906
NC_023134_1	1.16\|1647834\|32\|NC_023134\|CRT	1647834-1647865	32	NZ_CP019796	Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence	29491-29522	3	0.906
NC_023134_1	1.16\|1647834\|32\|NC_023134\|CRT	1647834-1647865	32	NZ_CP019661	Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence	30452-30483	3	0.906
NC_023134_1	1.16\|1647834\|32\|NC_023134\|CRT	1647834-1647865	32	NZ_CP019658	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence	30453-30484	3	0.906
NC_023134_1	1.15\|1647835\|31\|NC_023134\|CRISPRCasFinder	1647835-1647865	31	NZ_CP019720	Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence	18377-18407	4	0.871
NC_023134_1	1.16\|1647834\|32\|NC_023134\|CRT	1647834-1647865	32	NZ_CP019720	Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence	18376-18407	5	0.844

1. spacer 1.3|1647496|37|NC_023134|PILER-CR,CRT matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

2. spacer 1.3|1647496|37|NC_023134|PILER-CR,CRT matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

3. spacer 1.6|1647699|37|NC_023134|PILER-CR,CRT matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

4. spacer 1.6|1647699|37|NC_023134|PILER-CR,CRT matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

5. spacer 1.10|1647497|36|NC_023134|CRISPRCasFinder matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

6. spacer 1.10|1647497|36|NC_023134|CRISPRCasFinder matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

7. spacer 1.13|1647700|36|NC_023134|CRISPRCasFinder matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

8. spacer 1.13|1647700|36|NC_023134|CRISPRCasFinder matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

9. spacer 1.15|1647835|31|NC_023134|CRISPRCasFinder matches to NZ_CP020329 (Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

10. spacer 1.15|1647835|31|NC_023134|CRISPRCasFinder matches to NZ_CP019796 (Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

11. spacer 1.15|1647835|31|NC_023134|CRISPRCasFinder matches to NZ_CP019661 (Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

12. spacer 1.15|1647835|31|NC_023134|CRISPRCasFinder matches to NZ_CP019658 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

13. spacer 1.16|1647834|32|NC_023134|CRT matches to NZ_CP020329 (Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

14. spacer 1.16|1647834|32|NC_023134|CRT matches to NZ_CP019796 (Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

15. spacer 1.16|1647834|32|NC_023134|CRT matches to NZ_CP019661 (Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

16. spacer 1.16|1647834|32|NC_023134|CRT matches to NZ_CP019658 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

17. spacer 1.15|1647835|31|NC_023134|CRISPRCasFinder matches to NZ_CP019720 (Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.871

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
cttaaagccgaccgccatatagcgcggctat	Protospacer
  * ********************.******

18. spacer 1.16|1647834|32|NC_023134|CRT matches to NZ_CP019720 (Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaaagccgaccgccatatagcgcggctat	Protospacer
   * ********************.******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

114492 : 182173

Paenibacillus_phage(31.82%)

transposase,integrase,protease

attL 178628:178644|attR 189519:189535

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024092920.1\|114492_115716_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_024092922.1\|117026_119534_+	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_096761233.1\|119577_120693_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.2e-05	38.7
WP_042119400.1\|120826_121642_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.6e-30	32.0
WP_023483149.1\|121850_122933_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_024092924.1\|123006_124233_+	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_024092925.1\|124290_125085_+	acetylglutamate kinase	NA	NA	NA	NA
WP_036655748.1\|125138_126338_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.1e-31	27.9
WP_193373144.1\|126350_127316_+	ornithine carbamoyltransferase	Q84489	Paramecium_bursaria_Chlorella_virus	1.0e-23	29.2
WP_024092927.1\|127341_128568_+	argininosuccinate synthase	NA	NA	NA	NA
WP_024092928.1\|128655_130065_+	argininosuccinate lyase	NA	NA	NA	NA
WP_024092929.1\|130239_131730_-	VanW family protein	NA	NA	NA	NA
WP_042118303.1\|132108_132795_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	6.5e-25	34.5
WP_036655756.1\|132784_133705_+	ABC transporter permease	NA	NA	NA	NA
WP_023483138.1\|133857_135129_+	peptidoglycan DD-metalloendopeptidase family protein	A0A075BS18	Microcystis_phage	2.9e-18	47.4
WP_042119402.1\|135229_136663_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.1e-25	29.7
WP_042118306.1\|136801_138088_+\|protease	serine protease	NA	NA	NA	NA
WP_096761231.1\|138736_139513_-	OmpA family protein	NA	NA	NA	NA
WP_024092935.1\|139484_140282_-	flagellar motor protein	NA	NA	NA	NA
WP_024092936.1\|140533_142528_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_024092937.1\|142713_145596_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	58.2
WP_024092938.1\|145904_146303_+	hypothetical protein	NA	NA	NA	NA
WP_024092939.1\|146394_148011_-	ferredoxin--nitrite reductase NirA	NA	NA	NA	NA
WP_036655768.1\|148253_148454_+	hypothetical protein	NA	NA	NA	NA
WP_024092940.1\|148645_149614_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_052337358.1\|149888_151568_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_052337359.1\|151525_152065_+	hypothetical protein	A0A2H4J162	uncultured_Caudovirales_phage	6.7e-09	55.0
WP_052337360.1\|154453_154777_+	DUF4879 domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|154891_156115_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023482390.1\|156353_157640_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	3.2e-73	37.0
WP_023482391.1\|157800_159162_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	8.4e-117	50.2
WP_024092942.1\|159186_159633_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_024092943.1\|159629_161585_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_042119404.1\|161602_162520_-	DUF2232 domain-containing protein	NA	NA	NA	NA
WP_036655655.1\|162924_163260_-	hypothetical protein	NA	NA	NA	NA
WP_024092945.1\|163438_164662_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.1e-227	99.8
WP_042118312.1\|164817_165120_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	2.2e-30	67.0
WP_051427959.1\|165345_166008_+	hypothetical protein	NA	NA	NA	NA
WP_024092947.1\|166309_167557_+	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	1.2e-16	44.5
WP_036657280.1\|167791_168511_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-37	37.5
WP_023482385.1\|168511_170338_+	cell wall metabolism sensor histidine kinase WalK	A0A1V0SGX0	Hokovirus	3.0e-24	26.6
WP_023482384.1\|170334_171648_+	regulator of YycFG-like protein	NA	NA	NA	NA
WP_023482383.1\|171680_172448_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_024092948.1\|172494_173301_+	MBL fold metallo-hydrolase	A0A2I7SDH3	Paenibacillus_phage	1.3e-40	36.1
WP_024092949.1\|173269_173479_-	hypothetical protein	NA	NA	NA	NA
WP_024092950.1\|173640_174855_+	trypsin-like peptidase domain-containing protein	A0A1B1IRD3	uncultured_Mediterranean_phage	1.2e-10	28.4
WP_024092951.1\|174911_175079_+	CxxH/CxxC protein	NA	NA	NA	NA
WP_023482379.1\|176348_176864_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_042119405.1\|177057_178293_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
178628:178644	attL	NA	NA	NA	NA
WP_024092954.1\|179196_179676_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_042118318.1\|179678_180431_-\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	3.5e-64	45.1
WP_077585141.1\|180375_180519_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|180949_182173_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
189519:189535	attR	NA	NA	NA	NA

DBSCAN-SWA_2

215942 : 290822

Paenibacillus_phage(26.32%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024092852.1\|215942_217166_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
WP_024092981.1\|217370_218531_+	ABC-2 family transporter protein	NA	NA	NA	NA
WP_023483112.1\|218591_219428_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-21	33.3
WP_023483111.1\|219784_220483_+	heptaprenylglyceryl phosphate synthase	NA	NA	NA	NA
WP_024092982.1\|220631_222962_+	DNA helicase PcrA	A7KV33	Bacillus_phage	3.4e-134	41.9
WP_024092983.1\|223050_225072_+	NAD-dependent DNA ligase LigA	Q332J4	Clostridium_botulinum_C_phage	6.9e-99	35.3
WP_023485000.1\|231194_231512_-	MTH1187 family thiamine-binding protein	NA	NA	NA	NA
WP_023485001.1\|231599_233177_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_042118342.1\|233169_233766_-	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_036655789.1\|233771_234164_-	hypothetical protein	NA	NA	NA	NA
WP_024092985.1\|234352_235258_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_023485006.1\|235339_236446_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023485007.1\|236544_237666_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	2.7e-20	32.3
WP_023483236.1\|237729_238953_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023485008.1\|239188_240124_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_024092986.1\|240162_241170_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_024092987.1\|241166_241829_+	pyrophosphatase PpaX	NA	NA	NA	NA
WP_193373145.1\|242153_242339_+	hypothetical protein	NA	NA	NA	NA
WP_024092989.1\|242650_243877_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_024092990.1\|243869_244505_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_024092991.1\|244527_245814_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_023485015.1\|245810_246410_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_024092992.1\|246413_247019_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_023485017.1\|247147_247882_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_042118347.1\|247968_248727_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_024092994.1\|248723_249452_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_023485021.1\|249521_250328_+	histidinol-phosphatase HisJ	NA	NA	NA	NA
WP_023485022.1\|250517_251468_+	ribose-phosphate pyrophosphokinase	A0A2K9L8D8	Tupanvirus	7.8e-37	32.7
WP_024092995.1\|251548_253315_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_024092996.1\|253331_254279_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.4e-72	50.0
WP_036655797.1\|254470_255418_+	ROK family glucokinase	NA	NA	NA	NA
WP_023485026.1\|255478_256360_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.3e-06	30.3
WP_024092997.1\|256371_257349_+	YvcK family protein	A1IMD5	Streptococcus_phage	5.4e-57	39.2
WP_024092998.1\|257354_258281_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	8.1e-55	39.1
WP_036655800.1\|258474_258744_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_040930513.1\|258853_259087_-	hypothetical protein	NA	NA	NA	NA
WP_042118352.1\|259113_259737_-	YIP1 family protein	NA	NA	NA	NA
WP_158442216.1\|259770_260268_-	stage II sporulation protein M	NA	NA	NA	NA
WP_024093001.1\|260186_261032_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-22	29.7
WP_036655806.1\|261028_262684_-	hypothetical protein	NA	NA	NA	NA
WP_158442217.1\|262741_262915_-\|bacteriocin	uberolysin/carnocyclin family circular bacteriocin	NA	NA	NA	NA
WP_023483236.1\|263065_264289_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023485033.1\|264582_265164_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	7.4e-54	57.6
WP_024093002.1\|265699_266728_+	sugar-binding domain-containing protein	NA	NA	NA	NA
WP_042118357.1\|266784_267789_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_024093004.1\|267927_269109_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_023485037.1\|269130_269883_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_024093005.1\|269884_271423_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_023485039.1\|271579_272872_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.1e-171	71.9
WP_023485040.1\|272940_273654_+	M50 family metallopeptidase	NA	NA	NA	NA
WP_024093006.1\|273786_274023_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_024093007.1\|274310_276815_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.5e-92	40.9
WP_024093008.1\|277398_277878_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	8.2e-43	54.5
WP_158442218.1\|279461_279857_+	recombinase family protein	NA	NA	NA	NA
WP_024093012.1\|281122_281506_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|281610_282834_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023485049.1\|286857_287727_-	VOC family protein	NA	NA	NA	NA
WP_036657365.1\|287913_289377_+	cardiolipin synthase	NA	NA	NA	NA
WP_023483236.1\|289598_290822_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_3

308301 : 454172

119

Paenibacillus_phage(32.43%)

tRNA,transposase,integrase

attL 311196:311255|attR 381586:382974

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024093026.1\|308301_309525_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	6.2e-228	99.8
WP_042118373.1\|309613_310207_-	hypothetical protein	NA	NA	NA	NA
WP_051427968.1\|310218_310941_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	5.4e-14	30.0
311196:311255	attL	NA	NA	NA	NA
WP_023483236.1\|311316_312540_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093027.1\|312980_313223_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052337364.1\|313957_316699_-	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	2.2e-76	32.6
WP_023482446.1\|316867_317509_-	thiamine diphosphokinase	NA	NA	NA	NA
WP_036655831.1\|317635_317875_-	hypothetical protein	NA	NA	NA	NA
WP_023482447.1\|318053_319970_+	two-component sensor histidine kinase-like protein	NA	NA	NA	NA
WP_024093030.1\|319959_320652_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-26	30.4
WP_023482449.1\|320870_321518_+	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.9e-10	30.4
WP_024093032.1\|321628_321832_-	YbdD/YjiX family protein	NA	NA	NA	NA
WP_077585278.1\|325011_325089_+	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_024093034.1\|325117_326797_+	potassium-transporting ATPase subunit A	NA	NA	NA	NA
WP_024093035.1\|326819_328850_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.9e-27	26.0
WP_023482455.1\|328884_329505_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_024093036.1\|329522_331832_+	sensor protein KdpD	NA	NA	NA	NA
WP_023482457.1\|332941_333466_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042118381.1\|333660_334107_-	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_042118384.1\|334224_335364_-	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
WP_036655837.1\|335465_336044_-	thymidine kinase	A0A249XZX5	Enterococcus_phage	3.2e-49	54.3
WP_144083280.1\|336287_336680_-	hypothetical protein	NA	NA	NA	NA
WP_023482462.1\|336801_337461_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_023482464.1\|338487_339231_-	HAD family hydrolase	NA	NA	NA	NA
WP_023483236.1\|339361_340585_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036655838.1\|340778_342212_+	cardiolipin synthase	NA	NA	NA	NA
WP_024093043.1\|342225_343131_-	non-homologous end-joining DNA ligase	NA	NA	NA	NA
WP_024093044.1\|343152_344100_-	ATP-dependent DNA ligase-like protein	A0A2H4JD86	uncultured_Caudovirales_phage	1.2e-13	27.1
WP_024093045.1\|344101_344944_-	Ku protein	A0A218M9C0	Mycobacterium_phage	5.3e-37	33.3
WP_155116214.1\|345559_345826_+	hypothetical protein	NA	NA	NA	NA
WP_024093047.1\|345877_346816_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_023482471.1\|346828_347662_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_036655842.1\|347743_348850_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.9e-20	36.0
WP_052337366.1\|349273_349642_+	hypothetical protein	NA	NA	NA	NA
WP_104932469.1\|349733_350780_+	DUF1343 domain-containing protein	NA	NA	NA	NA
WP_024093052.1\|350783_351971_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_024093053.1\|352090_353449_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024093055.1\|354075_355509_+	NAD(P)/FAD-dependent oxidoreductase	A0A218MMS0	uncultured_virus	2.6e-20	25.6
WP_024093056.1\|355637_356771_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024093057.1\|357094_359032_-	transcription antiterminator	NA	NA	NA	NA
WP_023482485.1\|360992_361250_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_023482488.1\|363713_364193_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_023482489.1\|364189_365068_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_023482490.1\|365074_365593_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_036655844.1\|365605_366634_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.3e-65	39.7
WP_042118391.1\|369396_370413_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_024093065.1\|370508_372440_-	ABC-F type ribosomal protection protein	A0A2K9L3Z8	Tupanvirus	1.5e-58	30.7
WP_036655852.1\|372720_373350_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_042118394.1\|373363_373861_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_023482499.1\|373879_374371_+	MogA/MoaB family molybdenum cofactor biosynthesis protein	NA	NA	NA	NA
WP_023482500.1\|374367_375378_+	molybdopterin-binding protein	NA	NA	NA	NA
WP_024093067.1\|375409_375673_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_024093068.1\|375717_376479_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.8e-12	27.7
WP_023482502.1\|376800_377082_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.4e-18	52.2
WP_024093070.1\|377171_378800_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.4e-158	59.1
WP_077585167.1\|378888_379386_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	5.3e-45	59.8
WP_080675781.1\|379918_380122_+	hypothetical protein	NA	NA	NA	NA
WP_077585169.1\|380360_380573_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_077585170.1\|380651_380885_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_077585279.1\|380891_381044_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_042118398.1\|381327_381642_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|381706_382930_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093077.1\|383105_383600_-	hypothetical protein	NA	NA	NA	NA
381586:382974	attR	NA	NA	NA	NA
WP_024093078.1\|383596_384697_-	endospore germination permease	NA	NA	NA	NA
WP_080675782.1\|384693_386154_-	spore germination protein	NA	NA	NA	NA
WP_024093080.1\|387020_388271_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|390153_391377_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118402.1\|392017_393469_+	amino acid permease	NA	NA	NA	NA
WP_024093084.1\|393480_395349_+	tyrosine decarboxylase	NA	NA	NA	NA
WP_024093085.1\|395419_396808_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_042118407.1\|397357_398620_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.3e-87	42.3
WP_023483974.1\|398651_399353_+	protein rep	NA	NA	NA	NA
WP_023483236.1\|399823_401047_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093087.1\|401780_403229_+	amino acid permease	NA	NA	NA	NA
WP_042119415.1\|403286_405149_+	tyrosine decarboxylase	NA	NA	NA	NA
WP_042118410.1\|406164_407550_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_023483979.1\|407836_408133_+	hypothetical protein	NA	NA	NA	NA
WP_042118413.1\|408442_409093_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_080675783.1\|409322_410138_+	N-acetylmuramoyl-L-alanine amidase	D6QWP2	uncultured_phage	6.9e-42	53.5
WP_023483983.1\|411598_412156_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.1e-38	43.6
WP_024093094.1\|412152_413112_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.3e-76	46.0
WP_024093095.1\|413108_413963_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_024093098.1\|415075_415441_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|415579_416803_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083281.1\|416795_417101_-	hypothetical protein	NA	NA	NA	NA
WP_036655893.1\|417276_417600_+\|transposase	transposase	NA	NA	NA	NA
WP_024093101.1\|418026_418803_+	hypothetical protein	NA	NA	NA	NA
WP_158442219.1\|419376_419553_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|419940_421164_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093105.1\|422165_423047_+	hypothetical protein	NA	NA	NA	NA
WP_024093106.1\|423069_424002_+	type III-B CRISPR module RAMP protein Cmr1	NA	NA	NA	NA
WP_024093107.1\|424001_425675_+	type III-B CRISPR-associated protein Cas10/Cmr2	NA	NA	NA	NA
WP_042118425.1\|425677_426799_+	hypothetical protein	NA	NA	NA	NA
WP_042118428.1\|427691_428096_+	type III-B CRISPR module-associated protein Cmr5	NA	NA	NA	NA
WP_144083282.1\|428064_428928_+	type III-B CRISPR module RAMP protein Cmr6	NA	NA	NA	NA
WP_024093113.1\|429223_429388_+	hypothetical protein	A0A1X9I5T2	Streptococcus_phage	5.0e-08	56.8
WP_104932516.1\|430419_431464_+\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_023485410.1\|431770_432442_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.6e-12	29.7
WP_024093118.1\|432438_432609_+	hypothetical protein	NA	NA	NA	NA
WP_024093121.1\|434133_434316_+	hypothetical protein	NA	NA	NA	NA
WP_024092852.1\|434527_435751_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
WP_024093122.1\|436282_437539_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_024093123.1\|437706_438894_+	alanine racemase	NA	NA	NA	NA
WP_172423825.1\|439137_439410_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_023485406.1\|439413_439764_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A2P0ZKX3	Lactobacillus_phage	6.9e-15	38.6
WP_042119417.1\|439935_442140_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_036657428.1\|442341_442908_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_023485404.1\|443304_443763_+	hypothetical protein	NA	NA	NA	NA
WP_024093128.1\|444354_444582_+	hypothetical protein	NA	NA	NA	NA
WP_024093129.1\|444837_445842_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	7.5e-38	38.4
WP_052337368.1\|445856_446036_+	S8 family serine peptidase	NA	NA	NA	NA
WP_096761197.1\|446344_446452_-	cortex morphogenetic protein CmpA	NA	NA	NA	NA
WP_036655908.1\|446613_446970_-	hypothetical protein	NA	NA	NA	NA
WP_023485402.1\|447068_447539_+	SprT family protein	NA	NA	NA	NA
WP_024093134.1\|449240_449849_-	LexA repressor-like protein	NA	NA	NA	NA
WP_023483236.1\|449913_451137_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093136.1\|451700_452291_+	hypothetical protein	NA	NA	NA	NA
WP_024093137.1\|452302_452590_+	hypothetical protein	E2ELK3	Clostridium_phage	3.8e-19	51.6
WP_023483236.1\|452948_454172_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_4

