CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_023065	Magnetospirillum gryphiswaldense MSR-1 v2, complete genome	2 crisprs	Cas9_archaeal,csa3,DinG,DEDDh,PrimPol,RT	0	1	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_023065_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_023065_1

1331199-1331297

Orphan

Consensus_repeat	Method
ATGTTGTCGTGTAACACGACACTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_023065_1

>merge|NC_023065|1|1331199-1331297|CRISPRCasFinder
ATGTTGTCGTGTAACACGACACTTCCCTGGCGCTGAACGACATGGGGGCGAACATACATGCTGTATGTTGGCCGATGTTGTCGTGTAACACGACACGTC

>NC_023065|1|1|1331199-1331297|CRISPRCasFinder
ATGTTGTCGTGTAACACGACACTTC	CCTGGCGCTGAACGACATGGGGGCGAACATACATGCTGTATGTTGGCCG
ATGTTGTCGTGTAACACGACACGTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_023065.1\|WP_084028243.1\|1324598_1325432_-\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NC_023065.1\|WP_024079530.1\|1331661_1332105_+\|hypothetical-protein	unknown	unknown	unknown
NC_023065.1\|WP_024079533.1\|1334072_1337147_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182589
NC_023065.1\|WP_024079531.1\|1332404_1332752_-\|phasin-family-protein	unknown	unknown	gnl\|CDD\|378164
NC_023065.1\|WP_024079522.1\|1325497_1325743_-\|exodeoxyribonuclease-VII-small-subunit	unknown	unknown	gnl\|CDD\|179195
NC_023065.1\|WP_041633487.1\|1329321_1329585_+\|hypothetical-protein	unknown	unknown	unknown
NC_023065.1\|WP_024079528.1\|1329801_1330689_-\|hypothetical-protein	unknown	unknown	unknown
NC_023065.1\|WP_024079520.1\|1322674_1324594_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NC_023065.1\|WP_024079535.1\|1337443_1337794_-\|DUF5368-domain-containing-protein	unknown	unknown	gnl\|CDD\|375138
NC_023065.1\|WP_041634156.1\|1339230_1339875_-\|maleylacetoacetate-isomerase	unknown	unknown	gnl\|CDD\|273527
NC_023065.1\|WP_024079536.1\|1337814_1339152_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223523
NC_023065.1\|WP_024079532.1\|1332940_1334071_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|183194
NC_023065.1\|WP_024079534.1\|1337217_1337391_+\|hypothetical-protein	unknown	unknown	unknown
NC_023065.1\|WP_084027954.1\|1330901_1331180_+\|hypothetical-protein	unknown	unknown	unknown
NC_023065.1\|WP_024079523.1\|1325996_1326614_+\|30S-ribosomal-protein-S4	unknown	unknown	gnl\|CDD\|235411
NC_023065.1\|WP_024079538.1\|1339874_1340885_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NC_023065.1\|WP_008614211.1\|1327238_1328456_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271177
NC_023065.1\|WP_024079539.1\|1341053_1341278_-\|DUF2783-domain-containing-protein	unknown	unknown	gnl\|CDD\|371304
NC_023065.1\|WP_041633486.1\|1328575_1328992_+\|response-regulator	unknown	unknown	gnl\|CDD\|381098
NC_023065.1\|WP_024079524.1\|1326711_1327173_+\|response-regulator	unknown	unknown	gnl\|CDD\|381108

Protein	Function_ID	Function_description	E-value
NC_023065.1\|WP_084028243.1\|1324598_1325432_-\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	5.06595e-81
NC_023065.1\|WP_024079533.1\|1334072_1337147_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|182589	PRK10614, PRK10614, multidrug efflux system subunit MdtC; Provisional.	0
NC_023065.1\|WP_024079522.1\|1325497_1325743_-\|exodeoxyribonuclease-VII-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	6.01705e-22
NC_023065.1\|WP_024079538.1\|1339874_1340885_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	4.06937e-51
NC_023065.1\|WP_024079531.1\|1332404_1332752_-\|phasin-family-protein	gnl\|CDD\|378164	pfam09361, Phasin_2, Phasin protein. This entry describes a group of small proteins found associated with inclusions in bacterial cells. Most associate with polyhydroxyalkanoate (PHA) inclusions, the most common of which consist of polyhydroxybutyrate (PHB). These are designated granule-associate proteins or phasins.	1.88446e-10
NC_023065.1\|WP_024079535.1\|1337443_1337794_-\|DUF5368-domain-containing-protein	gnl\|CDD\|375138	pfam17336, DUF5368, Family of unknown function (DUF5368). This is a family of unknown function found in Proteobacteria and predicted to contain 2 trans-membrane regions.	1.38561e-40
NC_023065.1\|WP_041634156.1\|1339230_1339875_-\|maleylacetoacetate-isomerase	gnl\|CDD\|273527	TIGR01262, Maleylacetoacetate_isomerase, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines].	2.34685e-119
NC_023065.1\|WP_024079536.1\|1337814_1339152_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223523	COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only].	2.94894e-30
NC_023065.1\|WP_024079532.1\|1332940_1334071_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|183194	PRK11556, PRK11556, MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit.	6.27254e-72
NC_023065.1\|WP_024079520.1\|1322674_1324594_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NC_023065.1\|WP_024079523.1\|1325996_1326614_+\|30S-ribosomal-protein-S4	gnl\|CDD\|235411	PRK05327, rpsD, 30S ribosomal protein S4; Validated.	1.98709e-111
NC_023065.1\|WP_008614211.1\|1327238_1328456_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.44975e-11
NC_023065.1\|WP_024079539.1\|1341053_1341278_-\|DUF2783-domain-containing-protein	gnl\|CDD\|371304	pfam10932, DUF2783, Protein of unknown function (DUF2783). This is a bacterial family of uncharacterized protein.	2.28012e-29
NC_023065.1\|WP_041633486.1\|1328575_1328992_+\|response-regulator	gnl\|CDD\|381098	cd17544, REC_2_GGDEF, second phosphoacceptor receiver (REC) domain of uncharacterized GGDEF domain proteins. This family is composed of uncharacterized PleD-like response regulators that contain two N-terminal REC domains and a C-terminal diguanylate cyclase output domain with the characteristic GGDEF motif at the active site. Unlike PleD which contains a REC-like adaptor domain, the second REC domain of these uncharacterized GGDEF domain proteins, described in this model, contains characteristic metal-binding and active site residues. PleD response regulators are global regulators of cell metabolism in some important human pathogens. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.24883e-20
NC_023065.1\|WP_024079524.1\|1326711_1327173_+\|response-regulator	gnl\|CDD\|381108	cd17557, REC_Rcp-like, phosphoacceptor receiver (REC) domain of cyanobacterial phytochrome response regulator Rcp and similar domains. This family is composed of response regulators (RRs) that are members of phytochrome-associated, light-sensing two-component signal transduction pathways such as Synechocystis sp. Rcp1, Tolypothrix sp. RcpA, and Agrobacterium tumefaciens bacteriophytochrome response regulator AtBRR. They are stand-alone RRs containing only a REC domain with no output/effector domain. The REC domain itself functions as an effector domain. Also included in this family us Methanosaeta harundinacea methanogenesis regulatory protein FilR2, also a stand-alone RR. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.36142e-13