457711 : 518035

Paenibacillus_phage(43.75%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042118448.1\|457711_458062_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_023483236.1\|458253_459477_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118451.1\|459519_460602_-	hypothetical protein	NA	NA	NA	NA
WP_024093142.1\|460615_461830_-	sporulation killing factor system radical SAM maturase	NA	NA	NA	NA
WP_024093143.1\|461903_462089_-	sporulation killing factor	NA	NA	NA	NA
WP_042119418.1\|462499_462868_+	lectin	NA	NA	NA	NA
WP_023485422.1\|463653_463980_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_024093145.1\|464118_464421_-	hypothetical protein	NA	NA	NA	NA
WP_077585116.1\|464482_464590_-	TipAS antibiotic-recognition domain-containing protein	NA	NA	NA	NA
WP_042118454.1\|465060_467100_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-11	43.3
WP_023483236.1\|467383_468607_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093147.1\|468711_469326_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|469504_470728_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023485427.1\|471550_472006_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024093149.1\|472002_475170_+	MMPL family transporter	NA	NA	NA	NA
WP_023485429.1\|475368_475956_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.2e-11	36.8
WP_023485430.1\|476010_476979_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_036655432.1\|479926_480355_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_024093152.1\|480586_481312_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_042118457.1\|481520_481994_+	PTS N-acetylgalactosamine transporter subunit IIB	NA	NA	NA	NA
WP_036657176.1\|482021_482780_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_036655428.1\|482769_483642_+	PTS N-acetylgalactosamine transporter subunit IID	NA	NA	NA	NA
WP_023485438.1\|483659_484082_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_036655426.1\|484146_487842_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.3e-76	30.8
WP_024093155.1\|487926_489684_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-15	30.7
WP_158442221.1\|490129_490426_-	YcxB family protein	NA	NA	NA	NA
WP_144083284.1\|490466_490694_-	hypothetical protein	NA	NA	NA	NA
WP_042118461.1\|490934_492515_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_036655424.1\|493044_494274_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023485444.1\|494718_495786_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_042118468.1\|496061_496466_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_042118471.1\|496443_497013_+	Gx transporter family protein	NA	NA	NA	NA
WP_024093160.1\|497048_497882_+	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	1.2e-20	33.7
WP_036655420.1\|497857_498724_+	energy-coupling factor transporter ATPase	W8CYL7	Bacillus_phage	4.2e-13	28.9
WP_024093161.1\|498740_499544_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_024093162.1\|499676_501599_+	U32 family peptidase	NA	NA	NA	NA
WP_024093163.1\|501634_502909_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.9e-28	27.4
WP_023485453.1\|502922_504362_+	menaquinone biosynthesis decarboxylase	NA	NA	NA	NA
WP_024093164.1\|504351_505218_+	UbiA family prenyltransferase	NA	NA	NA	NA
WP_024093165.1\|505565_505895_-	ATP-binding protein	NA	NA	NA	NA
WP_036655414.1\|505904_506210_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_077585262.1\|506206_506512_-	response regulator	NA	NA	NA	NA
WP_023483236.1\|506680_507904_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118476.1\|507988_508759_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	39.2
WP_052337372.1\|508745_510623_+	ABC transporter permease	NA	NA	NA	NA
WP_023483236.1\|510666_511890_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118480.1\|513880_515863_+	acyltransferase family protein	B5WZU0	Pseudomonas_phage	2.9e-41	32.2
WP_036655400.1\|515879_516383_+	hypothetical protein	NA	NA	NA	NA
WP_024093174.1\|516587_517145_+	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	3.5e-85	92.0
WP_104932471.1\|517165_518035_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	7.5e-135	98.7

DBSCAN-SWA_5

527104 : 591467

Paenibacillus_phage(52.94%)

tRNA,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|527104_528328_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_080675785.1\|528972_529305_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|529383_530607_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093187.1\|530918_531056_+\|transposase	transposase	NA	NA	NA	NA
WP_023483605.1\|531752_533456_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	3.1e-76	32.3
WP_024093190.1\|534004_534676_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.5e-66	57.8
WP_023483607.1\|534672_535158_+	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	7.7e-57	68.2
WP_024093191.1\|535150_535888_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	4.2e-54	41.8
WP_024093192.1\|535914_536433_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.7e-49	63.1
WP_023483611.1\|537769_539212_+	dipeptidase PepV	NA	NA	NA	NA
WP_024093193.1\|539351_540575_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
WP_023483612.1\|540864_541266_+	hypothetical protein	NA	NA	NA	NA
WP_042119424.1\|541371_542784_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_080675786.1\|543013_543577_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_036655386.1\|543563_544181_+	hypothetical protein	NA	NA	NA	NA
WP_024093197.1\|544743_544962_+	hypothetical protein	NA	NA	NA	NA
WP_036655384.1\|545185_545698_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_052337475.1\|546118_546742_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_024093199.1\|546725_547538_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_036655382.1\|547594_547798_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_024093200.1\|547799_548600_+	thiazole synthase	NA	NA	NA	NA
WP_024093201.1\|548596_549523_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_080675787.1\|549579_549921_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_024093202.1\|551848_552085_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|552189_553413_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_158442222.1\|554969_555125_-	hypothetical protein	NA	NA	NA	NA
WP_024093206.1\|555501_555879_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_144083285.1\|556208_556424_-	hypothetical protein	NA	NA	NA	NA
WP_024093208.1\|556737_557433_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.8e-18	33.3
WP_024093209.1\|557429_557786_+	hypothetical protein	NA	NA	NA	NA
WP_024093210.1\|558150_560124_+	hypothetical protein	NA	NA	NA	NA
WP_080675788.1\|560375_560468_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_104932473.1\|560464_561325_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	1.6e-44	51.0
WP_024093212.1\|561240_561930_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023483570.1\|562040_562346_-	hypothetical protein	NA	NA	NA	NA
WP_024093213.1\|562670_563660_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_042118504.1\|563835_564972_-	virulence factor	NA	NA	NA	NA
WP_024093216.1\|565249_565834_-	guanylate kinase	A0A0K2FM14	Brevibacillus_phage	2.9e-10	27.8
WP_036655362.1\|566372_567380_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_077996146.1\|569375_569993_+	cytochrome (ubi)quinol oxidase subunit III	NA	NA	NA	NA
WP_024093219.1\|569997_570312_+	cytochrome C oxidase subunit IV family protein	NA	NA	NA	NA
WP_024093220.1\|570438_571305_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_023483236.1\|571924_573148_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093222.1\|574096_575002_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-23	30.0
WP_023483561.1\|574994_576263_+	ABC transporter permease	NA	NA	NA	NA
WP_024093223.1\|576597_578235_+	L-2,4-diaminobutyrate decarboxylase	NA	NA	NA	NA
WP_024093224.1\|578459_579257_-	MFS transporter	NA	NA	NA	NA
WP_023483558.1\|579257_579743_+	hypothetical protein	NA	NA	NA	NA
WP_052337375.1\|579985_581104_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|581096_582320_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_080675789.1\|582278_583742_+	ATP-binding domain-containing protein	A0A2I7SCM7	Paenibacillus_phage	5.3e-24	100.0
WP_024093225.1\|583790_584969_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_023483555.1\|585151_585958_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_023483554.1\|586405_587239_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024093227.1\|587366_588605_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_024093228.1\|589087_589657_+	maltose O-acetyltransferase Maa	NA	NA	NA	NA
WP_024093229.1\|589926_590223_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_023483236.1\|590243_591467_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_6

632969 : 721703

Paenibacillus_phage(65.52%)

holin,transposase,coat,integrase

attL 632848:632907|attR 664048:665437

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
632848:632907	attL	NA	NA	NA	NA
WP_023483236.1\|632969_634193_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023485365.1\|634938_635382_-	glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	NA	NA	NA	NA
WP_024093274.1\|635737_636109_+	DUF423 domain-containing protein	NA	NA	NA	NA
WP_023485363.1\|636185_637697_+	PAS domain S-box protein	NA	NA	NA	NA
WP_024093275.1\|637720_637981_+	hypothetical protein	NA	NA	NA	NA
WP_024093276.1\|638026_638443_-	hypothetical protein	NA	NA	NA	NA
WP_023485361.1\|638707_639019_+	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_024093278.1\|640178_641285_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_024093279.1\|641304_642534_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_024093280.1\|642752_643202_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	8.5e-42	61.3
WP_023483236.1\|643320_644544_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118539.1\|644769_645342_+	DUF1802 family protein	NA	NA	NA	NA
WP_023485355.1\|645522_646356_+	Fe-S cluster assembly ATPase SufC	W8CYL7	Bacillus_phage	2.2e-06	25.3
WP_024093282.1\|646423_647719_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_024093283.1\|647715_648942_+	cysteine desulfurase	Q2XUY6	environmental_halophage	2.1e-111	46.2
WP_023485352.1\|648928_649366_+	SUF system NifU family Fe-S cluster assembly protein	A0A218MKD1	uncultured_virus	1.1e-12	31.2
WP_023485351.1\|649390_650788_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_023483236.1\|651365_652589_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_051428002.1\|653466_654201_-	hypothetical protein	NA	NA	NA	NA
WP_024093289.1\|654445_655048_+	hypothetical protein	NA	NA	NA	NA
WP_077585193.1\|655032_655380_+	hypothetical protein	NA	NA	NA	NA
WP_023485348.1\|655410_655812_+	hypothetical protein	NA	NA	NA	NA
WP_024093291.1\|656087_656750_+	hypothetical protein	A0A2I7SC02	Paenibacillus_phage	5.1e-11	46.7
WP_024093292.1\|656725_656956_+	hypothetical protein	NA	NA	NA	NA
WP_024093293.1\|657215_657455_+	hypothetical protein	R9W0N4	Paenibacillus_phage	4.1e-35	96.2
WP_024093295.1\|658203_658446_+	hypothetical protein	A0A2I7SC00	Paenibacillus_phage	6.2e-31	90.0
WP_158442223.1\|659492_660161_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_024093297.1\|660273_660546_+	STAS-like domain-containing protein	J7KJ12	Streptococcus_phage	1.1e-07	47.9
WP_024092850.1\|660650_661874_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	3.1e-227	99.8
WP_052337378.1\|661996_662755_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|662761_663985_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_104932476.1\|664155_665227_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	8.3e-152	98.2
WP_024093300.1\|665614_665941_+\|transposase	transposase	NA	NA	NA	NA
664048:665437	attR	NA	NA	NA	NA
WP_024093302.1\|666351_666618_+	hypothetical protein	NA	NA	NA	NA
WP_024093303.1\|666701_667745_+	hypothetical protein	NA	NA	NA	NA
WP_042118544.1\|667764_668070_+	hypothetical protein	NA	NA	NA	NA
WP_158225766.1\|668100_668199_+	sporulation protein YjcZ	NA	NA	NA	NA
WP_024093305.1\|668432_668831_+	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|668919_670143_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093306.1\|670419_671427_-	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|671497_672721_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093307.1\|672940_673273_-	hypothetical protein	NA	NA	NA	NA
WP_024093308.1\|673465_674434_+	collagen-like repeat preface domain-containing protein	NA	NA	NA	NA
WP_023484380.1\|674618_676034_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_023484381.1\|676178_677030_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_023483236.1\|677394_678618_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_077585292.1\|678814_679918_+	radical SAM/CxCxxxxC motif protein YfkAB	NA	NA	NA	NA
WP_023484383.1\|679970_681341_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_024093257.1\|682394_683078_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	1.7e-118	96.9
WP_077585196.1\|683258_683471_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_024093310.1\|683743_684010_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_040932682.1\|684051_684621_+	manganese catalase family protein	NA	NA	NA	NA
WP_024093311.1\|685013_685310_+	hypothetical protein	A0A0K2CZ50	Paenibacillus_phage	3.5e-12	70.6
WP_023484389.1\|685539_686445_+	hypothetical protein	NA	NA	NA	NA
WP_158225767.1\|686567_686702_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_024093313.1\|687648_687846_+	hypothetical protein	NA	NA	NA	NA
WP_024093314.1\|688337_689561_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	2.4e-227	99.8
WP_080675874.1\|689988_691008_-	hypothetical protein	NA	NA	NA	NA
WP_024093317.1\|692309_692618_+	hypothetical protein	NA	NA	NA	NA
WP_155116254.1\|692757_692901_+	hypothetical protein	NA	NA	NA	NA
WP_104932516.1\|693709_694754_+\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_024093318.1\|694967_695408_+	hypothetical protein	NA	NA	NA	NA
WP_024093319.1\|695783_696080_-	sugar nucleotide-binding protein	NA	NA	NA	NA
WP_042119445.1\|697198_697921_-	NTP transferase domain-containing protein	H9NC64	Sphingomonas_phage	7.8e-45	41.0
WP_158225756.1\|698131_698314_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_193373148.1\|698982_699792_+	hypothetical protein	A0A024B055	Bacillus_phage	3.3e-12	43.6
WP_077585255.1\|699887_700769_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_051427935.1\|701334_702210_+	C40 family peptidase	D2KRB9	Lactobacillus_phage	2.6e-10	33.0
WP_023484075.1\|702526_702925_+\|holin	phage holin family protein	A0A0N7GFE6	Paenibacillus_phage	1.1e-21	43.5
WP_144083287.1\|703027_703636_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_042118555.1\|703976_704675_+	pirin family protein	NA	NA	NA	NA
WP_023484079.1\|704761_705931_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_023484080.1\|705927_706656_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_042118558.1\|706659_707517_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_023484082.1\|707703_708372_+	HAD family hydrolase	NA	NA	NA	NA
WP_024093330.1\|708420_709626_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_104932518.1\|709659_711609_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_036657087.1\|713356_713878_-	hypothetical protein	NA	NA	NA	NA
WP_052337381.1\|713999_714824_-	inositol phosphorylceramide synthase	NA	NA	NA	NA
WP_023483236.1\|714905_716129_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036657135.1\|716277_717438_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_144083289.1\|717669_717849_+	hypothetical protein	NA	NA	NA	NA
WP_077585258.1\|718160_718316_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	9.8e-06	46.0
WP_023483236.1\|718625_719849_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483236.1\|720479_721703_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_7

732377 : 803228

Paenibacillus_phage(41.67%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036657132.1\|732377_733526_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.9e-27	33.6
WP_023485156.1\|733522_734179_+	ABC transporter permease	NA	NA	NA	NA
WP_036655313.1\|734195_735089_+	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024093345.1\|735132_735762_+	ABC transporter permease	NA	NA	NA	NA
WP_024093346.1\|736042_736471_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024093347.1\|736751_737339_+	DUF402 domain-containing protein	NA	NA	NA	NA
WP_023485151.1\|737367_738537_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_023485150.1\|738607_739642_+	HD domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|739841_741065_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093348.1\|741138_741348_+	YneF family protein	NA	NA	NA	NA
WP_023485149.1\|741703_742294_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	5.5e-49	54.4
WP_024093349.1\|742514_743795_-	DUF2935 domain-containing protein	Q56AR7	Bacillus_thuringiensis_phage	8.1e-37	42.8
WP_023485147.1\|743868_744900_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_023485146.1\|745237_745981_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_024093350.1\|746088_747060_+	cation transporter	NA	NA	NA	NA
WP_024093351.1\|747219_749919_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_024093353.1\|750261_751281_+	amidase domain-containing protein	NA	NA	NA	NA
WP_024093354.1\|751303_752425_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_144083290.1\|752585_752801_-	hypothetical protein	NA	NA	NA	NA
WP_024093356.1\|752937_753966_+	UV DNA damage repair endonuclease UvsE	A0A2I2L3D9	Orpheovirus	7.7e-22	27.5
WP_023485140.1\|754154_754925_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_036655307.1\|755058_755349_-	hypothetical protein	NA	NA	NA	NA
WP_023485139.1\|755859_756714_+	inositol monophosphatase	NA	NA	NA	NA
WP_052304390.1\|756841_757234_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_024093358.1\|757394_758399_+	biotin synthase BioB	NA	NA	NA	NA
WP_080675875.1\|758474_762974_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_023485134.1\|763511_764825_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_080675876.1\|764916_765918_-	LCP family protein	NA	NA	NA	NA
WP_036657123.1\|766491_766962_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_023485131.1\|767253_768609_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_042118574.1\|770308_770788_+	winged helix DNA-binding protein	NA	NA	NA	NA
WP_024093366.1\|772511_774395_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.7e-56	31.1
WP_023483479.1\|774539_775109_+	putative ABC transporter permease	NA	NA	NA	NA
WP_024093368.1\|775414_776953_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	4.4e-21	32.6
WP_023483236.1\|777196_778420_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093369.1\|778592_778766_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024093370.1\|778783_779815_-	D-alanine--(R)-lactate ligase VanF	NA	NA	NA	NA
WP_023483236.1\|780507_781731_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093373.1\|782065_783460_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.9e-47	32.9
WP_023483236.1\|790146_791370_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093374.1\|791447_792455_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_023485289.1\|792648_793452_-	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_023485288.1\|793500_794526_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_042118579.1\|794873_795908_+	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_024093377.1\|795926_797378_+	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_024093378.1\|797390_799325_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_024093379.1\|799419_800316_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_024093380.1\|800342_801410_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_023483236.1\|802004_803228_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_8

807923 : 818578

Mollivirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036655290.1\|807923_809219_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	6.3e-21	34.3
WP_036655288.1\|809292_810177_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.1e-37	33.9
WP_024093384.1\|810267_810510_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FJ99	Synechococcus_phage	7.4e-08	35.4
WP_023485275.1\|810583_811279_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_042118586.1\|811256_813500_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.9e-168	44.4
WP_080675796.1\|813484_815059_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.5e-48	31.6
WP_023485273.1\|815153_816200_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	3.3e-68	44.7
WP_024093387.1\|816196_816820_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.0e-26	38.3
WP_042118590.1\|817030_818578_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	7.7e-74	49.8

DBSCAN-SWA_9

826923 : 871206

Paenibacillus_phage(42.86%)

holin,transposase,integrase

attL 824555:824569|attR 830569:830583

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
824555:824569	attL	NA	NA	NA	NA
WP_024093396.1\|826923_828501_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.0e-95	38.0
WP_024093397.1\|828497_829718_-\|integrase	site-specific integrase	S5MNZ2	Brevibacillus_phage	1.1e-120	54.3
WP_024093398.1\|829806_830223_-	ImmA/IrrE family metallo-endopeptidase	S6B1N5	Thermus_phage	5.7e-24	48.1
WP_024093400.1\|831116_831329_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
830569:830583	attR	NA	NA	NA	NA
WP_024093401.1\|831380_831599_-	helix-turn-helix transcriptional regulator	A8ATJ9	Listeria_phage	8.6e-08	46.0
WP_042119457.1\|831690_831888_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024093403.1\|831936_832233_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024093404.1\|832781_833219_+	hypothetical protein	NA	NA	NA	NA
WP_042118594.1\|833340_833973_+	hypothetical protein	A0A0N9RZD8	Paenibacillus_phage	3.7e-83	72.0
WP_042118596.1\|834028_834304_+	hypothetical protein	NA	NA	NA	NA
WP_024093407.1\|834300_835677_+	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	4.4e-73	35.7
WP_042118599.1\|835670_836339_+	hypothetical protein	NA	NA	NA	NA
WP_024093409.1\|836449_836728_-	hypothetical protein	NA	NA	NA	NA
WP_024093410.1\|836837_837032_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|837151_838375_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093411.1\|838551_839220_+	hypothetical protein	NA	NA	NA	NA
WP_024093412.1\|839191_839470_-	hypothetical protein	NA	NA	NA	NA
WP_024093413.1\|840133_841213_+	replication initiation factor domain-containing protein	NA	NA	NA	NA
WP_024093414.1\|841244_841727_+	DUF5348 domain-containing protein	NA	NA	NA	NA
WP_024093415.1\|841772_842348_+	sce7726 family protein	A0A1X9I9R5	Staphylococcus_phage	4.3e-06	26.8
WP_042118601.1\|842347_842611_+	DUF3895 domain-containing protein	NA	NA	NA	NA
WP_024093417.1\|842631_842982_+	hypothetical protein	NA	NA	NA	NA
WP_024093418.1\|843085_843574_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024093419.1\|843614_844247_+	replication initiation factor domain-containing protein	NA	NA	NA	NA
WP_024093420.1\|844325_844751_+	hypothetical protein	A0A0N9RRE2	Paenibacillus_phage	3.8e-07	91.7
WP_042118607.1\|845002_845191_+	hypothetical protein	NA	NA	NA	NA
WP_024093422.1\|845195_845402_+	hypothetical protein	R9VYB0	Paenibacillus_phage	1.5e-22	67.6
WP_024093423.1\|845431_845692_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_042118610.1\|845811_846138_+	hypothetical protein	NA	NA	NA	NA
WP_144083292.1\|846112_846313_+	hypothetical protein	NA	NA	NA	NA
WP_052337384.1\|846648_846960_+	hypothetical protein	NA	NA	NA	NA
WP_052337385.1\|846934_847150_+	hypothetical protein	A0A0Y0ATQ5	Bacillus_phage	1.9e-07	42.2
WP_042118613.1\|847234_847465_+	hypothetical protein	NA	NA	NA	NA
WP_024093429.1\|847468_848395_+	hypothetical protein	NA	NA	NA	NA
WP_158442224.1\|848453_848621_+	hypothetical protein	NA	NA	NA	NA
WP_024093430.1\|848659_851251_+	hypothetical protein	NA	NA	NA	NA
WP_042118615.1\|851321_851711_+	hypothetical protein	NA	NA	NA	NA
WP_024093432.1\|851724_852081_+	hypothetical protein	NA	NA	NA	NA
WP_024093433.1\|852085_852778_+	flagella assembly protein J	NA	NA	NA	NA
WP_042118617.1\|852792_853884_+	type II/IV secretion system ATPase subunit	NA	NA	NA	NA
WP_052337386.1\|853901_854630_+	hypothetical protein	NA	NA	NA	NA
WP_144083293.1\|854732_855641_+	conjugal transfer protein	NA	NA	NA	NA
WP_042118622.1\|855643_855859_+	hypothetical protein	NA	NA	NA	NA
WP_024093437.1\|855859_856297_+	hypothetical protein	NA	NA	NA	NA
WP_042118625.1\|856274_858770_+	ATP-binding protein	NA	NA	NA	NA
WP_148295690.1\|860708_861173_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_193373149.1\|861730_862159_+	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	2.2e-31	51.7
WP_024093441.1\|862160_862709_+	hypothetical protein	NA	NA	NA	NA
WP_077584997.1\|862805_862892_+\|holin	putative holin-like toxin	A0A0K2CZR6	Paenibacillus_phage	2.0e-05	100.0
WP_024093442.1\|863202_863688_-	hypothetical protein	NA	NA	NA	NA
WP_024093443.1\|863779_864289_+	hypothetical protein	NA	NA	NA	NA
WP_024093445.1\|864787_867064_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_023483236.1\|867291_868515_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118629.1\|868679_869342_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080675800.1\|870551_870710_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_158442225.1\|870762_871206_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_10

878169 : 921995

Paenibacillus_phage(53.85%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|878169_879393_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093457.1\|880945_881971_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	6.7e-18	24.3
WP_077996042.1\|881876_882755_+	ABC-2 family transporter protein	NA	NA	NA	NA
WP_024093459.1\|882759_883557_+	ABC-2 family transporter protein	NA	NA	NA	NA
WP_024093460.1\|884284_886168_+	molecular chaperone HtpG	A0A1V0SAD6	Catovirus	3.6e-94	34.4
WP_023483236.1\|886367_887591_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118638.1\|888000_889053_-	Fic family protein	NA	NA	NA	NA
WP_023484171.1\|889443_890391_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-24	32.4
WP_024093462.1\|890567_891722_+	ABC transporter permease	NA	NA	NA	NA
WP_104932478.1\|891727_892147_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_023484174.1\|892143_893094_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_024093464.1\|893086_893833_+	3-oxoacyl-ACP reductase FabG	W8CYX9	Bacillus_phage	4.9e-10	46.1
WP_023483236.1\|894042_895266_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093465.1\|895351_895639_+	acyl carrier protein	NA	NA	NA	NA
WP_024093466.1\|895645_896134_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_024093467.1\|896130_898929_+	acetyltransferase	NA	NA	NA	NA
WP_104932516.1\|898996_900041_+\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_023484160.1\|900091_901138_+	aminomethyl transferase family protein	NA	NA	NA	NA
WP_023484159.1\|901149_903597_+	beta-ketoacyl-[acyl-carrier-protein] synthase family protein	NA	NA	NA	NA
WP_051428085.1\|904582_904774_+	hypothetical protein	NA	NA	NA	NA
WP_024093470.1\|904895_906245_+	carbohydrate binding domain-containing protein	A0A1V0E026	Clostridioides_phage	9.7e-49	37.8
WP_023483236.1\|906460_907684_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_051427882.1\|908516_908717_+	ABC transporter permease	NA	NA	NA	NA
WP_024093473.1\|908907_909504_+	hypothetical protein	NA	NA	NA	NA
WP_042118641.1\|909605_910814_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_024093475.1\|910833_912306_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_023483236.1\|912653_913877_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_080675803.1\|913922_914129_+	ETX/MTX2 family pore-forming toxin	NA	NA	NA	NA
WP_096761175.1\|914176_914512_-\|transposase	transposase	NA	NA	NA	NA
WP_158442227.1\|914529_915042_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_052337389.1\|916240_917803_+	metallophosphoesterase	NA	NA	NA	NA
WP_024092920.1\|917795_919019_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_023483236.1\|920771_921995_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_11

1002814 : 1097068

101

Paenibacillus_phage(63.64%)

tRNA,transposase,protease,coat,terminase,integrase

attL 1031798:1031857|attR 1077319:1078707

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483874.1\|1002814_1005259_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	70.7
WP_024093537.1\|1005262_1006090_-	late competence protein ComER	NA	NA	NA	NA
WP_077585014.1\|1006219_1006792_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_036656460.1\|1006890_1008183_+	homocysteine synthase	A0A0B5JD48	Pandoravirus	8.5e-18	27.8
WP_023483878.1\|1008208_1008721_+	dCMP deaminase family protein	A0A222YXY3	Mycobacterium_phage	3.5e-23	44.9
WP_052337397.1\|1008778_1010677_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_023483880.1\|1010688_1011921_-\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	4.8e-180	75.1
WP_023483881.1\|1011988_1012714_-	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	1.5e-11	42.2
WP_042118682.1\|1012988_1013198_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	6.3e-08	44.3
WP_077585012.1\|1013337_1014162_+	phage antirepressor KilAC domain-containing protein	A0A0C5AFE7	Paenibacillus_phage	1.1e-130	94.7
WP_077585011.1\|1014094_1014355_+	helix-turn-helix domain-containing protein	A0A0K2CZS5	Paenibacillus_phage	1.5e-35	85.9
WP_024093542.1\|1014370_1014631_+	hypothetical protein	NA	NA	NA	NA
WP_158442230.1\|1014607_1014763_-	hypothetical protein	NA	NA	NA	NA
WP_042118685.1\|1014963_1015341_+	hypothetical protein	R9VW30	Paenibacillus_phage	3.8e-59	89.6
WP_024093545.1\|1015337_1015559_+	hypothetical protein	R9W0P6	Paenibacillus_phage	5.6e-31	91.8
WP_023485299.1\|1015696_1015930_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	S5MA41	Brevibacillus_phage	5.8e-18	49.3
WP_024093546.1\|1015959_1016124_+	hypothetical protein	NA	NA	NA	NA
WP_024093547.1\|1016152_1016908_+	phage antirepressor KilAC domain-containing protein	A0A0C5AEJ9	Bacteriophage	1.5e-107	76.5
WP_023485301.1\|1016904_1017213_+	hypothetical protein	NA	NA	NA	NA
WP_024093548.1\|1017248_1017437_+	hypothetical protein	NA	NA	NA	NA
WP_080675807.1\|1017433_1018210_+	ORF6N domain-containing protein	A0A2I7SCV5	Paenibacillus_phage	1.8e-55	73.8
WP_042118689.1\|1018224_1018416_+	hypothetical protein	NA	NA	NA	NA
WP_024093551.1\|1018452_1018716_+	hypothetical protein	A0A0K2CZE9	Paenibacillus_phage	2.2e-13	56.3
WP_024093552.1\|1018723_1019155_+	hypothetical protein	A0A0K2CYQ7	Paenibacillus_phage	8.5e-07	53.7
WP_024093553.1\|1019151_1019730_+\|protease	spore protease YyaC	G3M9W0	Bacillus_virus	1.2e-24	41.2
WP_023485305.1\|1019799_1021428_+	hypothetical protein	R9TQJ2	Paenibacillus_phage	3.8e-225	76.6
WP_023485306.1\|1021431_1022256_+	hypothetical protein	A0A0A7S0A9	Clostridium_phage	1.9e-87	62.8
WP_042118692.1\|1022236_1023049_+	PD-(D/E)XK nuclease-like domain-containing protein	R9TMF6	Paenibacillus_phage	5.4e-111	68.9
WP_024093557.1\|1023445_1024333_+	DnaD domain protein	A0A0K2CY85	Paenibacillus_phage	8.1e-153	100.0
WP_052337398.1\|1024223_1025045_+	ATP-binding protein	A0A0K2CYM7	Paenibacillus_phage	4.9e-120	98.6
WP_036656473.1\|1025163_1025373_+	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	5.0e-29	86.8
WP_042118695.1\|1025374_1025749_+	RusA family crossover junction endodeoxyribonuclease	A0A0K2CYQ8	Paenibacillus_phage	7.6e-44	66.1
WP_024093562.1\|1025939_1026305_+	hypothetical protein	A0A0K2CZ58	Paenibacillus_phage	1.5e-57	86.0
WP_023485190.1\|1026319_1026841_+	hypothetical protein	NA	NA	NA	NA
WP_080675881.1\|1026915_1027581_+	site-specific DNA-methyltransferase	A0A1D8KTH4	Synechococcus_phage	9.3e-61	51.6
WP_023485192.1\|1027674_1027983_+	hypothetical protein	NA	NA	NA	NA
WP_155116272.1\|1028445_1028616_+	hypothetical protein	NA	NA	NA	NA
WP_024093566.1\|1029257_1029461_+	hypothetical protein	A0A0K2CZA1	Paenibacillus_phage	2.9e-26	89.6
WP_023485194.1\|1029958_1030699_+\|terminase	phage-related terminase-like protein small subunit	A0A2H4J4R0	uncultured_Caudovirales_phage	1.4e-44	47.5
WP_024093568.1\|1030691_1031849_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.9e-138	64.2
1031798:1031857	attL	NA	NA	NA	NA
WP_023483236.1\|1031841_1033065_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484913.1\|1033902_1035204_-	hypothetical protein	A0A0K2CP77	Brevibacillus_phage	2.5e-62	35.6
WP_024093569.1\|1035398_1036358_+	hypothetical protein	A0A2I7SCF1	Paenibacillus_phage	2.6e-112	89.9
WP_023484911.1\|1036372_1036735_+	hypothetical protein	A0A2I7SCG2	Paenibacillus_phage	6.4e-48	79.2
WP_023483236.1\|1037203_1038427_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483236.1\|1039185_1040409_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036658506.1\|1040999_1041164_+	FeoB-associated Cys-rich membrane protein	NA	NA	NA	NA
WP_042118705.1\|1041307_1041871_+	peroxiredoxin	NA	NA	NA	NA
WP_042118708.1\|1041882_1043412_+	alkyl hydroperoxide reductase subunit F	A0A2I2L5E1	Orpheovirus	4.3e-37	32.7
WP_144029521.1\|1043713_1044064_+	hypothetical protein	NA	NA	NA	NA
WP_042118716.1\|1044317_1044617_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_023483236.1\|1044745_1045969_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484507.1\|1046318_1046522_+\|coat	spore coat-like protein	NA	NA	NA	NA
WP_024093574.1\|1046540_1046843_+\|coat	spore coat protein	NA	NA	NA	NA
WP_024093577.1\|1049047_1049401_+	BMC domain-containing protein	NA	NA	NA	NA
WP_024093578.1\|1049412_1049814_+	EutP/PduV family microcompartment system protein	NA	NA	NA	NA
WP_024093579.1\|1050078_1050651_+	ANTAR domain-containing response regulator	NA	NA	NA	NA
WP_024093580.1\|1050643_1052068_+	sensor histidine kinase	NA	NA	NA	NA
WP_024093581.1\|1053667_1055032_+	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_023484515.1\|1055053_1056004_+	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_023484516.1\|1056022_1056676_+	ethanolamine utilization microcompartment protein EutL	NA	NA	NA	NA
WP_024093582.1\|1056687_1057428_+	BMC domain-containing protein	NA	NA	NA	NA
WP_024093583.1\|1057578_1059042_+	acetaldehyde dehydrogenase (acetylating)	NA	NA	NA	NA
WP_024093584.1\|1059091_1059379_+	BMC domain-containing protein	NA	NA	NA	NA
WP_036657048.1\|1059523_1060351_+	ethanolamine utilization cobalamin adenosyltransferase	NA	NA	NA	NA
WP_024093586.1\|1060362_1061001_+	phosphate propanoyltransferase	NA	NA	NA	NA
WP_024093587.1\|1061019_1061703_+	putative ethanolamine utilization protein	NA	NA	NA	NA
WP_036655159.1\|1061715_1061988_+	EutN/CcmL family microcompartment protein	NA	NA	NA	NA
WP_036655157.1\|1061980_1062526_+	BMC domain-containing protein	NA	NA	NA	NA
WP_024093589.1\|1062545_1063661_+	ethanolamine utilization protein EutH	NA	NA	NA	NA
WP_042118720.1\|1063998_1064838_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_024093592.1\|1064965_1065130_-	hypothetical protein	NA	NA	NA	NA
WP_036655155.1\|1066274_1066469_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023484522.1\|1066802_1067264_+	hypothetical protein	A0A0K2CP77	Brevibacillus_phage	2.0e-22	30.5
WP_144029556.1\|1068183_1068486_+	hypothetical protein	NA	NA	NA	NA
WP_024093598.1\|1068502_1069027_+	VanZ family protein	NA	NA	NA	NA
WP_051427927.1\|1069096_1069510_+	hypothetical protein	NA	NA	NA	NA
WP_023484526.1\|1069781_1070084_-	hypothetical protein	NA	NA	NA	NA
WP_023484527.1\|1070469_1070907_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_024093599.1\|1071181_1071820_+	transcriptional regulator	NA	NA	NA	NA
WP_024093601.1\|1072108_1073170_+	selenide, water dikinase SelD	NA	NA	NA	NA
WP_042118723.1\|1073224_1074277_+\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
WP_024093603.1\|1074537_1075008_+	hypothetical protein	NA	NA	NA	NA
WP_024093604.1\|1075070_1075448_+	YtxH domain-containing protein	NA	NA	NA	NA
WP_077585253.1\|1075494_1075641_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|1076110_1077334_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_077585252.1\|1077617_1078142_-	GNAT family N-acetyltransferase	D0R097	Streptococcus_phage	1.0e-06	28.3
WP_023483236.1\|1079811_1081035_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
1077319:1078707	attR	NA	NA	NA	NA
WP_024093610.1\|1082124_1083423_+	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
WP_158442231.1\|1083724_1083982_-	metallophosphoesterase	NA	NA	NA	NA
WP_024093613.1\|1084725_1085949_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	2.4e-227	99.8
WP_158442232.1\|1086030_1086669_+	ETX/MTX2 family pore-forming toxin	A0A2I7SC07	Paenibacillus_phage	4.1e-98	90.5
WP_023483236.1\|1087549_1088773_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118727.1\|1089214_1089655_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_042118729.1\|1089692_1090877_+	MFS transporter	NA	NA	NA	NA
WP_023483961.1\|1091050_1091857_+	glutamate racemase	NA	NA	NA	NA
WP_023483960.1\|1091962_1093165_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_024093618.1\|1093249_1093558_+	hypothetical protein	NA	NA	NA	NA
WP_024093619.1\|1093683_1093965_+	hypothetical protein	NA	NA	NA	NA
WP_024093620.1\|1093998_1094190_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1095844_1097068_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_12

1130489 : 1186888

Paenibacillus_phage(35.71%)

transposase,integrase

attL 1130370:1130429|attR 1185545:1186932

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1130370:1130429	attL	NA	NA	NA	NA
WP_023483236.1\|1130489_1131713_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483928.1\|1131922_1132498_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_024093646.1\|1132795_1133464_-	DUF4247 domain-containing protein	NA	NA	NA	NA
WP_024093647.1\|1133492_1134026_-	DUF4178 domain-containing protein	NA	NA	NA	NA
WP_023483925.1\|1134454_1135915_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.4e-61	38.2
WP_024093649.1\|1136030_1136750_+	DUF624 domain-containing protein	NA	NA	NA	NA
WP_023483923.1\|1137209_1137866_+	fructose-6-phosphate aldolase	A0A0E3F5V4	Synechococcus_phage	1.1e-50	47.7
WP_023483922.1\|1137901_1138909_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_023483236.1\|1140532_1141756_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036655118.1\|1142104_1142494_+	DUF1499 domain-containing protein	NA	NA	NA	NA
WP_023483919.1\|1142578_1143097_-	thiol peroxidase	NA	NA	NA	NA
WP_024093650.1\|1143242_1144172_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_080675885.1\|1144189_1144855_-	zinc metallopeptidase	NA	NA	NA	NA
WP_036655114.1\|1144915_1145332_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_023483236.1\|1145496_1146720_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_158225771.1\|1147024_1147450_-	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_036655110.1\|1147543_1148857_-	MFS transporter	NA	NA	NA	NA
WP_096761302.1\|1149100_1149580_+	TlpA family protein disulfide reductase	A0A2I2L415	Orpheovirus	8.0e-06	33.9
WP_104932481.1\|1149807_1151325_-	citramalate synthase	NA	NA	NA	NA
WP_036655106.1\|1151536_1152829_+	DNA polymerase IV	A0A290GHP0	Caldibacillus_phage	8.8e-23	33.2
WP_024093655.1\|1152908_1153142_+	ferredoxin	A0A127AYY7	Bacillus_phage	2.3e-14	50.6
WP_024093656.1\|1153257_1154760_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_024093657.1\|1154913_1155063_-	hypothetical protein	NA	NA	NA	NA
WP_024093658.1\|1155243_1156341_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_024093659.1\|1156367_1157174_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_023483906.1\|1157170_1157590_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_036657018.1\|1157810_1158536_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_024093660.1\|1158563_1159367_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_042119488.1\|1159419_1160940_+	MFS transporter	NA	NA	NA	NA
WP_024093662.1\|1161092_1161596_+	hypothetical protein	NA	NA	NA	NA
WP_052337400.1\|1161571_1161856_+	hypothetical protein	NA	NA	NA	NA
WP_144083298.1\|1161821_1162040_+	hypothetical protein	NA	NA	NA	NA
WP_023483901.1\|1162165_1162483_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	4.5e-21	45.7
WP_024093664.1\|1162600_1162870_+	hypothetical protein	NA	NA	NA	NA
WP_042119489.1\|1162839_1164216_-	RsmF rRNA methyltransferase first C-terminal domain-containing protein	NA	NA	NA	NA
WP_024093666.1\|1164331_1164979_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_023483897.1\|1166976_1168467_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_042118766.1\|1168515_1169334_-	aquaporin family protein	M1IAZ4	Acanthocystis_turfacea_Chlorella_virus	9.7e-36	38.9
WP_023483895.1\|1169512_1170070_-	glycerol-3-phosphate responsive antiterminator	NA	NA	NA	NA
WP_024093669.1\|1170267_1170687_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	2.3e-12	38.6
WP_024093670.1\|1170932_1171322_-	helix-turn-helix transcriptional regulator	A0A0U4KKM4	Exiguobacterium_phage	2.2e-09	31.4
WP_036655097.1\|1171493_1171700_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024093672.1\|1172244_1173369_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_036657013.1\|1173383_1174685_+	DNA repair exonuclease	NA	NA	NA	NA
WP_024093673.1\|1174681_1177939_+	AAA family ATPase	NA	NA	NA	NA
WP_024093674.1\|1178080_1179013_-	1-phosphofructokinase	NA	NA	NA	NA
WP_024093675.1\|1179086_1179959_-	class II fructose-1,6-bisphosphate aldolase	NA	NA	NA	NA
WP_024093676.1\|1180216_1181014_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_042118769.1\|1181115_1182159_-	membrane protein	NA	NA	NA	NA
WP_023483886.1\|1182276_1182921_+	DedA family protein	NA	NA	NA	NA
WP_024093678.1\|1183078_1183525_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0C5AEA5	Paenibacillus_phage	2.0e-35	53.1
WP_024093679.1\|1183548_1183794_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_042118772.1\|1184054_1184645_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024093681.1\|1184736_1185381_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1185664_1186888_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
1185545:1186932	attR	NA	NA	NA	NA

DBSCAN-SWA_13

1226341 : 1270561

uncultured_Mediterranean_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|1226341_1227565_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118793.1\|1230429_1231935_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	41.0
WP_036658387.1\|1231931_1232588_+	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_036657864.1\|1232602_1233301_+	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_158442258.1\|1233768_1233948_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_024093713.1\|1233992_1234202_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_036657866.1\|1234363_1235002_+	stage V sporulation protein AA	NA	NA	NA	NA
WP_023482597.1\|1234994_1235414_+	stage V sporulation protein AB	NA	NA	NA	NA
WP_104932482.1\|1235514_1237272_+	spore germination protein	NA	NA	NA	NA
WP_023482599.1\|1237393_1238731_+	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_023483236.1\|1239018_1240242_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023482600.1\|1240351_1240789_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.6e-21	45.3
WP_036658391.1\|1241733_1242846_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.2e-52	35.5
WP_023482602.1\|1242849_1243515_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.4e-39	43.3
WP_042118800.1\|1243549_1244779_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	8.1e-111	51.0
WP_024093718.1\|1244813_1245284_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.2e-43	57.9
WP_036657869.1\|1245714_1246497_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.7e-09	34.2
WP_036658393.1\|1246465_1247107_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	8.2e-14	31.9
WP_158442234.1\|1247497_1247980_+	DUF2953 domain-containing protein	NA	NA	NA	NA
WP_023482608.1\|1248059_1248566_+	GerW family sporulation protein	NA	NA	NA	NA
WP_024093720.1\|1248686_1249988_-	ArsB/NhaD family transporter	NA	NA	NA	NA
WP_024093721.1\|1250227_1251415_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.4e-19	31.4
WP_024093722.1\|1251439_1252030_+	spore maturation protein A	NA	NA	NA	NA
WP_024093723.1\|1252045_1252579_+	spore maturation protein	NA	NA	NA	NA
WP_036657872.1\|1252669_1253008_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_023482614.1\|1253027_1253777_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_042118804.1\|1253842_1254409_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_024093725.1\|1254423_1256094_+	cytochrome c biogenesis protein ResB	NA	NA	NA	NA
WP_024093726.1\|1256090_1257335_+	c-type cytochrome biogenesis protein CcsB	NA	NA	NA	NA
WP_023482618.1\|1257410_1258124_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-49	43.3
WP_024093727.1\|1258125_1259979_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	5.4e-34	34.8
WP_042119491.1\|1260102_1261686_-	phosphoglycerate dehydrogenase	A0A2R8FDS8	Brazilian_cedratvirus	9.0e-46	35.3
WP_023482621.1\|1262150_1262639_-	inorganic diphosphatase	A0A1B1ISK6	uncultured_Mediterranean_phage	6.2e-30	41.8
WP_023482622.1\|1262825_1263143_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_036658398.1\|1263162_1263756_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_036657880.1\|1264156_1264456_+	hypothetical protein	NA	NA	NA	NA
WP_023482625.1\|1264680_1265289_+	genetic competence negative regulator	NA	NA	NA	NA
WP_024093731.1\|1265425_1266676_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_023482627.1\|1266716_1267406_+\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA
WP_024093732.1\|1267469_1267628_+	hypothetical protein	NA	NA	NA	NA
WP_024093733.1\|1267807_1269160_+	germination protein YpeB	NA	NA	NA	NA
WP_023483236.1\|1269337_1270561_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_14