>NC_023065.1|WP_084027954.1|1330901_1331180_+|hypothetical-protein
MNALQNAYITLKTNNLTEGQYDFSRKWLGRDRSYYGSMKARQRQAGLRTMLTLAGNLTKALVRAKAEQRGKDAAILEKLSGRIWDSVMVGRC
>NC_023065.1|WP_024079528.1|1329801_1330689_-|hypothetical-protein
MGEKVTLDKIADKSVFEQKYRYKNKIGDRADSKIRQRKYVVESLCRDFSDKKATALALRIMNCSASQKCNQPFCPMCRHKKQELFAKYVIDKFGSVSADKLRLLTILHSVHYNPLDINSDLIKKLRKDMDNLFDKIQDCADDNIRFIGAFEIDAIAGDEELSDRKVNTLSALGYDKDAKNACFLLHFHAVMYIPSFQNPKYDIEREIRKYYNGSHQVDFTDLHKDKTHDENLHNMATYMLKFRLQHSKSVASDDDEKQFTRTQYSSLYSYPIAKSVVMAVDRCGGFQGLITRRLK
>NC_023065.1|WP_041633487.1|1329321_1329585_+|hypothetical-protein
MKAREIIDADAWLARKKERRGETISDERRQLMAMIYSDATLEREQVELERAKLELGQIKAEIIKIRAEAVKNLSSANTDAVNVTKLQ
>NC_023065.1|WP_041633486.1|1328575_1328992_+|response-regulator
MQATSKIKVLLVDDSVPYSHFVREAILQTKHECEIELAHNGLEALEKLKLRENTDEQYDIVITDLNMPIMSGFDLIRAIRQSHTLRNLAVAAISSQSRSDISKLILALGADTFFEKKGNMNSVAHDMDLALQKLVLKK
>NC_023065.1|WP_008614211.1|1327238_1328456_+|tyrosine-type-recombinase/integrase
MDVGQREIELRGGRIVLYTLASDKRGIWQARFRLGTERTLVRRSMKTTDLAEAKRTAEELYEELRYKQRNNHPLKDQTFKQLADDYVRKAQRETLEGRLSKGRLVLVEGTLKRYLLPFFGKKPINSITTADFNDYDDWRLDYWTKGYGADRKVATAATTPSAKTLVMEQSMLRQILKHGLEQGSLKQLAFMKAKRAKTNRRGAFDVKEYRLLIWTARQRTRSAEHPRVKRDRQLLELYVRLLVGTGMRVGEARGLTWRDVELIHTGNGKQTETLRLWVDGKTGKRAVIGTRAAKNTLKKLLAHYGWKDLDEARAKGNGLFTNNNGEDIHTFEVGFKNLMAAANLDTDRHGNARTLYSLRHTYATFRLLYGGTDVYLLARNMGTSVLMIEQHYGHVSTTLAADKLI
>NC_023065.1|WP_024079524.1|1326711_1327173_+|response-regulator
MTQHAQNARILIIDDNVAEATLTKLTLQADRIGYSIEHVTDGYTGIDKLKQAALTERAYHIVIVDVNMPVISGCETLEIIRNTGEIADTYVAILTSLQCKTDCPRDLYLCHAKKADIYLHKKTTLDDFEAELLQLKTDYEKCMKMTAANAKDI
>NC_023065.1|WP_024079523.1|1325996_1326614_+|30S-ribosomal-protein-S4
MTKRIEAKFKINRRLGVNLWGRGKSPLARGKETPPGQHGARRKKPSDFGTQLMAKQKLKGYYGNISEKQFRKLYDEAVRRRGDTSENLIGLLERRLDAVVYRMKMAVSPFQARQVINHGHIHVNGKRLNIASYQVKDGDIISVKQKSKDLAIILEAAQSPERDVPDYLEVDHKEMKGTFIRAPKLSDVPYPCQMEPNLVIEFYSR
>NC_023065.1|WP_024079522.1|1325497_1325743_-|exodeoxyribonuclease-VII-small-subunit
MADLPPDIATLSFEDALAELDAIVRKLETGSTRLDDAIGAYERGALLKRHCEAKLKEAQAKVDKIVLGGDGAIGLEPAGIE
>NC_023065.1|WP_084028243.1|1324598_1325432_-|polyprenyl-synthetase-family-protein
MAHLLPVPDGPERRVHDAMRYSALDGGKRLRPFLTVQAASLFNVSPAAALRVGCALEMVHCYSLIHDDLPCMDDDDLRRGRPTCHRQFDEATALLAGDALQSRAFEVLAAESTHPDPAVRCELVWQLAHAAGGMGMVGGQMVDLQAAQLTMDMADITRLQQMKTGRLIGFACEAGAILGKAPSSLRLALKNYAHDLGLAFQIADDLLDVQGDEMQVGKKLGKDADAGKATFVSLLGVEHARAQADMLAEQACRHLDPFGDAAHLLRLTARYVVTRSV
>NC_023065.1|WP_024079520.1|1322674_1324594_-|1-deoxy-D-xylulose-5-phosphate-synthase
MTMSTSQRLLDGVDCPADTRAFTPEQLRQLADEVRQEMIEAVSITGGHLGAGLGVVELTVALHHVFQTPVDKLIWDVGHQCYPHKILTGRKERIRTLRQGGGLSGFTKRSESEYDPFGAGHSSTSISAGLGMAVGRDLKGEDFNVIAVIGDGAMSAGMVYEAMNNAGSMDSRLVVILNDNDMSIAPPVGAMSAYLSRLLSSRPYLSIRHFAKDLAAMLPPPLERAAKRAEEYARGFVSGGGTLFEELGFYYVGPIDGHNFDHLLPVLKNVRDSEDNKPVLIHVVTKKGRGYPPAEQAADKYHGVGKFDVVTGALAKPKANAPSYTSVFAQALLAEAENDDRVVAITAAMPAGTGLDKFAERFPNRCFDVGIAEQHAVTFAAGLACEGFKPFCALYSTFLQRGYDQLVHDVVIQKLPVRFAIDRAGLVGADGATHAGAFDLAYLGCLPDIVLMSPADELELMHAVATAKALDDRPSAFRYPRGEGVGLDLPVRGEVLPIGKGRIIREGSRVALLSLGTRLGEAMKAADELAARGLSTTVADARFMKPLDQDMILRLAREHEVLVTIEEGSIGGFGAQVLHFLAHSGALDRGLKVRPMVLPDVFLEHEAPLKQYDLAGLNAPHIVACVLAALGQSAAVASA
>NC_023065.1|WP_024079530.1|1331661_1332105_+|hypothetical-protein
MTAFAKLKLTTATRKIEKLSAEQYARQRVLGNLAEQLGLVKAMLDGTAFTVKQTRYKTDENGERVGYERSKRLRQWFWQDADGNWLLELRYGNRPLKLSGENTAVVAGTKEQLASVIETLMEAVQVGELDKALAIAKKERLAMLRKG
>NC_023065.1|WP_024079531.1|1332404_1332752_-|phasin-family-protein
MPTANFEQIAAATKANTEALTKSGTAAIAGYQELAKAYQALATKNAEKLTASIQALAGVKNPAEFIELQQKLVKEGVEAAVADSRNIAELTQSVFTQAFEPVKAQVEALQKTVAK