1341017 : 1415241

Paenibacillus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024093784.1\|1341017_1342316_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.3e-61	30.5
WP_023482697.1\|1342340_1343012_+	DnaD domain-containing protein	A0A0N7AE27	Bacillus_phage	8.9e-19	46.1
WP_024093785.1\|1343096_1343765_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_023483236.1\|1344053_1345277_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023482699.1\|1345352_1346018_-	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
WP_024093787.1\|1346663_1347929_-	2,3-diketo-5-methylthiopentyl-1-phosphate enolase	NA	NA	NA	NA
WP_042118841.1\|1348004_1348862_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_024093789.1\|1349004_1350252_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	8.3e-103	50.4
WP_024093790.1\|1350273_1351395_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.4e-79	43.1
WP_042118843.1\|1353163_1354009_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_167552518.1\|1354483_1355524_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	3.6e-51	48.8
WP_036658421.1\|1355953_1356376_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_036657929.1\|1356456_1356792_+	STAS domain-containing protein	NA	NA	NA	NA
WP_023482710.1\|1356812_1357262_+	anti-sigma B factor RsbW	NA	NA	NA	NA
WP_024093796.1\|1357258_1358041_+	sigma-70 family RNA polymerase sigma factor	A0A173GBT3	Bacillus_phage	1.2e-14	26.0
WP_023482712.1\|1358361_1359270_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_042118848.1\|1359417_1360839_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_024093798.1\|1360868_1361477_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_042118850.1\|1361694_1363029_+	N-acetylmuramoyl-L-alanine amidase	Q0H257	Geobacillus_phage	1.4e-20	39.7
WP_023482716.1\|1363042_1363630_+	GerMN domain-containing protein	NA	NA	NA	NA
WP_024093801.1\|1363849_1364515_+	endonuclease III	NA	NA	NA	NA
WP_024093802.1\|1364576_1364849_+	hypothetical protein	NA	NA	NA	NA
WP_052337405.1\|1364902_1368583_+	dynamin family protein	NA	NA	NA	NA
WP_024093806.1\|1370254_1371067_+	exported lipase-like protein	NA	NA	NA	NA
WP_023482722.1\|1371114_1372092_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.0e-36	36.4
WP_036658426.1\|1372084_1373077_+	ABC transporter permease	NA	NA	NA	NA
WP_023482724.1\|1373104_1375078_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.7e-126	42.5
WP_042118854.1\|1375139_1377599_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	4.3e-111	35.0
WP_042119500.1\|1377663_1378500_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024093809.1\|1378716_1379295_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_023483236.1\|1379301_1380525_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_052337406.1\|1380651_1381116_+	hypothetical protein	NA	NA	NA	NA
WP_024093811.1\|1381160_1382093_+	aldo/keto reductase	NA	NA	NA	NA
WP_024093812.1\|1382112_1383261_-	ABC transporter permease	NA	NA	NA	NA
WP_104932484.1\|1383278_1384136_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-24	32.3
WP_036657937.1\|1384232_1384988_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_023482734.1\|1385003_1385702_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-12	22.5
WP_023482735.1\|1385698_1386091_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_024093815.1\|1386278_1386515_-	hypothetical protein	NA	NA	NA	NA
WP_036658430.1\|1386747_1386978_+	hypothetical protein	NA	NA	NA	NA
WP_036657941.1\|1386974_1387505_+	hypothetical protein	NA	NA	NA	NA
WP_024093817.1\|1387655_1387907_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1389221_1390445_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024093819.1\|1390678_1399075_+	glycosyltransferase family 36 protein	NA	NA	NA	NA
WP_144083301.1\|1400832_1401021_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1401347_1402571_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036657950.1\|1403366_1403771_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_023482813.1\|1403781_1404513_-	RNA pseudouridine synthase	NA	NA	NA	NA
WP_024093823.1\|1404516_1405383_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_024093824.1\|1405586_1407521_+	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_023482817.1\|1407517_1408666_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_023482818.1\|1408672_1409782_+	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_042118863.1\|1409812_1411258_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_023483236.1\|1412102_1413326_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118866.1\|1413684_1413975_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1414017_1415241_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_15

1576069 : 1630272

Paenibacillus_phage(66.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024093941.1\|1576069_1577359_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.8e-53	31.5
WP_023485109.1\|1578287_1579739_+	amino acid permease	NA	NA	NA	NA
WP_077584971.1\|1580076_1580343_+	hypothetical protein	NA	NA	NA	NA
WP_036654351.1\|1580730_1581354_+	YhbD family protein	NA	NA	NA	NA
WP_024093944.1\|1581462_1581681_+	hypothetical protein	NA	NA	NA	NA
WP_024093945.1\|1582245_1582362_+	hypothetical protein	NA	NA	NA	NA
WP_023485113.1\|1582490_1583387_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_023485114.1\|1583546_1584752_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	3.1e-99	45.1
WP_024093947.1\|1584823_1585495_-	YIP1 family protein	NA	NA	NA	NA
WP_052337410.1\|1585511_1586039_-	stage II sporulation protein M	NA	NA	NA	NA
WP_024093949.1\|1586035_1586230_-	hypothetical protein	NA	NA	NA	NA
WP_024093950.1\|1586230_1586974_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-23	31.8
WP_042118943.1\|1586970_1587684_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1587847_1589071_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023485119.1\|1589541_1589976_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_042119526.1\|1590097_1590697_+	membrane protein	NA	NA	NA	NA
WP_023485122.1\|1591339_1592077_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_024093955.1\|1592361_1593651_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_024093957.1\|1594083_1594986_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_052337411.1\|1595853_1596633_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_024093960.1\|1596721_1597555_+	sugar-phosphatase	NA	NA	NA	NA
WP_036654335.1\|1597763_1598198_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024093962.1\|1598320_1598632_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_042118945.1\|1598793_1599483_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024093964.1\|1599581_1600613_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_024093965.1\|1601012_1602296_+	maltose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042118947.1\|1602378_1603692_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_024093967.1\|1603688_1604534_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_023483510.1\|1604599_1605016_-	DUF1992 domain-containing protein	NA	NA	NA	NA
WP_036656706.1\|1605227_1605695_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024093968.1\|1605761_1606835_+	nitronate monooxygenase	NA	NA	NA	NA
WP_024093969.1\|1607066_1608347_+	hydroxylamine reductase	NA	NA	NA	NA
WP_023483236.1\|1608451_1609675_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483514.1\|1609869_1610796_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_023483515.1\|1611721_1612084_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024093972.1\|1612120_1613596_-	4-hydroxyphenylacetate 3-monooxygenase, oxygenase component	NA	NA	NA	NA
WP_144083307.1\|1614799_1614991_+	hypothetical protein	NA	NA	NA	NA
WP_024093974.1\|1615102_1615981_-	tagatose bisphosphate family class II aldolase	NA	NA	NA	NA
WP_023483519.1\|1616038_1617472_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_024093975.1\|1617471_1618401_-	1-phosphofructokinase	NA	NA	NA	NA
WP_023483521.1\|1618571_1619354_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_023483236.1\|1619426_1620650_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483522.1\|1620833_1621391_+	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_024093977.1\|1621385_1621790_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_036654326.1\|1621782_1622115_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_024093978.1\|1622120_1622693_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_024093979.1\|1622985_1623336_+	hypothetical protein	NA	NA	NA	NA
WP_023483525.1\|1623697_1624456_-	YheC/YheD family protein	NA	NA	NA	NA
WP_023483236.1\|1625936_1627160_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_104932523.1\|1627166_1627307_-	helix-turn-helix transcriptional regulator	A0A0K2CZS1	Paenibacillus_phage	6.5e-09	94.1
WP_052337414.1\|1627532_1629056_+	S8 family serine peptidase	NA	NA	NA	NA
WP_023483236.1\|1629048_1630272_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_16

1635922 : 1685436

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104932485.1\|1635922_1637273_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-95	62.3
WP_024093987.1\|1637385_1637631_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024093988.1\|1638127_1638709_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024093989.1\|1638803_1639670_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023483541.1\|1640371_1641118_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-35	43.6
WP_023483542.1\|1641162_1641585_+	OsmC family protein	NA	NA	NA	NA
WP_051427842.1\|1641704_1642079_+	cyanase	NA	NA	NA	NA
WP_193373146.1\|1642327_1642480_-	hypothetical protein	NA	NA	NA	NA
WP_158442236.1\|1642564_1643428_+	phosphotransferase	NA	NA	NA	NA
WP_144083309.1\|1643582_1643825_+	hypothetical protein	NA	NA	NA	NA
WP_024093994.1\|1643986_1644409_+	hypothetical protein	NA	NA	NA	NA
WP_042118951.1\|1644437_1644632_+	hypothetical protein	NA	NA	NA	NA
WP_024093995.1\|1644743_1645967_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_023483488.1\|1646193_1646826_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_080675819.1\|1648019_1648415_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	3.1e-32	52.8
WP_077584958.1\|1648535_1648742_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_024093998.1\|1648900_1649221_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	7.2e-19	48.1
WP_024093999.1\|1649278_1649578_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_042119539.1\|1650707_1651064_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_036654307.1\|1651084_1651843_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_023484254.1\|1652431_1652986_+	FUSC family protein	NA	NA	NA	NA
WP_080548081.1\|1653712_1653886_-	DUF3951 domain-containing protein	NA	NA	NA	NA
WP_024094003.1\|1654485_1657434_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_023484252.1\|1657436_1657928_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_023484251.1\|1657944_1658748_+	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_024094004.1\|1659050_1660004_+	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.4e-94	55.3
WP_024094005.1\|1659993_1660947_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_023484248.1\|1660940_1661699_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.7e-19	30.8
WP_023484247.1\|1661825_1662743_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024094007.1\|1662965_1663223_+	YqkE family protein	NA	NA	NA	NA
WP_042119545.1\|1663253_1664393_+	lactonase family protein	NA	NA	NA	NA
WP_162471813.1\|1664673_1664829_+	hypothetical protein	NA	NA	NA	NA
WP_023484245.1\|1664949_1665264_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_024094010.1\|1665422_1665902_+	cysteine dioxygenase family protein	NA	NA	NA	NA
WP_036654303.1\|1666052_1666820_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_024094011.1\|1666872_1667028_+	hypothetical protein	NA	NA	NA	NA
WP_023484242.1\|1667045_1667711_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_023484241.1\|1667856_1668270_+	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_024094012.1\|1668272_1669088_+	M56 family metallopeptidase	NA	NA	NA	NA
WP_077585235.1\|1669256_1669892_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_024094013.1\|1669900_1670335_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_023484237.1\|1670377_1671100_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	2.6e-08	26.2
WP_077584953.1\|1671204_1671378_-	hypothetical protein	NA	NA	NA	NA
WP_023484236.1\|1671543_1671918_-	response regulator transcription factor	NA	NA	NA	NA
WP_024094015.1\|1672725_1673181_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_024094016.1\|1673362_1674196_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_036656682.1\|1674207_1674588_+	DUF1634 domain-containing protein	NA	NA	NA	NA
WP_024094018.1\|1674769_1676701_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023484229.1\|1676771_1678289_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_042119547.1\|1678275_1679502_+	peptidoglycan bridge formation glycyltransferase FemA/FemB family protein	NA	NA	NA	NA
WP_080675820.1\|1679617_1679830_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1679840_1681064_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094020.1\|1681367_1682735_+	amino acid permease	NA	NA	NA	NA
WP_077584950.1\|1682855_1684022_+	nitric oxide synthase oxygenase	NA	NA	NA	NA
WP_024093734.1\|1684212_1685436_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8

DBSCAN-SWA_17

1720524 : 1835775

Paenibacillus_phage(42.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|1720524_1721748_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_080675889.1\|1721894_1723790_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023484191.1\|1724213_1725572_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_023483236.1\|1726044_1727268_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036656669.1\|1727484_1728075_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_023484187.1\|1729002_1729830_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024094047.1\|1729922_1737689_+	hybrid non-ribosomal peptide synthetase/type I polyketide synthase	D0R7J2	Paenibacillus_phage	9.5e-64	38.7
WP_024094048.1\|1737727_1746766_+	hybrid non-ribosomal peptide synthetase/type I polyketide synthase	A0A2K9L3I8	Tupanvirus	1.3e-96	26.2
WP_144083310.1\|1746783_1752078_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	4.8e-59	31.0
WP_024094050.1\|1752097_1756096_+	non-ribosomal peptide synthase	A0A2K9KZV5	Tupanvirus	1.3e-69	26.5
WP_024094051.1\|1756142_1759442_+	non-ribosomal peptide synthase	A0A2K9KZV5	Tupanvirus	4.0e-96	26.3
WP_024094052.1\|1759624_1764208_+	type I polyketide synthase	NA	NA	NA	NA
WP_024094053.1\|1764208_1769791_+	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	3.2e-53	39.2
WP_024094054.1\|1769805_1778028_+	non-ribosomal peptide synthase	A0A2K9L3I8	Tupanvirus	6.1e-154	26.5
WP_042118959.1\|1778043_1778985_+	hypothetical protein	NA	NA	NA	NA
WP_042118960.1\|1779001_1782103_+	cyclic peptide export ABC transporter	G1BNF7	Mycobacterium_phage	6.6e-16	27.7
WP_023485312.1\|1782179_1782992_+	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_024094058.1\|1783020_1783290_+	acyl carrier protein	NA	NA	NA	NA
WP_024094059.1\|1783304_1783835_-	antiterminator LoaP	NA	NA	NA	NA
WP_051427829.1\|1784175_1788675_+	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	3.6e-79	24.8
WP_023485315.1\|1788771_1789824_+	HAD-IIIC family phosphatase	NA	NA	NA	NA
WP_024094060.1\|1789829_1790081_+	acyl carrier protein	NA	NA	NA	NA
WP_024094061.1\|1790083_1791253_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_023485317.1\|1791347_1792331_+	2,3-diaminopropionate biosynthesis protein SbnA	C3U2M1	Lactococcus_phage	8.1e-29	30.2
WP_024094062.1\|1792356_1793325_+	2,3-diaminopropionate biosynthesis protein SbnB	NA	NA	NA	NA
WP_023485319.1\|1793396_1794167_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_144083311.1\|1794330_1794471_+	amidohydrolase	NA	NA	NA	NA
WP_024094063.1\|1794792_1795656_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_023485323.1\|1796508_1797387_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_024094064.1\|1797444_1798983_+	DUF4127 family protein	A0A218KDG5	Bacillus_phage	4.8e-36	27.4
WP_023485325.1\|1799049_1800912_-	asparagine synthase (glutamine-hydrolyzing)	A0A2I2L3T4	Orpheovirus	1.0e-32	24.7
WP_024094065.1\|1801051_1801945_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024094066.1\|1802201_1802960_+	YheC/YheD family protein	NA	NA	NA	NA
WP_023485328.1\|1802981_1803881_+	phosphoenolpyruvate mutase	NA	NA	NA	NA
WP_024094067.1\|1803877_1804774_+	phosphonopyruvate decarboxylase	NA	NA	NA	NA
WP_023483236.1\|1804878_1806102_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083312.1\|1807314_1807503_+	CBS domain-containing protein	NA	NA	NA	NA
WP_024094069.1\|1807568_1811039_+	CoA-substrate-specific enzyme activase	NA	NA	NA	NA
WP_024094070.1\|1813052_1813427_+	YxeA family protein	NA	NA	NA	NA
WP_023484562.1\|1814067_1815450_+	amino acid permease	NA	NA	NA	NA
WP_024094071.1\|1815608_1816811_-	MFS transporter	NA	NA	NA	NA
WP_036654217.1\|1816833_1817415_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_024094073.1\|1817587_1818172_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_023483236.1\|1818436_1819660_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094074.1\|1819786_1820137_+	hypothetical protein	NA	NA	NA	NA
WP_024094075.1\|1820139_1820454_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_144083313.1\|1821972_1822233_+	hypothetical protein	NA	NA	NA	NA
WP_144083314.1\|1822196_1822868_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_024094080.1\|1823603_1824476_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_042118962.1\|1826314_1827097_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_023483236.1\|1828297_1829521_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094087.1\|1829702_1830170_+	hypothetical protein	NA	NA	NA	NA
WP_024094088.1\|1830237_1831050_+	hypothetical protein	NA	NA	NA	NA
WP_023484571.1\|1831036_1831843_+	hypothetical protein	NA	NA	NA	NA
WP_024094089.1\|1831839_1832643_+	hypothetical protein	NA	NA	NA	NA
WP_036654223.1\|1832655_1833306_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.4e-31	38.3
WP_024094090.1\|1833302_1834301_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1834551_1835775_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_18

1882527 : 1940440

Paenibacillus_phage(73.33%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104932487.1\|1882527_1883572_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_023483236.1\|1883649_1884873_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118965.1\|1884937_1886431_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_036656629.1\|1886514_1887078_-	hypothetical protein	NA	NA	NA	NA
WP_024094102.1\|1887202_1888099_-	cation transporter	NA	NA	NA	NA
WP_024094104.1\|1889081_1889450_+	hypothetical protein	NA	NA	NA	NA
WP_024094105.1\|1889640_1890375_-	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_023484542.1\|1890430_1891216_-	delta-lactam-biosynthetic de-N-acetylase	NA	NA	NA	NA
WP_024094106.1\|1891329_1892847_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_104932525.1\|1892925_1893942_-	amidase domain-containing protein	NA	NA	NA	NA
WP_023484539.1\|1894516_1894789_-	barstar family protein	NA	NA	NA	NA
WP_023483236.1\|1895412_1896636_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094111.1\|1897131_1898562_-	MBL fold metallo-hydrolase	A0A2N9QVZ6	Dishui_lake_phycodnavirus	1.3e-06	36.6
WP_036654194.1\|1898636_1899836_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023483236.1\|1900867_1902091_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094115.1\|1903488_1904547_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_024094116.1\|1904661_1905678_+	NTP transferase domain-containing protein	K7QKA7	Escherichia_phage	8.7e-26	33.5
WP_023483236.1\|1905746_1906970_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_104932488.1\|1908015_1908243_-	hypothetical protein	NA	NA	NA	NA
WP_023484729.1\|1908332_1909106_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_024094118.1\|1909383_1910598_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.3e-225	99.3
WP_080675823.1\|1910828_1911356_-	SIS domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|1911414_1912638_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119567.1\|1912680_1913016_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_024094119.1\|1913051_1913732_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_024094120.1\|1913736_1915269_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_023483236.1\|1915478_1916702_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484736.1\|1917037_1918156_-	glycosyltransferase-like protein	NA	NA	NA	NA
WP_023484737.1\|1918332_1919160_+	metallophosphoesterase	NA	NA	NA	NA
WP_080548066.1\|1919143_1919647_+	hypothetical protein	NA	NA	NA	NA
WP_042118973.1\|1919607_1921170_-	gluconokinase	NA	NA	NA	NA
WP_042118974.1\|1921204_1922566_-	GntP family permease	NA	NA	NA	NA
WP_024094123.1\|1922676_1923354_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_042118976.1\|1924531_1924849_-	DUF4870 domain-containing protein	A0A2H4JDX0	uncultured_Caudovirales_phage	5.8e-13	45.0
WP_023483236.1\|1925489_1926713_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_077995404.1\|1927851_1928118_-\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_024094127.1\|1928494_1928641_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1928806_1930030_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094128.1\|1930196_1930967_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	39.2
WP_023483236.1\|1931583_1932807_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094130.1\|1934053_1934602_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023484629.1\|1934835_1936008_+	oxalate decarboxylase family bicupin	NA	NA	NA	NA
WP_023484628.1\|1936091_1936520_-	cell wall hydrolase	NA	NA	NA	NA
WP_024094131.1\|1936686_1937076_-	DoxX family protein	NA	NA	NA	NA
WP_051427817.1\|1938276_1938582_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_024094134.1\|1938811_1939078_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|1939216_1940440_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_19

1945561 : 2019345

Paenibacillus_phage(46.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|1945561_1946785_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118982.1\|1947194_1948025_+	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_024094142.1\|1948715_1950083_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_023483236.1\|1950475_1951699_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042118983.1\|1953216_1953909_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-46	42.2
WP_042118984.1\|1957055_1957514_-	flavodoxin	A7KUZ7	Bacillus_phage	6.5e-13	31.6
WP_042119570.1\|1957723_1959058_-	magnesium transporter	NA	NA	NA	NA
WP_024094146.1\|1959165_1961814_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	4.0e-38	24.9
WP_023484611.1\|1963014_1963332_+	multifunctional tetracycline-metal/hydrogen antiporter-like protein	NA	NA	NA	NA
WP_024094150.1\|1963584_1964826_-	lipase Lip	NA	NA	NA	NA
WP_024094151.1\|1965078_1967379_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_023484608.1\|1967964_1969047_+	tyrosine recombinase XerS	A0A2R2ZGM9	Clostridioides_phage	3.9e-08	25.6
WP_024094152.1\|1969108_1970863_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-61	31.7
WP_024094153.1\|1971033_1971837_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_023484605.1\|1971843_1972473_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042119572.1\|1972565_1975259_-	pyruvate, phosphate dikinase	A0A2D2W2B1	Stenotrophomonas_phage	1.2e-95	40.6
WP_024094155.1\|1975258_1975423_-	GapA-binding peptide SR1P	NA	NA	NA	NA
WP_024094156.1\|1975704_1976940_-	MFS transporter	NA	NA	NA	NA
WP_024094157.1\|1977169_1978699_-	fumarate hydratase	NA	NA	NA	NA
WP_024094158.1\|1978785_1979679_-	isocitrate lyase/phosphoenolpyruvate mutase family protein	NA	NA	NA	NA
WP_023484600.1\|1979699_1980695_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_024094159.1\|1980716_1981922_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_024094160.1\|1981918_1983154_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_024092920.1\|1983214_1984438_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_024094161.1\|1984713_1985196_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_023483236.1\|1985555_1986779_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094163.1\|1989935_1990994_+	DctP family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_023484594.1\|1991251_1992529_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_042118988.1\|1992697_1993624_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_023484592.1\|1993627_1994059_-	NfeD family protein	NA	NA	NA	NA
WP_023483236.1\|1995726_1996950_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484590.1\|1997174_1998056_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_036654129.1\|1998082_1998745_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_042118989.1\|1999213_2007607_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.4e-92	26.1
WP_042119574.1\|2007628_2010850_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.3e-83	26.2
WP_096761293.1\|2013015_2013195_-\|transposase	transposase	NA	NA	NA	NA
WP_024094172.1\|2013769_2013955_-	hypothetical protein	NA	NA	NA	NA
WP_158442238.1\|2014470_2015361_+	DUF3471 domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|2015588_2016812_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119576.1\|2017211_2018201_+	metallophosphoesterase	NA	NA	NA	NA
WP_104932490.1\|2018382_2019345_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	6.9e-57	51.1

DBSCAN-SWA_20

2050652 : 2102816

Paenibacillus_phage(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024093891.1\|2050652_2051876_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
WP_024094200.1\|2052198_2053161_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	2.5e-38	34.0
WP_023483094.1\|2053307_2054327_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.7e-17	30.2
WP_023483095.1\|2054313_2055240_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-20	33.2
WP_036654095.1\|2055253_2056219_+	ABC transporter permease	NA	NA	NA	NA
WP_023483097.1\|2056237_2057143_+	ABC transporter permease	NA	NA	NA	NA
WP_024094202.1\|2057157_2058957_+	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023483099.1\|2059117_2060149_-	ribonucleotide-diphosphate reductase subunit beta	A0A127AVZ3	Bacillus_phage	1.3e-90	46.7
WP_046655160.1\|2060203_2062483_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0Y0AS84	Bacillus_phage	1.5e-267	65.1
WP_104932526.1\|2062719_2063765_-\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	4.6e-06	20.9
WP_042119003.1\|2064387_2065572_-	SIS domain-containing protein	NA	NA	NA	NA
WP_042119005.1\|2065625_2066396_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_023483236.1\|2066460_2067684_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094206.1\|2067676_2068570_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_052337428.1\|2068755_2071302_+	beta-N-acetylglucosaminidase domain-containing protein	NA	NA	NA	NA
WP_024094209.1\|2073362_2074175_-	DUF2935 domain-containing protein	A0A2I2L551	Orpheovirus	7.9e-38	37.2
WP_024094210.1\|2074316_2075720_-	aspartate ammonia-lyase	NA	NA	NA	NA
WP_024094211.1\|2075796_2076075_-	hypothetical protein	NA	NA	NA	NA
WP_042119006.1\|2076273_2076963_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_104932490.1\|2076878_2077841_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	6.9e-57	51.1
WP_023484814.1\|2077990_2079718_-	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_023484813.1\|2079714_2080914_-	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.8e-30	39.5
WP_023484812.1\|2081213_2081792_+	transcriptional regulator	NA	NA	NA	NA
WP_052337480.1\|2082043_2083543_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_023484810.1\|2083592_2084765_-	stage II sporulation protein P	NA	NA	NA	NA
WP_036654081.1\|2084780_2084960_-	hypothetical protein	NA	NA	NA	NA
WP_024094215.1\|2086015_2086861_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_024094216.1\|2086876_2087836_-	glycerophosphodiester phosphodiesterase family protein	NA	NA	NA	NA
WP_024094217.1\|2088033_2089257_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
WP_036656585.1\|2089442_2090531_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_024094218.1\|2090727_2091726_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_052337429.1\|2093393_2093726_+	DUF4064 domain-containing protein	NA	NA	NA	NA
WP_024094223.1\|2093722_2093899_+	hypothetical protein	A0A0C5AEJ6	Paenibacillus_phage	8.5e-22	89.7
WP_023483236.1\|2094099_2095323_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_036656580.1\|2096619_2096823_+	YqaE/Pmp3 family membrane protein	A0A2I7SCF5	Paenibacillus_phage	1.6e-27	97.0
WP_024094226.1\|2097024_2097456_+	universal stress protein	NA	NA	NA	NA
WP_024094227.1\|2097694_2098996_-	LCP family protein	NA	NA	NA	NA
WP_023483236.1\|2099215_2100439_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094228.1\|2100880_2101303_-	YlbF family regulator	NA	NA	NA	NA
WP_024094229.1\|2101334_2102816_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA

DBSCAN-SWA_21

2194979 : 2249515

Paenibacillus_phage(39.13%)

tRNA,transposase,integrase,protease

attL 2233900:2233914|attR 2249529:2249543

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172423885.1\|2194979_2196488_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	3.2e-40	27.6
WP_024094291.1\|2196543_2197086_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_024094292.1\|2197264_2198593_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_024094293.1\|2198605_2200696_-	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	1.8e-110	40.9
WP_024094294.1\|2200843_2201212_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|2201314_2202538_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_052337431.1\|2202626_2203271_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	3.8e-27	42.9
WP_023483236.1\|2203415_2204639_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484651.1\|2204847_2205783_-	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
WP_024094296.1\|2205839_2207000_-	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_024094298.1\|2207386_2207647_-	hypothetical protein	NA	NA	NA	NA
WP_024094299.1\|2207678_2208074_-	hypothetical protein	NA	NA	NA	NA
WP_042119030.1\|2208289_2209813_+	YifB family Mg chelatase-like AAA ATPase	NA	NA	NA	NA
WP_024094301.1\|2209910_2210315_-	YraN family protein	NA	NA	NA	NA
WP_023484363.1\|2210324_2210657_-	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_024094302.1\|2210653_2212465_-	hypothetical protein	NA	NA	NA	NA
WP_024094303.1\|2212519_2213203_-	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	9.7e-21	37.7
WP_024094304.1\|2213495_2214377_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_023484359.1\|2214468_2215071_-	signal peptidase I	NA	NA	NA	NA
WP_023484358.1\|2215182_2215524_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_024094305.1\|2215666_2216419_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_024094306.1\|2216415_2216937_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_023484355.1\|2217162_2217393_-	KH domain-containing protein	NA	NA	NA	NA
WP_023484354.1\|2217415_2217688_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_023484353.1\|2217729_2219097_-	signal recognition particle protein	NA	NA	NA	NA
WP_024094307.1\|2219126_2219489_-	putative DNA-binding protein	NA	NA	NA	NA
WP_023484351.1\|2219622_2220630_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_023484350.1\|2220714_2224293_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_024094308.1\|2224461_2225163_-	ribonuclease III	A0A167RGU4	Powai_lake_megavirus	9.3e-27	30.0
WP_024094309.1\|2225342_2226578_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_024094310.1\|2226667_2226901_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	6.0e-07	38.0
WP_024094311.1\|2227019_2227760_-	3-oxoacyl-[acyl-carrier-protein] reductase	Q06VL0	Trichoplusia_ni_ascovirus	5.0e-23	36.4
WP_023484345.1\|2227859_2228795_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_193373152.1\|2228826_2229804_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_024094313.1\|2229823_2230810_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_024094314.1\|2230811_2231405_-	transcription factor FapR	NA	NA	NA	NA
WP_023484341.1\|2231577_2231751_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_024094315.1\|2231869_2232382_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_042119611.1\|2232469_2233543_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_024094317.1\|2233727_2235077_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
2233900:2233914	attL	NA	NA	NA	NA
WP_023484338.1\|2235087_2235597_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.0e-26	39.5
WP_024094318.1\|2235614_2236172_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_024094320.1\|2236721_2236919_-	helix-turn-helix transcriptional regulator	D0R7I7	Paenibacillus_phage	2.4e-09	76.9
WP_024094321.1\|2236983_2237397_+	hypothetical protein	A0A0K2CYM1	Paenibacillus_phage	8.7e-33	98.6
WP_024094322.1\|2237544_2237934_-	hypothetical protein	NA	NA	NA	NA
WP_104932493.1\|2238378_2238825_-	hypothetical protein	NA	NA	NA	NA
WP_024094325.1\|2239195_2240527_-	lytic polysaccharide monooxygenase	A0A2D1GD28	Mycobacterium_phage	4.1e-07	29.3
WP_024094326.1\|2240917_2241160_-	hypothetical protein	A0A2I7SCT4	Paenibacillus_phage	7.3e-32	97.5
WP_080675891.1\|2241169_2241838_-	N-acetylmuramoyl-L-alanine amidase	A0A0K2CXQ8	Paenibacillus_phage	4.4e-127	95.5
WP_024094328.1\|2241837_2242077_-	hypothetical protein	A0A0C5AEG8	Bacteriophage	2.8e-36	100.0
WP_042119035.1\|2245048_2245399_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	8.4e-29	60.0
WP_077584875.1\|2245655_2245982_-	hypothetical protein	A0A0C5AFG5	Paenibacillus_phage	1.6e-45	82.2
WP_024094334.1\|2246093_2246609_+	DUF3231 family protein	NA	NA	NA	NA
WP_042119037.1\|2246691_2246895_-	hypothetical protein	A0A0S2SXP3	Bacillus_phage	6.8e-07	40.0
WP_024094338.1\|2247490_2247715_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_052337432.1\|2247861_2248305_+	LexA family transcriptional regulator	A6XML9	Bacillus_virus	1.0e-10	37.5
WP_052337433.1\|2248311_2248560_+	hypothetical protein	A0A0N9RTK0	Paenibacillus_phage	1.0e-17	53.7
WP_024094340.1\|2248579_2248915_+\|integrase	tyrosine-type recombinase/integrase	S5MNZ2	Brevibacillus_phage	6.8e-12	43.2
WP_052752961.1\|2249029_2249515_+\|integrase	site-specific integrase	S5MNZ2	Brevibacillus_phage	1.7e-27	57.9
2249529:2249543	attR	NA	NA	NA	NA

DBSCAN-SWA_22

2327959 : 2418164

101

Paenibacillus_phage(43.14%)

tail,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|2327959_2329183_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484131.1\|2329895_2330321_-	CoA-binding protein	NA	NA	NA	NA
WP_036658850.1\|2330339_2331131_-	C39 family peptidase	NA	NA	NA	NA
WP_024094395.1\|2331171_2332464_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_042119625.1\|2332590_2332941_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_024094397.1\|2332945_2333332_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_096761131.1\|2333435_2333954_-	shikimate kinase	NA	NA	NA	NA
WP_042119048.1\|2334084_2335320_-	ABC transporter permease	NA	NA	NA	NA
WP_036658354.1\|2335325_2336030_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-13	24.6
WP_042119050.1\|2336367_2336853_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|2337012_2338236_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083318.1\|2338228_2338993_-	hypothetical protein	NA	NA	NA	NA
WP_077584869.1\|2339737_2339839_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_042119627.1\|2340316_2340580_+	hypothetical protein	NA	NA	NA	NA
WP_023485372.1\|2340581_2341994_-	NADP-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	3.9e-32	29.4
WP_024094401.1\|2342670_2342910_-	hypothetical protein	A0A0K2CYG5	Paenibacillus_phage	1.0e-22	67.5
WP_024094402.1\|2343670_2345233_-	peptidase M4 family protein	NA	NA	NA	NA
WP_024094403.1\|2346048_2346534_+	hypothetical protein	A0A0C5AN10	Bacteriophage	1.5e-52	66.2
WP_023483534.1\|2346744_2347494_+	DUF4065 domain-containing protein	A0A0C5ABL3	Bacteriophage	5.1e-92	67.5
WP_024094405.1\|2347701_2348925_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	5.8e-226	99.3
WP_024094406.1\|2349237_2349789_+	hypothetical protein	NA	NA	NA	NA
WP_024094407.1\|2349990_2350473_-	SocA family protein	A0A0N9SGM1	Paenibacillus_phage	1.4e-26	41.3
WP_023483236.1\|2352010_2353234_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094410.1\|2353226_2353631_-	hypothetical protein	NA	NA	NA	NA
WP_023484264.1\|2353650_2354763_-	AAA family ATPase	A0A1S5V1G7	Saudi_moumouvirus	1.5e-15	28.8
WP_024094411.1\|2355075_2355318_-	hypothetical protein	A0A0K2CZD0	Paenibacillus_phage	9.5e-32	96.2
WP_024094412.1\|2355330_2355609_-	hypothetical protein	R9VWV2	Paenibacillus_phage	4.2e-39	80.6
WP_024094415.1\|2356774_2357014_-	hypothetical protein	R9W0N4	Paenibacillus_phage	2.8e-36	100.0
WP_024094416.1\|2357049_2357208_-	hypothetical protein	NA	NA	NA	NA
WP_024094417.1\|2357200_2357596_-	hypothetical protein	NA	NA	NA	NA
WP_024094418.1\|2357608_2359012_-	kelch-like protein	S5MNY5	Brevibacillus_phage	5.4e-10	37.5
WP_024094419.1\|2359015_2359294_-	hypothetical protein	NA	NA	NA	NA
WP_024094420.1\|2359290_2359854_-	DUF2313 domain-containing protein	S5MA71	Brevibacillus_phage	1.8e-36	46.9
WP_024094421.1\|2359864_2360941_-\|plate	baseplate J/gp47 family protein	A0A0K2CP27	Brevibacillus_phage	2.5e-100	52.4
WP_024094422.1\|2360933_2361344_-	DUF2634 domain-containing protein	A0A0A7RTU4	Clostridium_phage	1.1e-27	48.5
WP_024094423.1\|2361346_2361589_-	DUF2577 domain-containing protein	S5MC71	Brevibacillus_phage	9.9e-13	37.6
WP_024094424.1\|2361588_2362572_-	phage cell wall hydrolase	S5MNC9	Brevibacillus_phage	1.0e-103	55.6
WP_024094425.1\|2362576_2363215_-	LysM peptidoglycan-binding domain-containing protein	S5MUH0	Brevibacillus_phage	4.4e-52	50.5
WP_144083319.1\|2363211_2365161_-	hypothetical protein	S5MNW9	Brevibacillus_phage	8.6e-139	46.9
WP_024094427.1\|2365373_2365544_-	hypothetical protein	NA	NA	NA	NA
WP_023485206.1\|2365543_2365969_-	hypothetical protein	X5JAB6	Clostridium_phage	1.6e-26	44.8
WP_024094428.1\|2365995_2366460_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	2.7e-51	62.1
WP_024094429.1\|2366461_2367793_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0K2CNL4	Brevibacillus_phage	2.5e-113	48.7
WP_042119056.1\|2367793_2367976_-	hypothetical protein	NA	NA	NA	NA
WP_023485203.1\|2367968_2368379_-	hypothetical protein	S5MUN8	Brevibacillus_phage	7.8e-26	46.8
WP_024094431.1\|2368375_2368786_-	HK97 gp10 family phage protein	S5MNW5	Brevibacillus_phage	1.4e-38	61.1
WP_024094432.1\|2368785_2369145_-	hypothetical protein	S5M673	Brevibacillus_phage	3.7e-32	54.7
WP_036656482.1\|2369146_2369515_-	hypothetical protein	S5MP25	Brevibacillus_phage	2.1e-30	55.8
WP_024094434.1\|2369501_2369735_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|2370724_2371948_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119629.1\|2372278_2372971_+	response regulator transcription factor	NA	NA	NA	NA
WP_024094437.1\|2372943_2375346_-	polysaccharide lyase 8 family protein	NA	NA	NA	NA
WP_023483599.1\|2375358_2376108_-	SIS domain-containing protein	NA	NA	NA	NA
WP_024094438.1\|2376121_2377294_-	glycoside hydrolase family 88 protein	NA	NA	NA	NA
WP_024094439.1\|2377307_2378024_-	SIS domain-containing protein	NA	NA	NA	NA
WP_023483596.1\|2378043_2378529_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_024094440.1\|2378542_2379334_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_024094441.1\|2379326_2380106_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_024094442.1\|2380117_2380546_-	PTS IIA component	NA	NA	NA	NA
WP_104932495.1\|2381477_2382101_+	DUF1054 domain-containing protein	NA	NA	NA	NA
WP_042119632.1\|2382612_2383881_-	MFS transporter	NA	NA	NA	NA
WP_024094445.1\|2384057_2385527_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_023483588.1\|2385670_2386090_+	DUF1885 family protein	NA	NA	NA	NA
WP_023483587.1\|2386164_2386479_-	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_024094447.1\|2386536_2387547_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_036654741.1\|2387648_2387831_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_042119059.1\|2387837_2388314_-	cytochrome c biogenesis protein CcdC	NA	NA	NA	NA
WP_080675892.1\|2388502_2389237_+	MBL fold metallo-hydrolase	U5PU04	Bacillus_phage	7.9e-45	39.7
WP_024094451.1\|2389367_2389616_-	DUF3892 domain-containing protein	G3MB34	Bacillus_virus	7.1e-06	38.9
WP_024094452.1\|2389772_2391401_+	diguanylate cyclase	NA	NA	NA	NA
WP_096761174.1\|2391406_2391850_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023483236.1\|2392186_2393410_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483580.1\|2393603_2394056_-	divergent PAP2 family protein	NA	NA	NA	NA
WP_023483579.1\|2394211_2394637_+	CBS domain-containing protein	NA	NA	NA	NA
WP_023483578.1\|2394945_2395353_+	hypothetical protein	NA	NA	NA	NA
WP_148295689.1\|2395301_2396165_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-17	31.3
WP_152532817.1\|2396256_2396985_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-18	27.9
WP_152532850.1\|2396950_2397106_+	hypothetical protein	NA	NA	NA	NA
WP_024094454.1\|2397148_2397286_+	hypothetical protein	NA	NA	NA	NA
WP_023483575.1\|2397455_2397977_-	hypothetical protein	NA	NA	NA	NA
WP_023483574.1\|2398051_2398423_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023483236.1\|2398598_2399822_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119637.1\|2400051_2401341_+	NCS2 family permease	NA	NA	NA	NA
WP_024094456.1\|2401622_2402009_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|2402153_2403377_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_080675893.1\|2403995_2405210_-	family 10 glycosylhydrolase	A0A2I7SC76	Paenibacillus_phage	3.2e-27	88.5
WP_024094458.1\|2405844_2406177_-	hypothetical protein	A0A2I7SCG0	Paenibacillus_phage	1.6e-29	89.2
WP_023484756.1\|2406326_2406716_+	hypothetical protein	A0A0K2CZD8	Paenibacillus_phage	6.5e-06	49.3
WP_042119063.1\|2407733_2408066_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|2408072_2409296_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094461.1\|2409360_2409774_+	hypothetical protein	NA	NA	NA	NA
WP_024094463.1\|2410659_2410881_-	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	3.8e-11	44.4
WP_024094464.1\|2411377_2411569_+	hypothetical protein	A0A2I7SC20	Paenibacillus_phage	1.6e-29	98.4
WP_042119065.1\|2411565_2411835_+	hypothetical protein	A0A2I7SC25	Paenibacillus_phage	9.0e-39	98.8
WP_024094466.1\|2411838_2412051_+	hypothetical protein	A0A2I7SC04	Paenibacillus_phage	6.4e-24	78.8
WP_036654757.1\|2412387_2412936_-	hypothetical protein	A0A0C5AEH5	Bacteriophage	1.3e-73	81.4
WP_036654758.1\|2413272_2413773_-	hypothetical protein	R9VWV6	Paenibacillus_phage	7.1e-05	31.7
WP_104932516.1\|2414366_2415411_+\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_024094469.1\|2415944_2416355_+	helix-turn-helix transcriptional regulator	F8J1E0	Lactobacillus_phage	6.6e-09	38.8
WP_024094470.1\|2416386_2416803_+	ImmA/IrrE family metallo-endopeptidase	A0A2P1JU12	Anoxybacillus_phage	4.6e-18	37.0
WP_023483236.1\|2416940_2418164_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_23

2505458 : 2570952

Paenibacillus_phage(28.57%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|2505458_2506682_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094521.1\|2507322_2508438_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_024094522.1\|2508413_2509172_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_024094523.1\|2509175_2510006_-	hypothetical protein	NA	NA	NA	NA
WP_024094524.1\|2510149_2511277_-	RNA polymerase sigma factor RpoD	M4SMP8	Cyanophage	3.8e-38	37.2
WP_024094525.1\|2511323_2513150_-	DNA primase	A0A1S5REW9	Helicobacter_phage	1.8e-42	32.7
WP_023483689.1\|2513192_2513666_-	YaiI/YqxD family protein	NA	NA	NA	NA
WP_024094526.1\|2513747_2514575_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_023483687.1\|2514800_2515553_-	DNA repair protein RecO	NA	NA	NA	NA
WP_104932500.1\|2515594_2515747_-	YqzL family protein	NA	NA	NA	NA
WP_023483686.1\|2515851_2516754_-	GTPase Era	NA	NA	NA	NA
WP_023483685.1\|2516799_2517210_-	cytidine deaminase	NA	NA	NA	NA
WP_024094527.1\|2517226_2517943_-	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_024094528.1\|2517939_2518452_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_036656868.1\|2518543_2520784_-	HDIG domain-containing protein	NA	NA	NA	NA
WP_024094530.1\|2520822_2521794_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	1.8e-49	47.4
WP_023483680.1\|2521812_2522991_-	sporulation protein YqfD	NA	NA	NA	NA
WP_024094531.1\|2523014_2523296_-	sporulation protein YqfC	NA	NA	NA	NA
WP_023483678.1\|2523489_2523930_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.2e-19	40.4
WP_024094532.1\|2523944_2524118_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_036656869.1\|2524264_2524609_-	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_024094534.1\|2527028_2528450_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.6e-38	32.9
WP_024094535.1\|2528436_2529147_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.6e-34	35.7
WP_024094536.1\|2529175_2530546_-	hypothetical protein	NA	NA	NA	NA
WP_052337436.1\|2530741_2531701_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_024094538.1\|2531948_2532692_-	pyruvate formate lyase-activating protein	NA	NA	NA	NA
WP_024094539.1\|2532860_2535125_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.1e-189	44.7
WP_024094540.1\|2535250_2537866_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_023483236.1\|2538083_2539307_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094541.1\|2539547_2540078_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_023483665.1\|2540220_2540832_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_024094542.1\|2541052_2541775_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_024094543.1\|2541941_2542280_-	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_024094544.1\|2542294_2544739_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_024094545.1\|2544912_2546136_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	3.4e-226	99.3
WP_024094546.1\|2546378_2546603_-	hypothetical protein	NA	NA	NA	NA
WP_024094547.1\|2546707_2550160_-	AAA family ATPase	A0A1D8KRV2	Synechococcus_phage	3.5e-10	32.0
WP_024094548.1\|2550173_2551346_-	exonuclease SbcCD subunit D C-terminal domain-containing protein	NA	NA	NA	NA
WP_042119081.1\|2551362_2555538_-	helicase-exonuclease AddAB subunit AddA	G3MA40	Bacillus_virus	2.6e-07	25.1
WP_024094550.1\|2555515_2559118_-	helicase-exonuclease AddAB subunit AddB	NA	NA	NA	NA
WP_024093116.1\|2559585_2560095_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_158442240.1\|2560112_2560547_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023483236.1\|2560628_2561852_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_193373141.1\|2561872_2562022_-	hypothetical protein	NA	NA	NA	NA
WP_024094553.1\|2562305_2562857_-	DinB family protein	NA	NA	NA	NA
WP_036654811.1\|2562903_2563632_-	hypothetical protein	NA	NA	NA	NA
WP_024094555.1\|2563904_2564171_+	hypothetical protein	NA	NA	NA	NA
WP_023483654.1\|2564224_2564761_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023483653.1\|2564852_2566217_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	4.8e-19	22.2
WP_023483652.1\|2566394_2567405_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_042119648.1\|2567416_2567842_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_024094558.1\|2567989_2569339_-\|tRNA	tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB	NA	NA	NA	NA
WP_024094559.1\|2569341_2570109_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_023483648.1\|2570274_2570952_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_24