>NC_023065.1|WP_024079532.1|1332940_1334071_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MNRSRIALTVAILAALAGTFWYVAGRKSTAPNAQAEAKPVPVVTAFAVEQPMPVRIEAVGNIQALAVVAIRPRVEGEVLQVHIREGQEVAQGDALFTLDARMAEANKRQAEANLARDKAQLDRARADLVRYTELLKAGSATKQKVEQSQAEAAQAEAAVKSDLAAIDNARLTMGYATIKALVPGRTGTINAKLGSLAKPGDAQSMVTITQMRPINVAFSVAESYLPRIRAAMAAGPLETVVTSTADPTLRAMGQLSFIDSAIDTTTGTIGLKATFTNDDTRLWPGQFVNVTLTLGIEDKALTIPAEAVQSGQNGTFVFAVDEQAKASIAPIRVDRVLDGSAIITDGLKAGAKVVTQGQMRLAPGLTVSERAPQAGK
>NC_023065.1|WP_024079533.1|1334072_1337147_+|efflux-RND-transporter-permease-subunit
MNFSEIFIRRPIATLLLTLVMVFGGIVGWRQLPVASLPNVDFPTISVSASLSGASPDTMASSVAAPLEREFSTIAGLETITSTSGQGSTSITLQFVLDRDIDAAAQDVQAAITRAQRRLPEEMTTPPSFRKVNPSDAPVVLLALSSPTTPLATLDDYAQTILLPRLSRLSGVAQVLVYGSQKFAVRIQLNPDALASRGIGVDELSSAIKAANSNSPLGVLNGPKQQLTLQSNAQLPNAAAFGELAIAWRDGAPVRLKDVANVLDSVENNRTASWFNGTRAIVLAVQRQPEANTVQVVDDVRALMPTIKDSLPPTVDVQVMNDRSRSIRDAIVDVQFTFAITIALVVMVIFMFLRRLSATLIPTIAMPVSLVATLGAMSLLGFSLDNISLLGLTLSVGLVVDDAIVMLENIQRHVDDGMKPFDAAIKGAREIGFTILSITVSLVAVFIPILLMGGVIGRMFHEFAVVVTLAIGISGLVSLTLTPVMCARWLRPEHDTQAGPVERGLERGFNTLLALYQRSLDWVLGHGLSMLALGIATIVATVILFREVPKGFFPTEDTGQIFIQTEAAQDISFAAMAEEQKRMAAIVGADPYVATVTSAVGVSGLSNAANSGRMFVNLVARDQRPGVEQVIGQLRKKTAGNPAISVFITPVQTLNLGGRSSKSQYQYTLEGINQAELYAFADRLTTRLMAEPLVQDVTSDLQVKSPQALVAVNRDKAAALGVRLEDVRSALYSAYGSREISTIYATIADYAVILEMDPRFQGDLSALAKLKVRSTDGTLVPLDAVAEIGRTVGPLTINHQSQLPAVTIAFNLAPDIALGQAADRIRTIQAEMGMPAGITSNFAGTAKVFQQSLSNQGILLLAAVVVIYVILGVLYESLIHPVTILSGLPSAAVGALATLMLFRQELSVIAMIGILMLIGIVKKNAIMMIDFALEAQRNQGLDPHQAIRQACLLRFRPIMMTTMAAIMGTLPIALGHGAAAELRQPLGLSVVGGLVVSQALTLYITPVLYVWFERLRQRLSRSAP
>NC_023065.1|WP_024079534.1|1337217_1337391_+|hypothetical-protein
MTEQHDEFHTCPACNQRTRHRVSRDRKLAPVLWCQRCFHVHMEAPPPPLVEPARQVA
>NC_023065.1|WP_024079535.1|1337443_1337794_-|DUF5368-domain-containing-protein
MKDLDPFVFVLVFQEMLGPVLWLLVALALFGLIGFVVVFLREGRLDSRRLVRSELMGLVGGVLALVLAAKFTVSGFTDAGGPVDWLLIGLIWGIGLAGTTILTYAVQGLVGCRKCG
>NC_023065.1|WP_024079536.1|1337814_1339152_-|NAD(P)/FAD-dependent-oxidoreductase
MGSNLDPRLGRRDLLRLMGLGGVAAGTGLVLPRQAAASTKVAGKGAKIVIVGAGAAGLSMASRLVQRLDGAEITIIDGRKAHYYQPGFTLVAGGIKPKDYVTSTTAEYLPKAVTWIEEAVAEIDPDGNKVVTASGKAVAYDYLVVATGLTLDYASIEGMDVNRIGQDGLGSIYAGPDAAFATWGAMSQFADKGGVGLFLRPNTEMKCAGAPLKYTFLTDDYLRRRGNRGKAEVIYAANNKALFSVPIVSEKVRMLFRDRGVKVQYDHIQTGIDLGRKVAMFSTPTGPTEIKYDFINVVPPMRAPAAVRNSPLRWQEGPWAGDGWMEVDKSTLRHKRYANVFGVGDIAGVPKGKTAASVKWQVPVAVDHLVASIAGTQATSVYNGYTSCPLITRLGQAMLVEFDYDNNLVPSFPGIIAPLEELWITWVMKTMALKPTYLTMLRGQA
>NC_023065.1|WP_041634156.1|1339230_1339875_-|maleylacetoacetate-isomerase
MRLYTYFRSSAAYRVRIALNLKGIDYQAVPVHLVRNGGEHKSADYLALNPQGLVPALAVDGQVLTQSLAILEYLNETHPDPALLPADPLGRARVRAIAQAIACDIHPINNLRVLQYLGGTLGLDQAAKDDWYRHWVQTGLQAVEAMLAADRRTGVFCHGDQPGLADCCLVPQVFNARRFNCDLTALPTIMRIAERCEQIDAFNQAAPAQQPDFE
>NC_023065.1|WP_024079538.1|1339874_1340885_-|fumarylacetoacetate-hydrolase-family-protein
MKLATLKQGGRDGTLVVVSRDLSRCVAVPHVARTLQAALDDWDTLAPKLEAVSVGLNAGSNAEAFPFDPVACASPLPRAYQWADGSAYINHVELVRKARGATLPPEFHTDPLMYQGGSDSFVGPRDPIVAVTEDWGIDLEAEVAVITGDVPMAASREQCAQAIRLVMLVNDVSLRNLIPAELAKGFGFVQSKPASAFSPVAVTPDELGAAWDGAKVSLPLVVDINDKPFGRPNAGQDMTFDFPQLITHLAKTRELEAGSIIGSGTVSNKQGDLWGSSIDNGGIGYCCIAEVRMYETIEAGAPKTGFLKFGDSVRIRMDDADGNNIFGDICQQVVKL
>NC_023065.1|WP_024079539.1|1341053_1341278_-|DUF2783-domain-containing-protein
MSLITTPNFHQTGKRYFREFSPNDDFYEMLIETHRDLSDEQSNMVNAKLILLLANHIGDMDVLAEAMKAAREDV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_023065_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_023065_2