2589666 : 2646057

Paenibacillus_phage(50.0%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024092852.1\|2589666_2590890_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
WP_024094572.1\|2590978_2593507_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_023483236.1\|2593979_2595203_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083321.1\|2595311_2595590_-	hypothetical protein	M1PSD2	Streptococcus_phage	2.7e-14	54.2
WP_024094574.1\|2596029_2596269_-	hypothetical protein	A0A0K2CYG5	Paenibacillus_phage	3.0e-22	66.2
WP_024094402.1\|2597029_2598592_-	peptidase M4 family protein	NA	NA	NA	NA
WP_144083322.1\|2599341_2599893_+	hypothetical protein	A0A0C5AN10	Bacteriophage	1.7e-52	66.2
WP_024094575.1\|2600095_2601319_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	6.8e-227	99.5
WP_023484146.1\|2602590_2603547_-	ribonuclease Z	NA	NA	NA	NA
WP_024094577.1\|2603721_2607162_-	methionine synthase	A0A140XBC7	Dickeya_phage	5.1e-09	46.7
WP_023484144.1\|2607438_2607981_+	cupin domain-containing protein	NA	NA	NA	NA
WP_023484143.1\|2608086_2608881_-	HAD family hydrolase	NA	NA	NA	NA
WP_036654904.1\|2608907_2609093_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_036656935.1\|2609274_2609520_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_023484142.1\|2609797_2610415_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	6.5e-16	63.8
WP_024094581.1\|2610560_2610827_-	hypothetical protein	A0A2I7SCW2	Paenibacillus_phage	1.9e-28	72.7
WP_042119086.1\|2611323_2611554_-	helix-turn-helix transcriptional regulator	A0A0K2CYV5	Paenibacillus_phage	7.5e-10	47.9
WP_052337438.1\|2611654_2612746_-	LCP family protein	NA	NA	NA	NA
WP_104932485.1\|2614163_2615515_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-95	62.3
WP_024094586.1\|2616861_2617212_-	hypothetical protein	NA	NA	NA	NA
WP_024094545.1\|2617479_2618703_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	3.4e-226	99.3
WP_104932502.1\|2621461_2622796_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_023482825.1\|2622829_2623237_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_024094591.1\|2623407_2624658_-	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_172423876.1\|2624700_2625990_-	GTPase HflX	NA	NA	NA	NA
WP_024094593.1\|2626015_2627005_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.4e-51	45.5
WP_042119091.1\|2627131_2628133_-	lipoate--protein ligase	NA	NA	NA	NA
WP_052337439.1\|2628174_2628876_-	YdcF family protein	NA	NA	NA	NA
WP_024094596.1\|2629065_2629452_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_024094597.1\|2629502_2630150_-	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	1.2e-20	48.8
WP_024094598.1\|2630360_2632793_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_023482833.1\|2632941_2633181_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_024094599.1\|2633258_2634221_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_024094600.1\|2634208_2634988_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_024094601.1\|2635108_2637157_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.0e-66	30.5
WP_024094602.1\|2637187_2639869_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.3e-28	22.2
WP_023482838.1\|2639992_2641348_-	hypothetical protein	NA	NA	NA	NA
WP_023482839.1\|2641449_2642019_-\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_024094604.1\|2642832_2643327_+	DUF4352 domain-containing protein	A0A0N7GFE7	Paenibacillus_phage	2.7e-41	100.0
WP_024094605.1\|2643363_2643996_+	hypothetical protein	A0A0N9SJT2	Paenibacillus_phage	3.7e-51	68.1
WP_024094606.1\|2644162_2644438_+	hypothetical protein	A0A2I7SCF3	Paenibacillus_phage	3.3e-44	95.6
WP_052337440.1\|2644488_2644839_+	hypothetical protein	A0A2I7SCF2	Paenibacillus_phage	7.5e-54	90.5
WP_042119092.1\|2645261_2645495_-	helix-turn-helix transcriptional regulator	A0A2K9V490	Faecalibacterium_phage	2.5e-05	37.3
WP_024094610.1\|2645634_2646057_+	hypothetical protein	O48383	Streptococcus_phage	3.7e-07	75.0

DBSCAN-SWA_25

2649110 : 2704948

Paenibacillus_phage(93.75%)

transposase,portal,tail,terminase,integrase

attL 2672149:2672162|attR 2704978:2704991

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042119098.1\|2649110_2649389_+	hypothetical protein	A0A0K2CZR1	Paenibacillus_phage	3.2e-31	80.5
WP_052337441.1\|2649573_2650443_-	N-acetylmuramoyl-L-alanine amidase	A0A0N9SGH1	Paenibacillus_phage	6.1e-161	94.8
WP_042119101.1\|2650838_2651270_-	hypothetical protein	A0A0N9S7V6	Paenibacillus_phage	2.0e-48	67.8
WP_024094620.1\|2651275_2653594_-\|tail	phage tail protein	A0A0N9SIL8	Paenibacillus_phage	0.0e+00	93.9
WP_024094621.1\|2653596_2655054_-\|tail	phage tail family protein	A0A0N9RRA9	Paenibacillus_phage	4.7e-283	96.9
WP_024094622.1\|2655055_2655892_-	hypothetical protein	A0A0N9SJR9	Paenibacillus_phage	1.8e-32	52.4
WP_052337442.1\|2656048_2657950_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	3.3e-220	75.4
WP_024094624.1\|2657977_2658148_-	hypothetical protein	A0A0N9RZB8	Paenibacillus_phage	1.8e-13	70.9
WP_024094625.1\|2658327_2658711_-	hypothetical protein	A0A0N9SST2	Paenibacillus_phage	5.0e-43	67.7
WP_042119103.1\|2658713_2658971_-	hypothetical protein	A0A0K2CZ43	Paenibacillus_phage	1.4e-12	51.9
WP_042119105.1\|2659035_2659584_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	6.2e-95	98.4
WP_024094628.1\|2659596_2659971_-	hypothetical protein	A0A0N7GFE5	Paenibacillus_phage	1.6e-62	96.0
WP_024094629.1\|2659967_2660393_-	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	1.3e-71	95.0
WP_024094630.1\|2660389_2660722_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	1.1e-54	94.5
WP_024094631.1\|2660722_2661106_-	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	9.7e-63	95.3
WP_024094633.1\|2662163_2662799_-	hypothetical protein	A0A0N9SIL0	Paenibacillus_phage	1.6e-54	83.4
WP_024094634.1\|2662887_2663751_-	hypothetical protein	A0A0N9SJR1	Paenibacillus_phage	4.9e-147	92.7
WP_042119106.1\|2663747_2665244_-\|portal	phage portal protein	A0A0N7GFE4	Paenibacillus_phage	1.3e-251	93.5
WP_024094636.1\|2665273_2665732_-	hypothetical protein	A0A0K2CZJ8	Paenibacillus_phage	8.6e-74	86.1
WP_080675896.1\|2665744_2667430_-\|terminase	phage terminase large subunit	A0A0N9RZA7	Paenibacillus_phage	1.8e-310	98.0
WP_024094640.1\|2668472_2668724_-	hypothetical protein	NA	NA	NA	NA
WP_024094642.1\|2669565_2669964_-	helix-turn-helix domain-containing protein	A0A0N7GFF5	Paenibacillus_phage	7.5e-66	99.2
WP_024094643.1\|2669953_2670391_-	hypothetical protein	A0A0N9SJZ8	Paenibacillus_phage	5.7e-59	79.3
WP_158442241.1\|2670392_2670560_-	hypothetical protein	A0A0N9RTP7	Paenibacillus_phage	4.3e-15	75.9
WP_024093193.1\|2670848_2672072_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
2672149:2672162	attL	NA	NA	NA	NA
WP_024094644.1\|2672261_2672654_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024094646.1\|2672984_2673389_-	type II toxin-antitoxin system HicB family antitoxin	A0A0N9RRE8	Paenibacillus_phage	7.4e-61	88.9
WP_024094647.1\|2673453_2673687_-	hypothetical protein	A0A0N9SJZ3	Paenibacillus_phage	9.8e-34	94.8
WP_042119109.1\|2673775_2674234_-	hypothetical protein	A0A0N7GFF4	Paenibacillus_phage	7.3e-73	91.4
WP_024094649.1\|2674223_2674631_-	hypothetical protein	A0A0N9RZI0	Paenibacillus_phage	1.0e-62	94.1
WP_024094650.1\|2674618_2675917_-	DNA (cytosine-5-)-methyltransferase	A0A1P8CX25	Bacillus_phage	5.4e-97	44.8
WP_042119110.1\|2675995_2676379_+	hypothetical protein	A0A0N9SHP7	Paenibacillus_phage	8.8e-56	76.4
WP_024094651.1\|2676335_2676896_-	AAA family ATPase	A0A0N9SJZ0	Paenibacillus_phage	3.2e-99	96.7
WP_024094652.1\|2676879_2677740_-	hypothetical protein	A0A0N9RTN7	Paenibacillus_phage	4.6e-121	78.0
WP_042119112.1\|2677743_2678208_-	DUF4065 domain-containing protein	A0A0N9SGM1	Paenibacillus_phage	1.8e-87	99.4
WP_024094654.1\|2678201_2678495_-	hypothetical protein	A0A0N9S804	Paenibacillus_phage	5.7e-39	82.6
WP_042119113.1\|2678495_2678735_-	hypothetical protein	NA	NA	NA	NA
WP_024094656.1\|2678736_2679126_-	SprT-like domain-containing protein	A0A0N7GFF3	Paenibacillus_phage	4.6e-52	76.7
WP_024094657.1\|2679139_2679466_-	hypothetical protein	NA	NA	NA	NA
WP_042119115.1\|2679466_2679661_-	hypothetical protein	NA	NA	NA	NA
WP_042119116.1\|2679660_2679999_-	hypothetical protein	NA	NA	NA	NA
WP_042119676.1\|2679949_2680234_-	hypothetical protein	NA	NA	NA	NA
WP_042119118.1\|2680258_2680462_-	hypothetical protein	NA	NA	NA	NA
WP_024094660.1\|2680448_2680703_-	hypothetical protein	NA	NA	NA	NA
WP_024094661.1\|2680695_2681049_-	hypothetical protein	A0A0K2CZG5	Paenibacillus_phage	2.2e-37	85.7
WP_024094662.1\|2681078_2681537_-	dUTP diphosphatase	D2XR49	Bacillus_phage	2.9e-37	53.8
WP_024094663.1\|2681548_2682580_-	ribonucleotide-diphosphate reductase subunit beta	A0A0E3X9K0	Bacillus_phage	5.6e-121	60.3
WP_080675843.1\|2682824_2685143_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0Y0AS84	Bacillus_phage	2.0e-283	63.8
WP_024094665.1\|2685287_2685596_-	crossover junction endodeoxyribonuclease RuvC	A0A0N9ST03	Paenibacillus_phage	1.1e-29	85.5
WP_042119126.1\|2685795_2686815_-	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	1.3e-146	87.1
WP_042119128.1\|2686799_2687414_-	3'-5' exonuclease	A0A0N9SJX9	Paenibacillus_phage	4.8e-96	89.2
WP_104932503.1\|2687414_2688548_-	hypothetical protein	A0A0N9RTM8	Paenibacillus_phage	4.8e-174	78.4
WP_080675897.1\|2688547_2690179_-	DNA polymerase I	A0A0N9S7Z3	Paenibacillus_phage	8.9e-299	92.0
WP_024094670.1\|2690343_2691153_-	hypothetical protein	A0A0N9SIQ5	Paenibacillus_phage	1.0e-106	75.8
WP_024094672.1\|2691361_2691775_-	hypothetical protein	A0A0N9RZF9	Paenibacillus_phage	1.7e-73	97.1
WP_024094673.1\|2692157_2692895_-	hypothetical protein	A0A0N9SJW5	Paenibacillus_phage	8.0e-138	98.4
WP_024094674.1\|2692980_2693505_-	hypothetical protein	A0A0N9RTM1	Paenibacillus_phage	3.9e-54	66.7
WP_024094675.1\|2693570_2694134_-	hypothetical protein	A0A0N9SGJ9	Paenibacillus_phage	3.0e-76	88.8
WP_042119133.1\|2694187_2695138_-	toprim domain-containing protein	A0A0N9S7Y2	Paenibacillus_phage	4.1e-163	88.6
WP_024094677.1\|2695150_2696527_-	AAA family ATPase	A0A0N9SIP5	Paenibacillus_phage	3.8e-258	98.0
WP_024094679.1\|2697301_2697568_-	hypothetical protein	A0A0N9RRC8	Paenibacillus_phage	3.4e-38	85.2
WP_024094680.1\|2697578_2698106_-	hypothetical protein	A0A0N9SJU7	Paenibacillus_phage	4.3e-77	83.4
WP_024094681.1\|2698243_2699077_-	DUF3102 domain-containing protein	A0A0N9RZE9	Paenibacillus_phage	7.0e-90	67.9
WP_042119134.1\|2699091_2699460_-	hypothetical protein	A0A0N9SSX1	Paenibacillus_phage	6.3e-59	89.3
WP_024094683.1\|2699443_2699821_-	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	1.0e-40	70.9
WP_024094684.1\|2699878_2700250_-	hypothetical protein	A0A0N9SJV6	Paenibacillus_phage	2.9e-19	43.1
WP_024094685.1\|2700280_2700529_-	hypothetical protein	A0A0N9RTL0	Paenibacillus_phage	5.9e-45	98.8
WP_024094686.1\|2700697_2701024_-	helix-turn-helix domain-containing protein	A0A0N7GFE9	Paenibacillus_phage	1.2e-53	98.1
WP_024094687.1\|2701044_2701371_-	hypothetical protein	A0A0N9SGJ1	Paenibacillus_phage	3.4e-56	99.1
WP_024094688.1\|2701397_2701700_-	hypothetical protein	A0A0N9S7X2	Paenibacillus_phage	3.7e-41	86.0
WP_024094692.1\|2702714_2702948_-	helix-turn-helix transcriptional regulator	A0A0N9SHK5	Paenibacillus_phage	8.6e-22	91.5
WP_024094693.1\|2703121_2703757_+	helix-turn-helix domain-containing protein	A0A0N9RTK0	Paenibacillus_phage	1.2e-78	85.9
WP_024094694.1\|2703769_2704948_+\|integrase	site-specific integrase	A0A0N9SGH8	Paenibacillus_phage	1.1e-216	97.4
2704978:2704991	attR	NA	NA	NA	NA

DBSCAN-SWA_26

2846227 : 2907876

Paenibacillus_phage(20.0%)

tail,tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024094783.1\|2846227_2847628_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_023484282.1\|2847799_2848333_-	hypothetical protein	NA	NA	NA	NA
WP_024094784.1\|2848470_2848872_-	adenosylmethionine decarboxylase	A0A0E3FA82	Synechococcus_phage	1.2e-18	36.4
WP_024094785.1\|2849244_2849832_-	hypothetical protein	NA	NA	NA	NA
WP_024094786.1\|2850222_2850837_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_024094787.1\|2850855_2853189_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.3e-169	41.5
WP_024094788.1\|2853338_2855057_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	4.7e-16	24.7
WP_052304436.1\|2855272_2855980_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_023484289.1\|2856030_2857152_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_023484290.1\|2857256_2858516_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.5e-149	65.0
WP_024094790.1\|2858531_2859122_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	4.2e-57	56.6
WP_023484292.1\|2859286_2860588_-	trigger factor	NA	NA	NA	NA
WP_024094791.1\|2860766_2861669_-	hypothetical protein	NA	NA	NA	NA
WP_023484294.1\|2861799_2863020_-	CapA family protein	A0A2H4J5Z6	uncultured_Caudovirales_phage	4.8e-55	33.9
WP_024094793.1\|2863246_2863360_-	DUF4023 family protein	NA	NA	NA	NA
WP_024094794.1\|2863414_2864929_-	PH domain-containing protein	NA	NA	NA	NA
WP_024094795.1\|2864921_2865398_-	PH domain-containing protein	NA	NA	NA	NA
WP_024094796.1\|2865563_2865917_-	hypothetical protein	NA	NA	NA	NA
WP_024094797.1\|2866205_2868050_+	asparagine synthase (glutamine-hydrolyzing)	L7RC73	Acanthamoeba_polyphaga_moumouvirus	5.8e-28	24.7
WP_023484299.1\|2868117_2868750_-	XTP/dITP diphosphatase	NA	NA	NA	NA
WP_024094798.1\|2868736_2869492_-	ribonuclease PH	NA	NA	NA	NA
WP_023484301.1\|2869827_2870859_-	GerMN domain-containing protein	NA	NA	NA	NA
WP_024094799.1\|2871095_2871611_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.9e-37	53.6
WP_024094800.1\|2871722_2872532_+	MFS transporter	NA	NA	NA	NA
WP_023483236.1\|2872654_2873878_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094801.1\|2873992_2874439_-	lethal factor domain protein	NA	NA	NA	NA
WP_024094802.1\|2874665_2875472_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_024094804.1\|2875997_2876672_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A0K2CYE7	Paenibacillus_phage	2.0e-127	94.6
WP_023483236.1\|2877151_2878375_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_152659182.1\|2878617_2879601_-	hypothetical protein	A0A0C5AEQ0	Bacteriophage	7.1e-49	75.9
WP_155116279.1\|2879936_2880104_+	hypothetical protein	NA	NA	NA	NA
WP_024094807.1\|2880326_2880641_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_023485249.1\|2880640_2880982_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_024094809.1\|2881049_2881631_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_023484956.1\|2881879_2882863_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_024094810.1\|2882872_2883607_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_042119717.1\|2884109_2885054_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_023483236.1\|2885560_2886784_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094813.1\|2887471_2887696_-	response regulator transcription factor	A0A290GJH9	Caldibacillus_phage	3.7e-14	70.5
WP_024094814.1\|2887836_2889147_-	purine/pyrimidine permease	NA	NA	NA	NA
WP_036654839.1\|2889286_2890219_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_024094816.1\|2890199_2890901_-	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_188318623.1\|2891127_2891232_-	sporulation protein YjcZ	NA	NA	NA	NA
WP_024094817.1\|2891315_2892182_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_080675845.1\|2892265_2893102_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_158442244.1\|2893088_2893910_-	glycosyltransferase	NA	NA	NA	NA
WP_042119724.1\|2894109_2894886_-	glycosyltransferase	NA	NA	NA	NA
WP_036654840.1\|2895054_2895975_+	GDP-mannose 4,6-dehydratase	E3T4Y8	Cafeteria_roenbergensis_virus	7.4e-32	31.2
WP_024094820.1\|2896056_2896776_-	glycosyltransferase	K7Z8A5	Megavirus	1.2e-10	23.6
WP_024094821.1\|2896783_2897689_-	NAD-dependent epimerase/dehydratase family protein	A0A291LAD7	Escherichia_phage	1.2e-15	25.7
WP_024094822.1\|2897685_2898516_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_024094823.1\|2898512_2899499_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.6e-40	33.4
WP_023482886.1\|2899488_2900583_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A2P1ELS7	Moumouvirus	1.9e-87	44.4
WP_052337448.1\|2900579_2902037_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_036654842.1\|2902681_2903818_-	glycosyltransferase	NA	NA	NA	NA
WP_023482882.1\|2903792_2904983_-	glycosyltransferase	NA	NA	NA	NA
WP_024094825.1\|2904979_2905702_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	5.4e-46	40.9
WP_024094826.1\|2905956_2907876_-\|tail	WIAG-tail domain	NA	NA	NA	NA

DBSCAN-SWA_27

2949039 : 3009357

uncultured_Caudovirales_phage(15.38%)

holin,transposase,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042119189.1\|2949039_2950644_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_023483304.1\|2950727_2952707_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_023483303.1\|2952838_2953150_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	4.8e-20	45.7
WP_024094847.1\|2953440_2953590_+	YqzM family protein	NA	NA	NA	NA
WP_193373153.1\|2953619_2954696_+	globin-coupled sensor protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-09	34.1
WP_036656916.1\|2954834_2955782_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	5.4e-38	33.0
WP_024094849.1\|2955810_2957307_-	DnaD domain protein	NA	NA	NA	NA
WP_036656917.1\|2957530_2957812_-	hypothetical protein	NA	NA	NA	NA
WP_023483298.1\|2957985_2958732_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_024094851.1\|2958791_2959064_-	hypothetical protein	NA	NA	NA	NA
WP_036654862.1\|2959208_2960411_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023483296.1\|2960778_2961813_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	2.0e-22	44.4
WP_024094855.1\|2962203_2962359_-	sporulation histidine kinase inhibitor Sda	NA	NA	NA	NA
WP_042119192.1\|2962778_2962940_+	hypothetical protein	NA	NA	NA	NA
WP_096761320.1\|2963117_2963591_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_036654865.1\|2963624_2963963_-	DsrE family protein	NA	NA	NA	NA
WP_023483294.1\|2963986_2964973_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_024094859.1\|2965242_2965662_+	hypothetical protein	A0A0N9SIM5	Paenibacillus_phage	5.2e-25	50.0
WP_023483292.1\|2965960_2966611_+	cell wall hydrolase	A0A0K2FM09	Brevibacillus_phage	2.5e-18	30.9
WP_024094860.1\|2966876_2967239_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	8.1e-19	50.0
WP_036656920.1\|2967386_2967566_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_023483290.1\|2968064_2969168_+	aminofutalosine synthase MqnE	A9ZMK9	Mamastrovirus	1.7e-14	33.3
WP_024094862.1\|2969209_2970274_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_024094863.1\|2970321_2970570_-	YuzB family protein	NA	NA	NA	NA
WP_023483287.1\|2970685_2970934_+	NifU family protein	NA	NA	NA	NA
WP_024094864.1\|2971014_2971800_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_024094865.1\|2971796_2972525_-	hypothetical protein	NA	NA	NA	NA
WP_024094866.1\|2972711_2974472_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_052337481.1\|2974486_2975347_-	heme A synthase	NA	NA	NA	NA
WP_036654871.1\|2975512_2975695_-	hypothetical protein	NA	NA	NA	NA
WP_024094868.1\|2975731_2976079_-	thioredoxin family protein	NA	NA	NA	NA
WP_023483281.1\|2976262_2977105_+	SPFH domain-containing protein	NA	NA	NA	NA
WP_024094869.1\|2977111_2977309_+	hypothetical protein	NA	NA	NA	NA
WP_023483280.1\|2977626_2978958_+	DUF2515 family protein	NA	NA	NA	NA
WP_023483279.1\|2978954_2980649_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_024094870.1\|2980832_2981555_-	ThuA domain-containing protein	NA	NA	NA	NA
WP_023483277.1\|2981612_2982095_-	DUF456 family protein	NA	NA	NA	NA
WP_024094871.1\|2982166_2982907_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_024094872.1\|2983131_2985006_-	asparagine synthase (glutamine-hydrolyzing)	F2Y1H0	Organic_Lake_phycodnavirus	2.4e-37	30.2
WP_193373142.1\|2986312_2986837_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|2986857_2988081_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083327.1\|2988162_2989254_+	hypothetical protein	NA	NA	NA	NA
WP_023483273.1\|2989235_2989706_+	hypothetical protein	NA	NA	NA	NA
WP_023483272.1\|2989846_2990782_+	DUF2334 domain-containing protein	NA	NA	NA	NA
WP_104932516.1\|2992360_2993405_+\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_080675847.1\|2993371_2995309_+	cellulose biosynthesis cyclic di-GMP-binding regulatory protein BcsB	NA	NA	NA	NA
WP_024094875.1\|2996396_2997077_-	LrgB family protein	NA	NA	NA	NA
WP_023483267.1\|2997073_2997445_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_036654876.1\|2997567_2998461_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_052337451.1\|2998836_2999394_-	hypothetical protein	NA	NA	NA	NA
WP_024094877.1\|2999504_3000653_-	transglutaminase domain-containing protein	NA	NA	NA	NA
WP_158442247.1\|3000680_3000854_-	hypothetical protein	NA	NA	NA	NA
WP_155116295.1\|3000943_3001096_-	hypothetical protein	NA	NA	NA	NA
WP_023483263.1\|3001214_3002357_+	MFS transporter	NA	NA	NA	NA
WP_024094879.1\|3002560_3002929_+	ribonuclease-like protein	NA	NA	NA	NA
WP_104932485.1\|3002939_3004291_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-95	62.3
WP_023483261.1\|3004353_3004995_-	SCO family protein	NA	NA	NA	NA
WP_042119742.1\|3005085_3006012_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_024094881.1\|3006256_3008269_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-11	24.3
WP_023483257.1\|3008877_3009357_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

DBSCAN-SWA_28

3070515 : 3194245

105

Paenibacillus_phage(44.83%)

tRNA,transposase,integrase,protease

attL 3129292:3129351|attR 3194219:3195657

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|3070515_3071739_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119222.1\|3071955_3072339_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3072964_3074188_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119224.1\|3074427_3075189_+	alpha/beta fold hydrolase	A0A2K9KZN8	Tupanvirus	3.0e-07	23.3
WP_023484455.1\|3082308_3083208_-	hypothetical protein	NA	NA	NA	NA
WP_023484454.1\|3083326_3083728_+	hypothetical protein	NA	NA	NA	NA
WP_023484453.1\|3083916_3085617_-	epimerase-like protein for modification of peptidoglycan	NA	NA	NA	NA
WP_023484452.1\|3085770_3086205_-	peroxide-responsive transcriptional repressor PerR	NA	NA	NA	NA
WP_024094923.1\|3086329_3086929_-	hypothetical protein	NA	NA	NA	NA
WP_036658247.1\|3086970_3087300_-	hypothetical protein	NA	NA	NA	NA
WP_024094925.1\|3087250_3087859_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_052337482.1\|3088183_3088612_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024094927.1\|3088788_3090237_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_024094928.1\|3090255_3091713_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_023484446.1\|3091746_3092034_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_023484445.1\|3092249_3093314_+	EAL domain-containing protein	NA	NA	NA	NA
WP_023484444.1\|3093408_3093789_-	hypothetical protein	NA	NA	NA	NA
WP_077584857.1\|3093956_3094391_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_024094929.1\|3094439_3095063_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.5e-28	40.9
WP_023484441.1\|3095086_3095653_-	thioredoxin family protein	NA	NA	NA	NA
WP_036658236.1\|3095768_3096374_-	DedA family protein	NA	NA	NA	NA
WP_024094930.1\|3096567_3097020_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_024094931.1\|3097097_3097409_+	hypothetical protein	NA	NA	NA	NA
WP_024094932.1\|3097756_3098335_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042119228.1\|3098472_3098829_+	YhgE/Pip family protein	NA	NA	NA	NA
WP_024092920.1\|3098849_3100073_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_158442249.1\|3100154_3101624_+	hypothetical protein	NA	NA	NA	NA
WP_024094933.1\|3101623_3102175_+	YhgE/Pip family protein	NA	NA	NA	NA
WP_077584856.1\|3102243_3102357_+	hypothetical protein	NA	NA	NA	NA
WP_174567573.1\|3102445_3103237_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_077585224.1\|3103273_3103951_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_023484433.1\|3104303_3104849_-\|protease	spore protease YyaC	G3M9W0	Bacillus_virus	7.0e-22	37.4
WP_024094935.1\|3105282_3105987_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_023483236.1\|3106215_3107439_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083329.1\|3108320_3111167_+	lantibiotic dehydratase	NA	NA	NA	NA
WP_024094939.1\|3111159_3112515_+	lanthionine synthetase C family protein	NA	NA	NA	NA
WP_023484429.1\|3112803_3114120_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_144083330.1\|3114407_3115337_-	hypothetical protein	NA	NA	NA	NA
WP_024094943.1\|3115732_3117760_-	sodium:proton antiporter	NA	NA	NA	NA
WP_024094945.1\|3118850_3119648_-	C39 family peptidase	NA	NA	NA	NA
WP_024094946.1\|3119865_3121323_+	cardiolipin synthase	NA	NA	NA	NA
WP_024094947.1\|3121508_3122594_-	thermonuclease family protein	NA	NA	NA	NA
WP_052337483.1\|3123204_3123957_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_172423924.1\|3124053_3125238_-	PatB family C-S lyase	NA	NA	NA	NA
WP_042119236.1\|3125272_3126832_-	PTS maltose transporter subunit IICB	NA	NA	NA	NA
WP_024094951.1\|3127597_3127846_+	hypothetical protein	NA	NA	NA	NA
WP_036658206.1\|3127852_3128116_+	hypothetical protein	NA	NA	NA	NA
WP_024094953.1\|3128299_3129241_-	alpha/beta hydrolase	NA	NA	NA	NA
3129292:3129351	attL	NA	NA	NA	NA
WP_104932485.1\|3129323_3130675_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-95	62.3
WP_155116280.1\|3130737_3130881_-	hypothetical protein	A0A0K2CYN9	Paenibacillus_phage	3.7e-07	93.9
WP_023483236.1\|3131216_3132440_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094955.1\|3132472_3132790_+\|integrase	phage integrase-like protein	A0A0K2CZ62	Paenibacillus_phage	2.5e-32	71.1
WP_144083331.1\|3132773_3132977_+	hypothetical protein	A0A0K2CZ62	Paenibacillus_phage	3.8e-26	76.1
WP_024094956.1\|3133068_3133224_+\|integrase	phage integrase family protein	A0A0K2CZ62	Paenibacillus_phage	4.5e-19	88.2
WP_023483158.1\|3133454_3134189_-	oxo-acid lyase	NA	NA	NA	NA
WP_023483159.1\|3134192_3135299_-	DgaE family pyridoxal phosphate-dependent ammonia lyase	NA	NA	NA	NA
WP_024094957.1\|3135340_3136006_-	DUF4310 family protein	NA	NA	NA	NA
WP_024094958.1\|3136008_3136794_-	DUF4311 domain-containing protein	NA	NA	NA	NA
WP_024094959.1\|3136814_3137153_-	DUF4312 family protein	NA	NA	NA	NA
WP_023483163.1\|3137156_3137513_-	glycine-rich SFCGS family protein	NA	NA	NA	NA
WP_024094960.1\|3137552_3137915_-	PRD domain-containing protein	NA	NA	NA	NA
WP_042119241.1\|3139028_3139322_-	hypothetical protein	NA	NA	NA	NA
WP_024094962.1\|3139388_3140612_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_024094963.1\|3140869_3141010_-	hypothetical protein	NA	NA	NA	NA
WP_024094964.1\|3141013_3142366_-	hypothetical protein	S5MC02	Brevibacillus_phage	1.0e-21	26.3
WP_024094965.1\|3142554_3143334_-	ABC transporter permease	NA	NA	NA	NA
WP_023483170.1\|3143326_3144265_-	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.3e-20	29.0
WP_042119243.1\|3144321_3145110_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_023483236.1\|3145174_3146398_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024094967.1\|3146870_3147860_+	glycosyltransferase family 2 protein	B9UDL7	Salmonella_phage	8.4e-50	40.3
WP_023483173.1\|3147889_3149323_+	hypothetical protein	NA	NA	NA	NA
WP_024094968.1\|3149623_3150055_+	nitroreductase family protein	NA	NA	NA	NA
WP_023483175.1\|3150151_3150664_-	FUSC family protein	NA	NA	NA	NA
WP_042119245.1\|3151010_3152006_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_023483177.1\|3152191_3153115_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_024094971.1\|3153338_3154907_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_023483179.1\|3154933_3155848_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.8e-70	45.5
WP_052337454.1\|3156333_3158544_+	SpoIID/LytB domain-containing protein	Q2XU88	Pseudomonas_phage	1.6e-11	25.8
WP_024094974.1\|3158769_3159690_-	nucleoside hydrolase	NA	NA	NA	NA
WP_023483183.1\|3159889_3160453_+	signal peptidase I	NA	NA	NA	NA
WP_144083332.1\|3160493_3161123_-	hypothetical protein	NA	NA	NA	NA
WP_144083333.1\|3161386_3161752_-	hypothetical protein	NA	NA	NA	NA
WP_023483185.1\|3162600_3163554_+\|integrase	tyrosine-type recombinase/integrase	A0A097BYJ7	Leuconostoc_phage	1.2e-05	26.3
WP_024094978.1\|3163827_3164532_+	HD domain-containing protein	NA	NA	NA	NA
WP_024094979.1\|3165432_3166419_-	MFS transporter	NA	NA	NA	NA
WP_023483236.1\|3166515_3167739_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_051428076.1\|3168359_3169346_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	3.7e-05	25.1
WP_024094980.1\|3169388_3171632_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_077584824.1\|3172771_3173767_-	cytosine permease	NA	NA	NA	NA
WP_023483197.1\|3173875_3174271_+	hypothetical protein	NA	NA	NA	NA
WP_036657987.1\|3174798_3175461_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3T7R5	Bacillus_phage	1.3e-51	51.9
WP_023483199.1\|3175631_3176063_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_023483200.1\|3176625_3177366_-	hypothetical protein	NA	NA	NA	NA
WP_023483201.1\|3177427_3178066_-	transcriptional regulator	NA	NA	NA	NA
WP_036657986.1\|3178109_3178724_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-59	54.5
WP_024094986.1\|3179054_3180278_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
WP_023483205.1\|3181985_3182870_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_042119773.1\|3183445_3186052_-	adenosylcobalamin-dependent ribonucleoside-diphosphate reductase	A0A0K2CP92	Brevibacillus_phage	3.1e-168	46.3
WP_024094992.1\|3186500_3187349_+	D-amino-acid transaminase	NA	NA	NA	NA
WP_036658443.1\|3187465_3188308_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_023483209.1\|3188481_3190281_+	DEAD/DEAH box helicase	A0A2H4J643	uncultured_Caudovirales_phage	2.1e-59	29.3
WP_023483210.1\|3190277_3191297_+	hypothetical protein	NA	NA	NA	NA
WP_042119250.1\|3191418_3192432_+	hypothetical protein	NA	NA	NA	NA
WP_024094994.1\|3192481_3192733_-	YqzE family protein	NA	NA	NA	NA
WP_104932485.1\|3192894_3194245_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-95	62.3
3194219:3195657	attR	NA	NA	NA	NA

DBSCAN-SWA_29

3212498 : 3234733

Paenibacillus_phage(50.0%)

transposase,integrase

attL 3213999:3214014|attR 3237777:3237792

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024093995.1\|3212498_3213722_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_024095009.1\|3213728_3215126_-	radical SAM protein	NA	NA	NA	NA
3213999:3214014	attL	NA	NA	NA	NA
WP_144083334.1\|3215240_3215471_+	hypothetical protein	NA	NA	NA	NA
WP_104932509.1\|3215467_3215608_-	cyclic lactone autoinducer peptide	NA	NA	NA	NA
WP_023485252.1\|3215678_3216239_-	accessory gene regulator B family protein	NA	NA	NA	NA
WP_036655081.1\|3216451_3217189_+	response regulator transcription factor	NA	NA	NA	NA
WP_158442250.1\|3217327_3218491_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_024095013.1\|3219520_3219742_+	hypothetical protein	NA	NA	NA	NA
WP_040931968.1\|3219810_3220011_+	hypothetical protein	NA	NA	NA	NA
WP_024095015.1\|3220992_3222471_+	ABC-F type ribosomal protection protein	A0A2K9L0W2	Tupanvirus	6.5e-30	25.2
WP_024095016.1\|3222626_3223682_-\|transposase	transposase	A0A1P8DJG9	Virus_Rctr71	2.2e-16	30.9
WP_024095017.1\|3223686_3224082_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	7.0e-40	62.8
WP_024095018.1\|3225101_3225287_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CZ62	Paenibacillus_phage	2.4e-06	54.3
WP_024095019.1\|3225590_3226259_-	adenosylcobinamide amidohydrolase	NA	NA	NA	NA
WP_024095020.1\|3226330_3226564_-	hypothetical protein	NA	NA	NA	NA
WP_036655087.1\|3226956_3227265_+	hypothetical protein	NA	NA	NA	NA
WP_036655089.1\|3227391_3227718_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3227952_3229176_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095023.1\|3229546_3230968_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_024095024.1\|3231041_3231929_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_104932516.1\|3232117_3233163_-\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_080675854.1\|3233249_3233369_-	DUF871 family protein	NA	NA	NA	NA
WP_024093995.1\|3233509_3234733_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
3237777:3237792	attR	NA	NA	NA	NA

DBSCAN-SWA_30

3274571 : 3318846

Paenibacillus_phage(44.44%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077584833.1\|3274571_3276557_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	6.3e-97	36.9
WP_042119788.1\|3276910_3277159_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.6e-19	56.1
WP_023485543.1\|3277158_3277590_-	transcriptional repressor	NA	NA	NA	NA
WP_024095055.1\|3277813_3279343_+	spore germination protein	NA	NA	NA	NA
WP_024095056.1\|3279339_3280440_+	endospore germination permease	NA	NA	NA	NA
WP_024095057.1\|3280436_3281567_+	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_023482903.1\|3281686_3282532_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_024095058.1\|3282722_3283712_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_042119262.1\|3283886_3285326_-	alanine:cation symporter family protein	NA	NA	NA	NA
WP_052337456.1\|3286484_3287639_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_024095061.1\|3287754_3288618_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_080675899.1\|3288730_3290008_-	(Fe-S)-binding protein	NA	NA	NA	NA
WP_193373154.1\|3290063_3291374_-	FAD-binding protein	NA	NA	NA	NA
WP_023483236.1\|3291715_3292939_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023482910.1\|3293164_3293602_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_036658022.1\|3296010_3296751_+	response regulator transcription factor	NA	NA	NA	NA
WP_024095066.1\|3297061_3298444_+\|tRNA	glycine--tRNA ligase	A0A2I2L3K8	Orpheovirus	1.9e-47	29.5
WP_024095068.1\|3298939_3299818_-	ROK family protein	NA	NA	NA	NA
WP_023482915.1\|3299857_3300847_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_024095069.1\|3301131_3303255_+	LTA synthase family protein	NA	NA	NA	NA
WP_023483236.1\|3305140_3306364_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_104932485.1\|3307081_3308433_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-95	62.3
WP_023484418.1\|3308621_3309236_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_036658526.1\|3309458_3310649_-	MFS transporter	NA	NA	NA	NA
WP_023484416.1\|3310684_3311374_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_024095074.1\|3312329_3312758_+	pyruvate formate-lyase-activating enzyme	NA	NA	NA	NA
WP_024095075.1\|3312752_3313517_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_023483236.1\|3313768_3314992_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119269.1\|3315424_3315943_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3316007_3317231_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095078.1\|3317223_3317877_-	nucleoid-associated protein	A0A090D855	Clostridium_phage	2.6e-07	29.5
WP_024095079.1\|3317986_3318244_-	hypothetical protein	NA	NA	NA	NA
WP_077585076.1\|3318708_3318846_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_31

3360841 : 3423312

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024092852.1\|3360841_3362065_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
WP_024095122.1\|3363313_3364171_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_023483410.1\|3364167_3365007_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_024095124.1\|3365340_3366231_-	phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023483412.1\|3366946_3368029_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_024095126.1\|3368168_3369095_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_024095127.1\|3369160_3369874_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-38	37.8
WP_042119284.1\|3369981_3371781_-	PAS domain S-box protein	W8CYF6	Bacillus_phage	1.1e-39	36.6
WP_042119801.1\|3372067_3373414_+	N-acyl-D-glucosamine 2-epimerase	NA	NA	NA	NA
WP_024095130.1\|3373682_3375224_-	fumarate hydratase	NA	NA	NA	NA
WP_023483418.1\|3375404_3376556_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_023483419.1\|3376860_3377802_-	malate dehydrogenase	NA	NA	NA	NA
WP_023483420.1\|3377827_3379126_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	4.0e-15	75.9
WP_024095131.1\|3379232_3380345_-	citrate synthase	NA	NA	NA	NA
WP_024095132.1\|3380765_3381212_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_042119286.1\|3381388_3383143_-	pyruvate kinase	NA	NA	NA	NA
WP_042119288.1\|3383135_3384110_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_024095135.1\|3384099_3384966_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_024095136.1\|3385060_3385252_-	hypothetical protein	NA	NA	NA	NA
WP_024095137.1\|3385604_3389261_-	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.6e-213	37.9
WP_023483236.1\|3389985_3391209_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095139.1\|3391734_3392067_+	YtrH family sporulation protein	NA	NA	NA	NA
WP_023483429.1\|3392063_3392642_+	hypothetical protein	NA	NA	NA	NA
WP_024095140.1\|3393090_3394233_-	C40 family peptidase	A0A1W6DXV0	Rhodococcus_phage	6.2e-12	40.2
WP_023483236.1\|3395115_3396339_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_158225759.1\|3396458_3396605_+	hypothetical protein	NA	NA	NA	NA
WP_144083340.1\|3397027_3397420_-	hypothetical protein	NA	NA	NA	NA
WP_024095141.1\|3397728_3398271_+	hypothetical protein	NA	NA	NA	NA
WP_024095143.1\|3398514_3399738_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	5.2e-227	99.5
WP_024095144.1\|3399981_3400956_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_023485469.1\|3400977_3401607_-	response regulator transcription factor	NA	NA	NA	NA
WP_024095145.1\|3401603_3403925_-	sensor histidine kinase	NA	NA	NA	NA
WP_024095146.1\|3404023_3404206_+	hypothetical protein	NA	NA	NA	NA
WP_024095147.1\|3404425_3404578_+	hypothetical protein	NA	NA	NA	NA
WP_023485471.1\|3404754_3405060_+	YtpI family protein	NA	NA	NA	NA
WP_042119292.1\|3405043_3406381_-	CBS domain-containing protein	NA	NA	NA	NA
WP_036655248.1\|3406535_3406814_-	hypothetical protein	NA	NA	NA	NA
WP_024095151.1\|3406941_3407184_-	hypothetical protein	NA	NA	NA	NA
WP_042119294.1\|3407390_3407846_+	SgrR family transcriptional regulator	NA	NA	NA	NA
WP_042119296.1\|3407864_3409202_+	hypothetical protein	NA	NA	NA	NA
WP_024093995.1\|3409340_3410564_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_023483995.1\|3410770_3411130_-	YlbF family regulator	NA	NA	NA	NA
WP_024095152.1\|3411178_3412345_-	DUF445 family protein	NA	NA	NA	NA
WP_024095153.1\|3412474_3413848_+	YheC/YheD family protein	NA	NA	NA	NA
WP_158442252.1\|3414204_3415056_+	YheC/YheD family protein	NA	NA	NA	NA
WP_024095154.1\|3415068_3416439_+	YheC/YheD family protein	NA	NA	NA	NA
WP_023483990.1\|3416438_3417557_+	YheC/YheD family protein	NA	NA	NA	NA
WP_023483989.1\|3417562_3418999_+	YheC/YheD family protein	NA	NA	NA	NA
WP_023483988.1\|3419021_3420248_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_023483987.1\|3420288_3420660_-	EamA family transporter	NA	NA	NA	NA
WP_024095155.1\|3420663_3421053_-	DUF2304 family protein	NA	NA	NA	NA
WP_023483334.1\|3421068_3421764_-	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	1.4e-06	28.0
WP_023483236.1\|3422088_3423312_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_32