2916096-2916177

Orphan

Consensus_repeat	Method
TGGCATTGACGTCGCGACCGACGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_023065_2

>merge|NC_023065|2|2916096-2916177|CRISPRCasFinder
TGGCATTGACGTCGCGACCGACGCTCAGTTGATCGTCGCCGTTGCCGATATTGATGCTGGCGTTGACGTCGCGACCGACGCT

>NC_023065|2|2|2916096-2916177|CRISPRCasFinder
TGGCATTGACGTCGCGACCGACGCT	CAGTTGATCGTCGCCGTTGCCGATATTGATGC
TGGCGTTGACGTCGCGACCGACGCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_023065.1\|WP_024080972.1\|2904871_2905336_-\|molybdenum-cofactor-biosynthesis-protein-MoaE	unknown	unknown	gnl\|CDD\|238385
NC_023065.1\|WP_024080990.1\|2930899_2931667_+\|peptidoglycan-editing-factor-PgeF	unknown	unknown	gnl\|CDD\|376831
NC_023065.1\|WP_024080981.1\|2911936_2912791_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_023065.1\|WP_024080979.1\|2910170_2910950_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|236389
NC_023065.1\|WP_024080987.1\|2928044_2929031_+\|ADP-glyceromanno-heptose-6-epimerase	unknown	unknown	gnl\|CDD\|274028
NC_023065.1\|WP_024080980.1\|2910991_2911888_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_023065.1\|WP_041633640.1\|2907311_2907875_-\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|273139
NC_023065.1\|WP_024080977.1\|2907885_2909781_-\|excinuclease-ABC-subunit-UvrC	unknown	unknown	gnl\|CDD\|234792
NC_023065.1\|WP_024080985.1\|2926992_2927496_-\|YbjN-domain-containing-protein	unknown	unknown	gnl\|CDD\|341116
NC_023065.1\|WP_024080974.1\|2905588_2906818_-\|molybdopterin-molybdotransferase-MoeA	unknown	unknown	gnl\|CDD\|238452
NC_023065.1\|WP_024080986.1\|2927672_2927930_-\|accessory-factor-UbiK-family-protein	unknown	unknown	gnl\|CDD\|377337
NC_023065.1\|WP_024080971.1\|2903743_2904871_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224343
NC_023065.1\|WP_024080973.1\|2905340_2905592_-\|molybdopterin-converting-factor-subunit-1	unknown	unknown	gnl\|CDD\|273753
NC_023065.1\|WP_024080992.1\|2932870_2933797_+\|ribose-phosphate-pyrophosphokinase	unknown	unknown	gnl\|CDD\|234929
NC_023065.1\|WP_024080975.1\|2906820_2907315_-\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|349770
NC_023065.1\|WP_024080988.1\|2929039_2929837_+\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|234599
NC_023065.1\|WP_041634535.1\|2924028_2926125_-\|excinuclease-ABC-subunit-UvrB	unknown	unknown	gnl\|CDD\|235395
NC_023065.1\|WP_024080989.1\|2929836_2930889_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|224481
NC_023065.1\|WP_041634536.1\|2926136_2926934_-\|pyrroline-5-carboxylate-reductase	unknown	unknown	gnl\|CDD\|237008
NC_023065.1\|WP_024080991.1\|2931747_2932863_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030

Protein	Function_ID	Function_description	E-value
NC_023065.1\|WP_024080972.1\|2904871_2905336_-\|molybdenum-cofactor-biosynthesis-protein-MoaE	gnl\|CDD\|238385	cd00756, MoaE, MoaE family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), which carries the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase in the second major step in Moco biosynthesis. MPT synthase is a heterotetramer consisting of two large (MoaE) and two small (MoaD) subunits.	1.0014e-54
NC_023065.1\|WP_024080990.1\|2930899_2931667_+\|peptidoglycan-editing-factor-PgeF	gnl\|CDD\|376831	pfam02578, Cu-oxidase_4, Multi-copper polyphenol oxidoreductase laccase. Laccases are multi-copper oxidoreductases able to oxidize a wide variety of phenolic and non-phenolic compounds and are widely distributed among both prokaryotes and eukaryotes. There are two main active catalytic sites with conserved histidines that are capable of binding four copper atoms.	1.04506e-86
NC_023065.1\|WP_024080981.1\|2911936_2912791_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.32773e-61
NC_023065.1\|WP_024080979.1\|2910170_2910950_-\|SDR-family-oxidoreductase	gnl\|CDD\|236389	PRK09134, PRK09134, SDR family oxidoreductase.	1.21199e-132
NC_023065.1\|WP_024080987.1\|2928044_2929031_+\|ADP-glyceromanno-heptose-6-epimerase	gnl\|CDD\|274028	TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase. This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of lipopolysaccharide (LPS) for Gram-negative bacteria. This enzyme is homologous to UDP-glucose 4-epimerase (TIGR01179) and belongs to the NAD dependent epimerase/dehydratase family (pfam01370). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	5.18759e-146
NC_023065.1\|WP_024080980.1\|2910991_2911888_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	6.51266e-48
NC_023065.1\|WP_041633640.1\|2907311_2907875_-\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	gnl\|CDD\|273139	TIGR00560, pgsA, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. Alternate names: phosphatidylglycerophosphate synthase; glycerophosphate phosphatidyltransferase; PGP synthase. A number of related enzymes are quite similar in both sequence and catalytic activity, including Saccharamyces cerevisiae YDL142c, now known to be a cardiolipin synthase. There may be problems with incorrect transitive annotation of near homologs as authentic CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [Fatty acid and phospholipid metabolism, Biosynthesis].	8.42776e-43
NC_023065.1\|WP_024080977.1\|2907885_2909781_-\|excinuclease-ABC-subunit-UvrC	gnl\|CDD\|234792	PRK00558, uvrC, excinuclease ABC subunit UvrC.	0
NC_023065.1\|WP_024080985.1\|2926992_2927496_-\|YbjN-domain-containing-protein	gnl\|CDD\|341116	cd17033, DR1245-like, possible type III secretion system (T3SS) chaperone protein DR1245 found in Deinococcus radiodurans. This family includes a possible type III secretion system (T3SS) chaperone protein DR1245 found in Deinococcus radiodurans, a bacterium that is exceptionally resistant to the lethal effects of ionizing radiation (IR), ultraviolet light and other DNA-damaging agents. DR1245, a protein of unknown function conserved only in the Deinococcaceae, and with strong structural homology to YbjN proteins and T3SS chaperones, may display some chaperone activity towards DdrB, a protein found to be highly up-regulated following irradiation; DR1245 may also bind to other substrates.	4.85641e-57
NC_023065.1\|WP_024080974.1\|2905588_2906818_-\|molybdopterin-molybdotransferase-MoeA	gnl\|CDD\|238452	cd00887, MoeA, MoeA family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF), an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. MoCF contains a tricyclic pyranopterin, termed molybdopterin (MPT). MoeA, together with MoaB, is responsible for the metal incorporation into MPT, the third step in MoCF biosynthesis. The plant homolog Cnx1 is a MoeA-MogA fusion protein. The mammalian homolog gephyrin is a MogA-MoeA fusion protein, that plays a critical role in postsynaptic anchoring of inhibitory glycine receptors and major GABAa receptor subtypes.	3.59623e-172
NC_023065.1\|WP_024080986.1\|2927672_2927930_-\|accessory-factor-UbiK-family-protein	gnl\|CDD\|377337	pfam04380, BMFP, Membrane fusogenic activity. BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS. BMFP interacts with phospholipid vesicles though the predicted amphipathic alpha-helix induced in the N-terminal half of the protein and promotes aggregation and fusion of vesicles in vitro.	6.9666e-21
NC_023065.1\|WP_024080971.1\|2903743_2904871_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224343	COG1426, COG1426, Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown].	4.53673e-21
NC_023065.1\|WP_024080973.1\|2905340_2905592_-\|molybdopterin-converting-factor-subunit-1	gnl\|CDD\|273753	TIGR01682, Molybdopterin_synthase_sulfur_carrier_subunit, molybdopterin converting factor, subunit 1, non-archaeal. This model describes MoaD. It excludes archaeal homologs, since many Archaea have two MoaD-like proteins, suggesting two different functions. pfam02597 describes both the thiamine biosynthesis protein ThiS and this protein, MoaD, a subunit (together with MoaE, pfam02391) of the molybdopterin converting factor. Both ThiS and MoaD are involved in sulfur transfer reactions. Distribution of this family appears limited to species that also have a member of pfam02391, but a number of Archaea have two different members, suggesting functionally distinct subtypes. The C-terminal Gly-Gly of this model is critical to function. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin].	1.29746e-26
NC_023065.1\|WP_024080992.1\|2932870_2933797_+\|ribose-phosphate-pyrophosphokinase	gnl\|CDD\|234929	PRK01259, PRK01259, ribose-phosphate diphosphokinase.	0
NC_023065.1\|WP_024080975.1\|2906820_2907315_-\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	gnl\|CDD\|349770	cd03116, MobB, molybdopterin-guanine dinucleotide biosynthesis protein B. Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In Escherichia coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.	1.41888e-76
NC_023065.1\|WP_024080988.1\|2929039_2929837_+\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|234599	PRK00052, PRK00052, prolipoprotein diacylglyceryl transferase; Reviewed.	1.00396e-107
NC_023065.1\|WP_041634535.1\|2924028_2926125_-\|excinuclease-ABC-subunit-UvrB	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
NC_023065.1\|WP_024080989.1\|2929836_2930889_+\|SAM-dependent-methyltransferase	gnl\|CDD\|224481	COG1565, COG1565, Uncharacterized conserved protein [Function unknown].	2.39911e-108
NC_023065.1\|WP_041634536.1\|2926136_2926934_-\|pyrroline-5-carboxylate-reductase	gnl\|CDD\|237008	PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed.	4.47937e-101
NC_023065.1\|WP_024080991.1\|2931747_2932863_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	1.8809e-07

>NC_023065.1|WP_024080981.1|2911936_2912791_-|serine/threonine-protein-kinase
MTAPARLGIYEIRELVVTSSFSHLYRAHDPLLDRWVAIKVFDLSPEKEASLPYERQEWQRRFVAEARILAAMDHPHVVRVDAMGHLPDGAPYMVMPWHVANLRREIGRDVFDPERQKTVPVEQRPRAVAPERAIEILRQTCLGLAALHRRGIVHRDVKPSNLLLTERHDGMIRLCDLGMAKQGADMSRSRAGVWIGTLDYLAPEQRENAAAATDRADVYAVGVLAYRLLTGKLPVGAFAPVSTLVEGVGTELDHWVGDALAPDPVLRPPAIRMAARLAQGVLKA
>NC_023065.1|WP_024080980.1|2910991_2911888_-|serine/threonine-protein-kinase
MERIGKYVVHKSVQTTGYARIVFCHDPDLQIPVALKVFAAKASDSDPLSVPQWLTRFQAEARALATFDHPHIIAVKSMETGTSGRPFFVMPYMAANLRFEIGKDNVTEGEEKSRRLPLARALSLLKQTSSGLMSLHRRGMVHRAVKPGNLLLTARENGQIKLADFSMVKLPERNPPLPDHWMGDTDYCAPEQRESATTVDARADVYSLGVLACRLLTGTLPDLSAGAVELPGKFSELLVKLVRDATDPDPAKRPAHAGAFLQGLGQVPVEAAAKPKVHVVPMRRVPAATKAALPIAGE
>NC_023065.1|WP_024080979.1|2910170_2910950_-|SDR-family-oxidoreductase
MTDISSLIPRTALVTGAARRLGRAMALELAQAGFAVAIHYSRSRDEAASLAAEIVGHGGRAALVAGDLAVEADMQALMPQAVAALGPIGVLVNNASTFERDEVDSASRASWDFHMEVNLRAPFVLSQAMAAALPDDAHGVIVNLIDQRVWNLTPHFTTYTLSKAGLWTLTQTLALALAPRIRVAGIGPGPALPSVRQTQAQFDAQCAGTPLAVGTSPDEVAAALRFILSSRSYTGQMVALDGGQHLQWAPAAAGFAGIE
>NC_023065.1|WP_024080977.1|2907885_2909781_-|excinuclease-ABC-subunit-UvrC
MTTDNAHRAESDLSDRPLAVGVTVIERFLATLPATPGVYRMLNQRGDVLYVGKAKSLKKRVVAYTKPERQTLRIQRMIAETAFMEVITTHTEVEALLLESNLIKTLGPRYNILLKDDKTFPHILLTGDHDWPQVVKHRGARSRRGEYFGPFASAGAVNQTLSALQRAFLLRSCTDSVFSSRTRPCLLFQIKRCSAPCVDRIDHAEYMDLVAQARAFLSGQSQVIQRDLAKRMEASAEAMEYEQAAVYRDRIRALSRIQAHQDINPADVAEADVVALHQAGGQTCVQVFFFRSGCNYGNRAYFPQHAAEAEASEVMAAFLGQFYADKQPPREILLSQEPAEAEIVAAALSAKAGRKVIVSVPKRGDRKRLIEHAYDNAREALGRRMAESSAQGTLLDGVAELFGLDARPTRIEVYDNSHIQGTNAVGGMIVAGPDGLMKAAYRKFNIRSTELTPGDDFAMMREVLTRRFQRAQKEDPDRDRGQWPDLVLIDGGLGQLNATVEVLADLGIEDVALVSIAKGPDRNAGRERFFMPGKEPFSLPMKDPVLYFLQRLRDEAHRFAIGAHRTRRAGDMVRSPLDEIDGIGAARKKALLHHFGSAREAAAAGLADLEAVPGISKSMAKKIYDHFHPQG
>NC_023065.1|WP_041633640.1|2907311_2907875_-|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase
MLTSLPNLLTLSRIVVIPLVILTFYIEGAWTHWAACALFVAAAITDWFDGWLARSWNQVSAFGRFLDPIADKLLVAAVLFMLVAFDRVSQWSELPALVILLREILVSGLREFLAEIRVGMPVTRLAKWKTGFQMVALPVLLVGQAGPAMIPVQAIGEGFLWVAAALTMITGWDYLRSGLKHLTGPTK
>NC_023065.1|WP_024080975.1|2906820_2907315_-|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B
MKIFGLSGHSGSGKTTLMVKLVPLLTAKGLTVSTIKQANAGFDADKPGKDSYLHREAGAKEVLVASAKRWALMHEYRDEPEFTMDQLLARMSAVDLVLVEGFRQWPHPRIEVWRQAVGKPPFFPDDPQVVAVASPDQPDGLDRPLLDLDDAGAITRFILKNLGF
>NC_023065.1|WP_024080974.1|2905588_2906818_-|molybdopterin-molybdotransferase-MoeA
MAYDAGDTMISVEQALALLESRVQPLGLTEVVALPDALGRVLAEDVVSPLDVPAFANSAMDGYAFALAGLPADGRLRRVGRSAAGHPFDGVVGAGECIRILTGAMMPQGADCVAMQEDCSVDGDVVTVPTSLKPGANWRHAGEDVAHGATVLYTGSRLRPQEIGLAAAVGRTALRVYRPLRAAVFSTGDEINPPGSPLPPGGIYDSNRFTAGALLRALGIEVTDLGILADDRAAIIAALDKAALDHDVILTSGGVSVGDEDHVKAAVETLGALHFWRLAIKPGKPVALGEIKGRTFIGLPGNPVAVMVCFMLLARPLLLRLMGLRQCAPLMVPVRADFSFRRKPGRREWLRARVVNRDGQLWAEKFPVESSGVLSSMVWAEGLVAVPEDMGDVAPGALLDFVSFAEVLR
>NC_023065.1|WP_024080973.1|2905340_2905592_-|molybdopterin-converting-factor-subunit-1
MNVLYFAWLRAKVGVGEEILVVPENVTTTGALVEWLKTRSDGHAQAFADLKLVRVAVNQDYVGWDHPIKPADEVAFFPPVTGG
>NC_023065.1|WP_024080972.1|2904871_2905336_-|molybdenum-cofactor-biosynthesis-protein-MoaE
MIRVQAEDFDPGAELAAFSAGNGKVGGICMFLGLVRDYLGDHPGQGAGVSAMTLEHYPGMTERQLAAIEAEARDRWPLHEVLIIHRHGRLEPGERIVLVATASSHREAAFQSCHFLMDWLKTKAPFWKIEHTDQGDQWVAAKDEDDDAARRWTR
>NC_023065.1|WP_024080971.1|2903743_2904871_+|helix-turn-helix-domain-containing-protein
MSTTTPDETSETPAPLPQSVGATLRHARSQTGKSLAEVASMLRIRQPYLLALEEGRHKDLPGGAYAIGFLRTYSEFLDLDGEEMLRRFRAEASGDLHPRSELVFPSPVSEGRIPGGAVLFVGLLLAGIAYGGWYLLSSRDTSVAEMVPALPDRLTSVLNRPANVTAEPQPAKKAPEPVKLNEPANLTPAKETEVVPPAEEEEAKPKPVEPSPPPVTPPAPAKVEPVKAEPVKAEPAKPEPPKPEPVKAEPVKVETPKPVEPTKVEPAKVEPPKAEPPKAEATKPSVDHGDSRVVLTAAGDDCWIQVREMDGQLLMSRLLRKGDAYAVPNRPGLTLMVGNAGALDVAVDGRKAPALGAAGQVRRDIRLDPDKLSGG
>NC_023065.1|WP_041634535.1|2924028_2926125_-|excinuclease-ABC-subunit-UvrB
MSLPFVDRPDLPTGPADFKLVSDYQPAGDQPTAIATLVAGLESKERDQVLLGVTGSGKTFTMAHVIATTKRPALVLAHNKTLAAQLYAEMKSFFPDNAVEYFVSYYDYYQPEAYIPRTDTYIEKDSQINEQIDRMRHAATRALLERRDVIIVASVSCIYGIGSVESYARMTLKLVVGESIDRTELLKRLVELQYTRNDAAFERGTFRVRGDSVEIFPVHYEDRAWQVSLWGDEIEGIAEFDPLTGEKTVRLSEVVVYPSSHYVTPRPTITAALAGIKAELKATVAHFEAEGKLLEAQRIRERTTFDIEMLETTGHCKSIENYSRYLTGRKPGEPPPTLFEYLPPDALLIVDESHVTVPQIGGMYRGDYARKSTLSEFGFRLPSCIDNRPLKFEEWDIMRPSSLFVSATPGPWEMDRTGGVFAEQVIRPTGLIDPICIIRPVEHQVDDLLAEVRQMAAQGHRTLVTVLTKRMAEDLTEYLHDHGIRVRYLHSDIDTLERIEIIRDLRLGAFDVLIGINLLREGLDIPECALVAILDADKEGFLRSKTSLIQTIGRAARNIDGRVILYADKMTDSLKYAIDETNRRREKQQAYNVAHGITPEGIKKAVGDVLESVYEKDYLTVDTGDSGLAHGVGHNLAAVKADIEKRMKAAAADLEFEEAARLRDELRRLEAQELGVPAAPGPRGAAPKPQPKGRGRRR