3500488 : 3608353

Paenibacillus_phage(29.17%)

tRNA,transposase,protease,holin,bacteriocin,integrase

attL 3555515:3555574|attR 3572778:3574168

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023483236.1\|3500488_3501712_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095211.1\|3501922_3505081_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_051427989.1\|3505082_3505994_-	aldo/keto reductase	NA	NA	NA	NA
WP_042119326.1\|3506168_3507341_-	hypothetical protein	NA	NA	NA	NA
WP_023483755.1\|3507340_3508480_-	DGQHR domain-containing protein	NA	NA	NA	NA
WP_023483754.1\|3508632_3509679_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_036656029.1\|3509694_3510063_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.7e-19	43.5
WP_172423831.1\|3510124_3511060_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_042119329.1\|3511053_3511623_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_042119331.1\|3514382_3515186_-	adenosylcobinamide-GDP ribazoletransferase	NA	NA	NA	NA
WP_104932510.1\|3516165_3516741_-	bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase	NA	NA	NA	NA
WP_042119334.1\|3516873_3517920_-	nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase	NA	NA	NA	NA
WP_024095219.1\|3517977_3518766_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-17	26.3
WP_023483743.1\|3518767_3519808_-	iron ABC transporter permease	NA	NA	NA	NA
WP_024095220.1\|3519830_3520826_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024095221.1\|3521317_3521623_-	hypothetical protein	NA	NA	NA	NA
WP_024095222.1\|3522017_3522281_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_172423830.1\|3522365_3523523_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X6WGT4	Pacmanvirus	1.8e-06	24.4
WP_023483739.1\|3523586_3524078_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_024095225.1\|3524341_3524623_-	hypothetical protein	NA	NA	NA	NA
WP_024095227.1\|3524850_3526182_-	MFS transporter	NA	NA	NA	NA
WP_158442255.1\|3526208_3527279_-	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024095229.1\|3527427_3527922_-	hypothetical protein	NA	NA	NA	NA
WP_023483734.1\|3528054_3528474_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_036656018.1\|3528573_3529245_-	PspA/IM30 family protein	NA	NA	NA	NA
WP_104932511.1\|3529357_3531721_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	1.8e-13	37.9
WP_023483731.1\|3532044_3532413_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_036656016.1\|3532654_3533017_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_023483729.1\|3533097_3533637_-	CvpA family protein	NA	NA	NA	NA
WP_024095232.1\|3533642_3536543_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_024095233.1\|3536649_3539100_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_042119342.1\|3539123_3540152_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.7e-29	37.9
WP_023483724.1\|3541252_3541768_-	signal peptidase I	NA	NA	NA	NA
WP_024095236.1\|3541935_3542859_+	aldo/keto reductase	NA	NA	NA	NA
WP_024095237.1\|3542965_3543262_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024095239.1\|3544206_3544770_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-24	41.0
WP_036656001.1\|3544984_3545302_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158225718.1\|3545460_3545601_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3545890_3547114_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095242.1\|3547106_3548351_-	hypothetical protein	A0A0K2CP77	Brevibacillus_phage	1.4e-62	35.4
WP_024095243.1\|3548395_3548572_-	hypothetical protein	NA	NA	NA	NA
WP_024095244.1\|3549649_3550639_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_024095245.1\|3550631_3551510_+	ribokinase	NA	NA	NA	NA
WP_023484945.1\|3551511_3551910_+	D-ribose pyranase	NA	NA	NA	NA
WP_024095246.1\|3551924_3553406_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-16	27.6
WP_024095247.1\|3553407_3554376_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_023484942.1\|3554394_3555312_+	ribose ABC transporter substrate-binding protein RbsB	NA	NA	NA	NA
3555515:3555574	attL	NA	NA	NA	NA
WP_023483236.1\|3555558_3556782_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_077585289.1\|3557256_3557523_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_144083343.1\|3557601_3557892_+	hypothetical protein	NA	NA	NA	NA
WP_024095249.1\|3557912_3558692_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3558952_3560176_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095250.1\|3560686_3561067_+	hypothetical protein	NA	NA	NA	NA
WP_024095251.1\|3561210_3562116_+\|integrase	tyrosine-type recombinase/integrase	A0A0A7AR08	Bacillus_phage	6.2e-92	57.0
WP_104932516.1\|3563910_3564956_-\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	7.9e-06	20.9
WP_024095239.1\|3565331_3565895_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-24	41.0
WP_083040599.1\|3566441_3566624_-	hypothetical protein	NA	NA	NA	NA
WP_036655999.1\|3566788_3567970_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_023484907.1\|3568085_3568739_+	hypothetical protein	NA	NA	NA	NA
WP_036655998.1\|3569013_3569721_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_024095255.1\|3569792_3569957_-	rubredoxin	NA	NA	NA	NA
WP_023483236.1\|3571569_3572793_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095256.1\|3573261_3573963_+	iron-sulfur cluster repair di-iron protein	NA	NA	NA	NA
WP_080675859.1\|3574363_3574534_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
3572778:3574168	attR	NA	NA	NA	NA
WP_023483236.1\|3574566_3575790_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095257.1\|3576265_3576745_+	hypothetical protein	NA	NA	NA	NA
WP_023484901.1\|3577134_3577491_-	hypothetical protein	NA	NA	NA	NA
WP_024095258.1\|3577884_3579573_-	copper resistance protein CopC	NA	NA	NA	NA
WP_023484899.1\|3579745_3580030_-	hypothetical protein	NA	NA	NA	NA
WP_024095259.1\|3580753_3580996_+	hypothetical protein	NA	NA	NA	NA
WP_042119831.1\|3581285_3582092_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_023484897.1\|3582088_3582766_+	response regulator transcription factor	NA	NA	NA	NA
WP_036657482.1\|3582855_3583479_+	YcnI family protein	NA	NA	NA	NA
WP_024095262.1\|3583535_3585962_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.2e-115	38.0
WP_023484894.1\|3586056_3586257_-	heavy-metal-associated domain-containing protein	A0A218MNH0	uncultured_virus	6.3e-05	40.0
WP_144029658.1\|3586277_3586562_-	metal-sensing transcriptional repressor	NA	NA	NA	NA
WP_023484892.1\|3586654_3587140_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.1e-31	42.5
WP_023484891.1\|3587194_3588151_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	6.7e-121	63.7
WP_077585182.1\|3588180_3588465_-	hypothetical protein	NA	NA	NA	NA
WP_023484889.1\|3588764_3589199_-	universal stress protein	NA	NA	NA	NA
WP_024095265.1\|3589420_3589810_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_024095266.1\|3590424_3591531_+	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_024095267.1\|3591571_3592927_+	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	E3SN07	Prochlorococcus_phage	1.4e-55	38.4
WP_024095268.1\|3592923_3594390_+	aminomethyl-transferring glycine dehydrogenase subunit GcvPB	E3ST28	Prochlorococcus_phage	6.8e-80	39.4
WP_052337463.1\|3594750_3595290_+	hypothetical protein	NA	NA	NA	NA
WP_024095270.1\|3595431_3596826_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_024095271.1\|3597038_3598151_-	anti-sigma factor domain-containing protein	NA	NA	NA	NA
WP_024095272.1\|3598143_3598962_-	RNA polymerase sigma factor SigI	NA	NA	NA	NA
WP_144029657.1\|3599181_3600141_+	hypothetical protein	NA	NA	NA	NA
WP_024095273.1\|3600395_3600821_-	hypothetical protein	NA	NA	NA	NA
WP_024095274.1\|3600930_3602154_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
WP_024095275.1\|3602404_3602605_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_042119350.1\|3602651_3604622_+	glycoside hydrolase family 15 protein	NA	NA	NA	NA
WP_036657474.1\|3604659_3605052_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_024095277.1\|3605199_3605745_-	peroxiredoxin	NA	NA	NA	NA
WP_024095278.1\|3605969_3607058_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_023484873.1\|3608017_3608353_+\|bacteriocin	uberolysin/carnocyclin family circular bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_33

3621595 : 3679151

Paenibacillus_phage(37.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024095290.1\|3621595_3622321_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_036655973.1\|3622518_3622998_-	WGxxGxxG-CTERM domain-containing protein	NA	NA	NA	NA
WP_024095291.1\|3623174_3624125_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	9.9e-48	62.8
WP_023484857.1\|3624140_3624731_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	5.4e-36	41.4
WP_023484856.1\|3624776_3625742_+	class I mannose-6-phosphate isomerase	NA	NA	NA	NA
WP_024095292.1\|3626275_3626503_-	hypothetical protein	NA	NA	NA	NA
WP_144083345.1\|3627089_3627284_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3627304_3628528_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484854.1\|3630434_3631067_-	L,D-transpeptidase	NA	NA	NA	NA
WP_024095294.1\|3631922_3633155_+	aminopeptidase	NA	NA	NA	NA
WP_023484852.1\|3633255_3634191_-	1-phosphofructokinase	NA	NA	NA	NA
WP_024095295.1\|3634257_3634824_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_023484850.1\|3635029_3635782_-	23S rRNA pseudouridine(2604) synthase RluF	NA	NA	NA	NA
WP_023484849.1\|3635901_3636687_-	DUF4240 domain-containing protein	NA	NA	NA	NA
WP_024095297.1\|3637145_3637358_+	hypothetical protein	NA	NA	NA	NA
WP_024095298.1\|3637576_3637819_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3637962_3639186_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_077585287.1\|3639464_3639863_+	VOC family protein	NA	NA	NA	NA
WP_042119352.1\|3640013_3640793_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_036655967.1\|3641645_3642167_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024095303.1\|3642545_3642890_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_023484843.1\|3643071_3643863_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-16	27.0
WP_042119837.1\|3643846_3644839_-	iron ABC transporter permease	NA	NA	NA	NA
WP_023484841.1\|3644907_3645897_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023483236.1\|3646068_3647292_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023484840.1\|3647665_3649609_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_024095307.1\|3649595_3650366_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.5e-33	36.4
WP_023484838.1\|3650617_3651208_-	hypothetical protein	NA	NA	NA	NA
WP_024095308.1\|3651756_3652077_+	alpha/beta-type small acid-soluble spore protein	NA	NA	NA	NA
WP_023484837.1\|3652140_3652587_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_023484836.1\|3652588_3653128_-	hypothetical protein	NA	NA	NA	NA
WP_024095310.1\|3653207_3653432_+	hypothetical protein	NA	NA	NA	NA
WP_024095311.1\|3653428_3653950_+	hypothetical protein	NA	NA	NA	NA
WP_023484834.1\|3653974_3654274_+	hypothetical protein	NA	NA	NA	NA
WP_023484833.1\|3654897_3655653_+	hypothetical protein	NA	NA	NA	NA
WP_042119354.1\|3655668_3656376_+	AAA family ATPase	W6JKT0	Anomala_cuprea_entomopoxvirus	2.0e-08	27.4
WP_024095313.1\|3656486_3656777_-	hypothetical protein	NA	NA	NA	NA
WP_036655952.1\|3656877_3657108_-	DUF1128 domain-containing protein	NA	NA	NA	NA
WP_023484830.1\|3657179_3657818_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.7e-35	44.0
WP_024095314.1\|3658010_3659363_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_024095315.1\|3659686_3660601_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_023484827.1\|3660664_3662689_-	transketolase	A0A2K9L6P9	Tupanvirus	1.2e-15	23.6
WP_077585284.1\|3662812_3663646_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_023484825.1\|3663747_3664893_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	2.0e-26	31.1
WP_104932528.1\|3665115_3665526_+	DUF2621 domain-containing protein	NA	NA	NA	NA
WP_024095317.1\|3665798_3666011_-	DUF3006 domain-containing protein	NA	NA	NA	NA
WP_023484823.1\|3666022_3666913_-	MBL fold metallo-hydrolase	Q332B9	Clostridium_botulinum_C_phage	5.8e-58	46.4
WP_023484822.1\|3667181_3667532_+	hypothetical protein	NA	NA	NA	NA
WP_024095318.1\|3667633_3669151_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_024095319.1\|3669229_3669403_+	YjfB family protein	NA	NA	NA	NA
WP_024092920.1\|3669877_3671101_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
WP_036657447.1\|3671251_3671935_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.5e-39	41.4
WP_036655944.1\|3673827_3674658_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_077585177.1\|3674774_3674867_-	hypothetical protein	NA	NA	NA	NA
WP_080675860.1\|3675273_3675414_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024095323.1\|3675562_3675988_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.1e-38	62.6
WP_144083347.1\|3676199_3676454_+	hypothetical protein	NA	NA	NA	NA
WP_024095326.1\|3676892_3677423_-	hypothetical protein	NA	NA	NA	NA
WP_024092852.1\|3677927_3679151_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5

DBSCAN-SWA_34

3685843 : 3751941

Paenibacillus_phage(53.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077585283.1\|3685843_3686041_+\|transposase	transposase	NA	NA	NA	NA
WP_051427985.1\|3686715_3687198_-	hypothetical protein	NA	NA	NA	NA
WP_023484400.1\|3687296_3687725_-	3'-5' exonuclease	A2I2Z6	Vibrio_virus	8.4e-23	54.8
WP_023483236.1\|3688301_3689525_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_052337466.1\|3690196_3691336_-	MFS transporter	NA	NA	NA	NA
WP_023484396.1\|3691578_3692004_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_042119357.1\|3692176_3692542_-	YjdF family protein	NA	NA	NA	NA
WP_024095336.1\|3692892_3693228_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080675861.1\|3693325_3693859_+	glycosyltransferase	NA	NA	NA	NA
WP_024092852.1\|3693963_3695187_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
WP_036655922.1\|3696230_3696629_-	hypothetical protein	NA	NA	NA	NA
WP_024095338.1\|3696641_3698603_-	toxin-like protein	A0A2I7SCU7	Paenibacillus_phage	8.8e-192	80.5
WP_042119358.1\|3700088_3700736_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3700768_3701992_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119360.1\|3702715_3702928_-	hypothetical protein	NA	NA	NA	NA
WP_024095342.1\|3703430_3705758_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_144083348.1\|3705818_3706538_-	hypothetical protein	NA	NA	NA	NA
WP_042119363.1\|3707089_3707944_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3708084_3709308_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_144083349.1\|3709606_3709840_-	hypothetical protein	NA	NA	NA	NA
WP_024095347.1\|3709950_3710691_-	DGQHR domain-containing protein	NA	NA	NA	NA
WP_024095348.1\|3710697_3710994_-	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3711026_3712250_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095349.1\|3712354_3713167_-	DGQHR domain-containing protein	NA	NA	NA	NA
WP_077585122.1\|3713721_3713937_-	hypothetical protein	NA	NA	NA	NA
WP_051427952.1\|3713930_3714617_-	hypothetical protein	NA	NA	NA	NA
WP_024095352.1\|3714583_3714946_-	UvrD-helicase domain-containing protein	S5M596	Bacillus_phage	1.7e-08	34.6
WP_024095353.1\|3715211_3717038_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HVL7	Paramecium_bursaria_Chlorella_virus	1.2e-115	41.4
WP_023483236.1\|3717781_3719005_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_042119364.1\|3719388_3720729_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_077997570.1\|3720753_3721938_-	hypothetical protein	NA	NA	NA	NA
WP_023482933.1\|3721978_3722794_-	TIGR00159 family protein	NA	NA	NA	NA
WP_024095356.1\|3722968_3723574_-	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_023482935.1\|3723643_3724222_-	RNA polymerase sigma factor SigW	A0A0F6TH34	Sinorhizobium_phage	1.7e-05	23.7
WP_024095357.1\|3724449_3727233_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_023483236.1\|3728226_3729450_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023483469.1\|3729601_3729922_-	cytochrome aa3 quinol oxidase subunit IV	NA	NA	NA	NA
WP_024095358.1\|3729922_3730543_-	cytochrome aa3 quinol oxidase subunit III	NA	NA	NA	NA
WP_023483471.1\|3730553_3732491_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
WP_024095359.1\|3732509_3733484_-	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
WP_024095360.1\|3740795_3741014_-	hypothetical protein	NA	NA	NA	NA
WP_036655466.1\|3741113_3741725_-	stage II sporulation protein M	NA	NA	NA	NA
WP_172423937.1\|3741859_3742633_+	polysaccharide deacetylase family sporulation protein PdaB	NA	NA	NA	NA
WP_024095362.1\|3742912_3743707_+	hypothetical protein	NA	NA	NA	NA
WP_024095363.1\|3743774_3744836_-	Mrp/NBP35 family ATP-binding protein	NA	NA	NA	NA
WP_042119366.1\|3744888_3745644_-	N-acetylmuramoyl-L-alanine amidase CwlD	M4ZRP4	Bacillus_phage	1.0e-10	31.3
WP_042119367.1\|3745736_3746915_-	sulfate adenylyltransferase	A0A2K9L0F0	Tupanvirus	1.1e-37	31.5
WP_024095366.1\|3746933_3747635_-	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_024095367.1\|3748354_3749524_-	C40 family peptidase	A0A1W6DXV0	Rhodococcus_phage	8.8e-14	45.1
WP_023482142.1\|3750169_3750562_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_024095368.1\|3750582_3751020_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_023482144.1\|3751182_3751941_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA

DBSCAN-SWA_35

3936222 : 4004152

Paenibacillus_phage(33.33%)

tRNA,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024095474.1\|3936222_3937446_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.1e-227	99.8
WP_024095475.1\|3937726_3939796_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.3e-46	29.5
WP_036655569.1\|3939792_3941553_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	9.1e-47	28.2
WP_024095476.1\|3941722_3941866_-	hypothetical protein	NA	NA	NA	NA
WP_023482279.1\|3943416_3944070_-	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.1e-10	27.6
WP_023483236.1\|3944285_3945509_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_080675865.1\|3945582_3945789_-	stage II sporulation protein M	NA	NA	NA	NA
WP_023483236.1\|3946621_3947845_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_023482281.1\|3948466_3949042_-	hypothetical protein	NA	NA	NA	NA
WP_024095478.1\|3949121_3949343_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_024095479.1\|3949495_3949759_-	hypothetical protein	NA	NA	NA	NA
WP_042119384.1\|3949995_3952995_+	collagenase	NA	NA	NA	NA
WP_023482283.1\|3953068_3953914_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_042119385.1\|3953910_3954603_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_036655583.1\|3954692_3955445_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.9e-08	24.9
WP_023482286.1\|3955702_3956107_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_042119873.1\|3956369_3958604_-	pyruvate synthase	NA	NA	NA	NA
WP_024095483.1\|3958691_3959702_-	2-oxoacid:acceptor oxidoreductase family protein	NA	NA	NA	NA
WP_052337472.1\|3960018_3960741_+	YwiC-like family protein	NA	NA	NA	NA
WP_080675866.1\|3960953_3962039_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_024095486.1\|3962395_3963712_+	APC family permease	NA	NA	NA	NA
WP_024095487.1\|3964122_3964434_+	hypothetical protein	NA	NA	NA	NA
WP_036655594.1\|3964703_3964895_+	hypothetical protein	NA	NA	NA	NA
WP_024095488.1\|3964970_3965624_+	hypothetical protein	NA	NA	NA	NA
WP_023483236.1\|3965738_3966962_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
WP_024095489.1\|3967187_3967697_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_077585275.1\|3967656_3967896_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-06	37.5
WP_036655600.1\|3968720_3969932_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_023482298.1\|3969928_3970609_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-36	39.3
WP_024095491.1\|3970605_3971805_+	ABC transporter permease	NA	NA	NA	NA
WP_024095492.1\|3971899_3972577_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_024095493.1\|3972573_3973155_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_024095494.1\|3973173_3974643_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	2.3e-19	46.2
WP_024095495.1\|3974632_3978313_-	nitrate reductase subunit alpha	NA	NA	NA	NA
WP_024095496.1\|3978532_3979168_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_042119387.1\|3979164_3979701_-	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
WP_024095498.1\|3979731_3980979_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_024095499.1\|3981101_3982106_-	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_023482308.1\|3982180_3983395_-	NarK/NasA family nitrate transporter	NA	NA	NA	NA
WP_052337474.1\|3983480_3984416_-	GAF domain-containing protein	NA	NA	NA	NA
WP_024095501.1\|3984462_3985119_-	response regulator transcription factor	NA	NA	NA	NA
WP_158442256.1\|3985118_3986333_-	PAS domain-containing protein	NA	NA	NA	NA
WP_024095503.1\|3986574_3987333_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_024095504.1\|3987329_3988379_+	ThiF family adenylyltransferase	A0A1V0SAV8	Catovirus	4.1e-10	26.6
WP_023482314.1\|3988477_3990142_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.8e-175	55.9
WP_036657247.1\|3990372_3991179_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
WP_024095505.1\|3991551_3992865_+	anaerobic C4-dicarboxylate transporter	NA	NA	NA	NA
WP_042119388.1\|3992941_3993721_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_036655604.1\|3994018_3994918_-	EamA family transporter	NA	NA	NA	NA
WP_024095507.1\|3995139_3996468_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_024095508.1\|3996780_3998130_+	radical SAM protein	A0A1L7N0Q5	Ralstonia_phage	5.0e-05	22.2
WP_023482320.1\|3998652_3999561_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_036655605.1\|3999812_4000352_+	hypothetical protein	NA	NA	NA	NA
WP_144083351.1\|4001643_4002231_+	hypothetical protein	NA	NA	NA	NA
WP_023482323.1\|4002232_4002796_+	stage II sporulation protein M	NA	NA	NA	NA
WP_024092945.1\|4002928_4004152_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.1e-227	99.8

Anti-CRISPR protein detection

Acr_ID: NC_023134.1|WP_024094640.1|2668472_2668724_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_023134.1|WP_024094640.1|2668472_2668724_-|hypothetical-protein

2668472_2668724_-

83 aa aa

2649110-2704948

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_023134_1	Orphan	1.1\|1647364\|32\|NC_023134\|PILER-CR,CRT	1647364-1647395	32	2685213-2685244	1
NC_023134_1	Orphan	1.8\|1647365\|31\|NC_023134\|CRISPRCasFinder	1647365-1647395	31	2685214-2685244	1

1. spacer 1.1|1647364|32|NC_023134|PILER-CR,CRT matches to NC_023134 position: 2685213-2685244, mismatch: 1

ttgtttcgatgctatatttatacgcatcaata	CRISPR spacer
ttgtttcgatgctatatttgtacgcatcaata	Protospacer
*******************.************

2. spacer 1.8|1647365|31|NC_023134|CRISPRCasFinder matches to NC_023134 position: 2685214-2685244, mismatch: 1

tgtttcgatgctatatttatacgcatcaata	CRISPR spacer
tgtttcgatgctatatttgtacgcatcaata	Protospacer
******************.************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_023134

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information