>NC_023065.1|WP_041634536.1|2926136_2926934_-|pyrroline-5-carboxylate-reductase
MTKILLVGCGKMGSAMLAGWLERGIRAADVVVIDPHAQGLPDGVTVLGDVDLLSKTFIPDITILAVKPQVMAEVLPAYARLAGQTVFLSIAAGKPVEFFRRHLGEAAAVIRAMPNTPAAVQRGITVCFAGPGVAQEPRALAQSLLEAVGEVAWIDDESQMDAVTAVSGSGPAYVFLLAEVMAAAGVAAGLPADLADRLARATVSGGGELLRQSLDSSAQLRINVTSPGGTTAAALAVLMDEAKGMAPLMTDAVAAATKRGKELAG
>NC_023065.1|WP_024080985.1|2926992_2927496_-|YbjN-domain-containing-protein
MSMALAHEEDFVINPLDLIEQFVTANDWAFDRRSDDELAVEMPGKWCNYSLYFAWREDMGAMHFTCAFDMKVPSGKHPVICELLAAINEKLWLGHFGLWDDEGVPMFRHTSLVRGTEGLSPEQVEDLMDIALTECERFYPAFQFVIWGGKSAKDAVACSLLDTVGEA
>NC_023065.1|WP_024080986.1|2927672_2927930_-|accessory-factor-UbiK-family-protein
MQTQNPFFDDLARMAGGALGALSGLRAEIEGLIRQQMERFMAGVDMVPREEFEVVRDMAIKAREENDALAKRLADLEAKLADKSS
>NC_023065.1|WP_024080987.1|2928044_2929031_+|ADP-glyceromanno-heptose-6-epimerase
MIVVTGGAGFIGSNILAALEARDAGKLVVCDRLRSNDKWKNVAKRELADIVHPEQLFDFLEANRKHVQVIFHMGAISATTETDGDKIAANNFSLSLALWKWCALSNVRFIYASSAATYGDGSFGFDDDWSIDHLAKLQPLNAYGWSKHLFDRRVARKIQQGSRKPPQFAGLKFFNVYGPNEYHKGGQQSVVSQIYPHAKQDAAYQLFRSHNPQYKDGGQMRDFIWVEDCVDVMMWLLDNPQVNGIFNVGTGKARSFIDLASQVYKALGKEPKIKFQDTPVAIRDKYQYFTQASEKNLRAAGYTRAFTSLEEGVTKYVQHFLDRPDRYK
>NC_023065.1|WP_024080988.1|2929039_2929837_+|prolipoprotein-diacylglyceryl-transferase
MLTYPHIDPIAIQLGPIAIRWYALAYITGLTLGWLYIKRLVRFPPHAMREADVDDFLVWATLGVVFGGRLGYVLFYKPGYYLSHPLEIFQLWQGGMAFHGGALGVILAIILFARRRGLNLFAIGDVVCCAVPIGLFFGRIANFINGELYGRVAPDALFAMVFPGGGPEPRHPSQLYQAGLEGLALFLLLAVLWRIRPFREKRGALAGTFLMGYGVARIIGEFFRQPDAHLGFLIGGATMGQLLSIPLILAGAGVIAWAFKRGHRP
>NC_023065.1|WP_024080989.1|2929836_2930889_+|SAM-dependent-methyltransferase
MRSLAEKLAARIAQGGPITVADFMHEAVGQYYATRDPFGRQGDFTTAPEVSQMFGELIGLWCVMVWQMMGAPDKVVLAELGPGRGTLMNDLLRAAGVVPAFLKAADIRLVETSPRLTALQRQTLSGRDVQWCENVDQLPDGPLIVIANELFDALPIRQFVKHDGQWCERMVGLDGDGFCFVAGPAADPDLPAEVLATPDGAIVETCDGGRALAASLGKRLNRQPGFALIIDYGHGRSGTGDTLQAVRHHRFHPVLDQPGLADITAHVDFQALAGAAVPARAWGPVDQGGFLRALGIETRAHLLAQAGGDKVAADIMGQLRRLIDPGEMGTLFKALALASPHFPAPPGFVS
>NC_023065.1|WP_024080990.1|2930899_2931667_+|peptidoglycan-editing-factor-PgeF
MITLSALNEIIHIRHGFFTREGGVSTGLYTSLNCGPGSADQPAAVAENRGRAMAMMDLPETALVTVHQAHTADVVTVTGPWAEGSRPTADAMVTTVPGLALGILTADCAPVLLADRKNGIVAAAHAGWKGAIGGVLENTIARMVELGAKPKNIVGAIGPCIGQRSYEVGPDFPAAFLAENADNADFFAPSRRDGHFLFDLPGYVSRKLARLGLIDVTRVPADTCRDGARFFSYRRATLNNEPDYGRQVSVIVRER
>NC_023065.1|WP_024080991.1|2931747_2932863_+|hypothetical-protein
MRIITALALLLAVAACETVPRPFKHEDGAVNALARPKLGRGIALHSAGEIAAGEALSEAVIKAFEDREIPVTLRRGPGFGRVIEVAPEGNTVLWRLLAADGAEMSRLSTSPTMSGKLAAAQVAAQFHPFLEDPDAKPQLAPGRVLPQMPKIRVEPMKGLPGDGDTALPQALAKALAREGVEIAADAAFTVVGVVTVAQVNTTDDNVTISWLIKQGDAGGTQLARIDQSGAVPRGRLNLTWGSMARDIAEGGASGVAEVLRAAERNRKEQEAQAGSRQFTEPRPADIGKPESSDQTDPARTSPPPPVEPAPPAAVASPQAPPQAMPAKPIKAKPVKPKPAKATKPAKSSASKKVKPAPTKTVKAAPRTKPDR
>NC_023065.1|WP_024080992.1|2932870_2933797_+|ribose-phosphate-pyrophosphokinase
MKILACNSNRPLAEAIAEYMTMSITKASVRRFSDMEVFVEVHENVRGEDVFVIQSTCYPTNDNLMELLITLDALKRGSARRITAVIPYFGYARQDRKSGPRTPISAKLVANLITTAGADRVVTLDLHSGQIQGFFDIPLDNLYAAPVFVNDIRARYDNVMIVSPDVGGVVRARAIASRIDADLAIIDKRRERAGVSEVMNIIGDVKGRRCILVDDIVDSAGTLCNAAEALMKSGAVSVSAYVTHGVLSGGAVARVTSSPLEELVITDSIPATEAMKLAHNIRQSTIAPLMAESIQRISEERSVSSLFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	225018-225049	5	0.844
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1919966-1919997	5	0.844
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1919966-1919997	5	0.844
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1837775-1837806	6	0.812
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1845113-1845144	6	0.812
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1839984-1840015	6	0.812
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1841331-1841362	6	0.812
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1842408-1842439	6	0.812
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	505424-505455	8	0.75
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1276086-1276117	9	0.719
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	395798-395829	10	0.688
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	44235-44266	10	0.688
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	392857-392888	10	0.688
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	384731-384762	10	0.688
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	392851-392882	10	0.688
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NC_028878	Mycobacterium phage Archie, complete genome	22943-22974	10	0.688
NC_023065_2	2.1\|2916121\|32\|NC_023065\|CRISPRCasFinder	2916121-2916152	32	NZ_CP047236	Gordonia sp. JH63 plasmid pJH63-1, complete sequence	12608-12639	11	0.656

1. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 5, identity: 0.844

-cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
gccgttg-ccgttgccgttgccgatatggatgc	Protospacer
 * **** .***.************** *****

2. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.844

-cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
gccgttg-ccgttgccgttgccgatatggatgc	Protospacer
 * **** .***.************** *****

3. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.844

-cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
gccgttg-ccgttgccgttgccgatatggatgc	Protospacer
 * **** .***.************** *****

4. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cagtt-gatcgtcgccgttgccgatattgatgc	CRISPR spacer
-agtcaggccgttgccgttgccgatatggatgc	Protospacer
 ***. *..***.************** *****

5. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cagtt-gatcgtcgccgttgccgatattgatgc	CRISPR spacer
-agtcaggccgttgccgttgccgatatggatgc	Protospacer
 ***. *..***.************** *****

6. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cagtt-gatcgtcgccgttgccgatattgatgc	CRISPR spacer
-agtcaggccgttgccgttgccgatatggatgc	Protospacer
 ***. *..***.************** *****

7. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cagtt-gatcgtcgccgttgccgatattgatgc	CRISPR spacer
-agtcaggccgttgccgttgccgatatggatgc	Protospacer
 ***. *..***.************** *****

8. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

cagtt-gatcgtcgccgttgccgatattgatgc	CRISPR spacer
-agtcaggccgttgccgttgccgatatggatgc	Protospacer
 ***. *..***.************** *****

9. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
ccgcatcacgtcgccgttgacgatgttgatgc	Protospacer
* *.    *********** ****.*******

10. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 9, identity: 0.719

cagttgat--cgtcgccgttgccgatattgatgc	CRISPR spacer
--gtcagcgacgtcgtcgttgccgatatcgatga	Protospacer
  **....  *****.************.****

11. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 10, identity: 0.688

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
ggcctgatcggcgccgttgtcgatattaccga	Protospacer
 . .****** ********.*******. .*

12. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 10, identity: 0.688

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
ggtgaaatcgttgccgttgccgaaattgaagt	Protospacer
 .   .*****.*********** ***** *.

13. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 10, identity: 0.688

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
ggcctgatcggcgccgttgtcgatattaccga	Protospacer
 . .****** ********.*******. .*

14. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 10, identity: 0.688

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
ggtgaaatcgttgccgttgccgaaattgaagt	Protospacer
 .   .*****.*********** ***** *.

15. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 10, identity: 0.688

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
ggcctgatcggcgccgttgtcgatattaccga	Protospacer
 . .****** ********.*******. .*

16. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NC_028878 (Mycobacterium phage Archie, complete genome) position: , mismatch: 10, identity: 0.688

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
gccctgaccatcgccgttgccgatattagccc	Protospacer
   .***.*.*****************... *

17. spacer 2.1|2916121|32|NC_023065|CRISPRCasFinder matches to NZ_CP047236 (Gordonia sp. JH63 plasmid pJH63-1, complete sequence) position: , mismatch: 11, identity: 0.656

cagttgatcgtcgccgttgccgatattgatgc	CRISPR spacer
tgaccagtcgtcgccgttgccgagagtgatcg	Protospacer
.......**************** * ****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

626420 : 741789

109

Acidithiobacillus_phage(23.08%)

capsid,integrase,portal,terminase,bacteriocin,head,transposase

attL 638350:638366|attR 686921:686937

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024078834.1\|626420_626699_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0P0I4A4	Acinetobacter_phage	1.0e-13	45.0
WP_024078835.1\|626914_627781_-	RNA polymerase sigma factor RpoH	I1ZBD5	Salisaeta_icosahedral_phage	2.5e-05	24.9
WP_024078836.1\|627918_628902_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	8.7e-07	27.8
WP_024078837.1\|628950_629271_+	hypothetical protein	NA	NA	NA	NA
WP_024078838.1\|629267_629738_+	M67 family metallopeptidase	NA	NA	NA	NA
WP_024078840.1\|630620_631826_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.4e-91	47.0
WP_024078844.1\|633424_634666_-	hypothetical protein	NA	NA	NA	NA
WP_024078846.1\|635354_635801_+\|transposase	transposase	NA	NA	NA	NA
WP_084027885.1\|635937_637446_-	B12-binding domain-containing radical SAM protein	NA	NA	NA	NA
WP_041633417.1\|637854_638037_-	hypothetical protein	NA	NA	NA	NA
WP_041633418.1\|638205_639939_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-26	24.9
638350:638366	attL	NA	NA	NA	NA
WP_158497719.1\|640013_640733_-	metallophosphoesterase	V9QL63	Rhizobium_phage	9.8e-24	35.5
WP_024078851.1\|640922_641489_+	polysaccharide biosynthesis/export family protein	NA	NA	NA	NA
WP_162472130.1\|642419_642569_-	hypothetical protein	NA	NA	NA	NA
WP_084028217.1\|643199_643868_+	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_158497720.1\|644180_645584_+	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_144084363.1\|645533_646424_-	sugar transferase	NA	NA	NA	NA
WP_024078856.1\|646848_648048_-	hypothetical protein	NA	NA	NA	NA
WP_024078857.1\|648078_648792_-	hypothetical protein	NA	NA	NA	NA
WP_144084267.1\|648875_649598_-	methyltransferase	NA	NA	NA	NA
WP_024078859.1\|649896_650565_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_084027889.1\|650707_652150_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_158497721.1\|652170_654399_+	polysaccharide biosynthesis tyrosine autokinase	NA	NA	NA	NA
WP_024078862.1\|654382_655039_+	hypothetical protein	NA	NA	NA	NA
WP_024078863.1\|655032_656403_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_052588846.1\|656399_657506_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SJE0	Klosneuvirus	1.6e-25	27.4
WP_052588847.1\|657681_659484_+	asparagine synthase (glutamine-hydrolyzing)	A0A0N9QYX6	Chrysochromulina_ericina_virus	8.8e-05	23.4
WP_024078866.1\|659474_660704_+	hypothetical protein	NA	NA	NA	NA
WP_024078867.1\|660688_661957_+	membrane protein of unknown function	NA	NA	NA	NA
WP_024078868.1\|661953_664212_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_024078869.1\|664359_664524_+	hypothetical protein	NA	NA	NA	NA
WP_024078870.1\|664520_666437_+	asparagine synthetase B	G8DDK6	Micromonas_pusilla_virus	1.7e-06	27.0
WP_024078871.1\|666611_666911_+	PqqD family protein	NA	NA	NA	NA
WP_024078872.1\|666913_667834_+	hypothetical protein	NA	NA	NA	NA
WP_024078873.1\|667830_668667_+	sulfotransferase domain-containing protein	NA	NA	NA	NA
WP_024078875.1\|668954_669389_+	lasso peptide biosynthesis B2 protein	NA	NA	NA	NA
WP_024078876.1\|669385_669988_+	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_106001305.1\|671137_671900_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.2e-21	46.1
WP_158497722.1\|672148_672871_-	hypothetical protein	NA	NA	NA	NA
WP_158497723.1\|672792_673107_-	hypothetical protein	NA	NA	NA	NA
WP_158497724.1\|673147_673315_-	hypothetical protein	NA	NA	NA	NA
WP_024078884.1\|673392_673602_-	hypothetical protein	NA	NA	NA	NA
WP_084027890.1\|673865_674120_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_024078886.1\|674475_674982_-	hypothetical protein	NA	NA	NA	NA
WP_024078887.1\|675027_675570_-	hypothetical protein	NA	NA	NA	NA
WP_024078888.1\|675808_676066_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024078889.1\|676264_676507_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_144084268.1\|676686_678174_+	hypothetical protein	NA	NA	NA	NA
WP_024078891.1\|678182_678488_-	hypothetical protein	NA	NA	NA	NA
WP_024078892.1\|678860_680114_-\|integrase	site-specific integrase	Q6EVM3	Oenoccocus_phage	3.1e-09	25.9
WP_024078893.1\|680767_681679_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	4.4e-29	32.1
WP_024078894.1\|681683_682874_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_024078895.1\|683303_683846_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_024078896.1\|683856_686796_-\|bacteriocin	NHLP bacteriocin export ABC transporter permease/ATPase subunit	W8CYL7	Bacillus_phage	1.3e-24	27.1
WP_024078897.1\|686800_689026_-\|bacteriocin	NHLP family bacteriocin export ABC transporter peptidase/permease/ATPase subunit	W8CYL7	Bacillus_phage	2.8e-29	26.0
686921:686937	attR	NA	NA	NA	NA
WP_024078898.1\|689022_690222_-\|bacteriocin	NHLP bacteriocin system secretion protein	NA	NA	NA	NA
WP_024078899.1\|690479_691097_+	hypothetical protein	NA	NA	NA	NA
WP_024078900.1\|691523_692900_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_024078901.1\|692989_693367_-	hypothetical protein	K4HZX2	Acidithiobacillus_phage	1.5e-15	40.9
WP_024078902.1\|693363_694683_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	1.3e-119	49.8
WP_041633995.1\|694679_695120_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	1.7e-23	47.4
WP_024078905.1\|695466_695742_-	hypothetical protein	NA	NA	NA	NA
WP_024078906.1\|695894_697388_+	recombinase family protein	A0A0N9RZT8	Staphylococcus_phage	2.5e-05	25.0
WP_024078907.1\|697387_698278_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_024078908.1\|698274_699177_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_024078909.1\|699381_699981_-	hypothetical protein	NA	NA	NA	NA
WP_024078910.1\|699983_700421_-	hypothetical protein	A0A2I7RXE2	Vibrio_phage	4.7e-29	46.9
WP_024078911.1\|700484_702809_-	hypothetical protein	A0A0B5A1N2	Achromobacter_phage	1.9e-121	39.0
WP_024078912.1\|702805_703201_-	C40 family peptidase	A0A0G3EYJ9	Achromobacter_phage	1.4e-24	44.0
WP_024078913.1\|703271_703796_-	DUF1833 family protein	NA	NA	NA	NA
WP_024078914.1\|703788_704136_-	hypothetical protein	NA	NA	NA	NA
WP_024078915.1\|704148_705483_-	radical SAM protein	A0A0B5A4P9	Achromobacter_phage	9.2e-68	36.7
WP_024078916.1\|705482_706274_-	hypothetical protein	NA	NA	NA	NA
WP_024078917.1\|706284_707157_-	hypothetical protein	NA	NA	NA	NA
WP_041633428.1\|707167_707647_-	hypothetical protein	B5WZT5	Pseudomonas_phage	2.0e-17	43.6
WP_024078919.1\|707671_710671_-	tape measure protein	A0A0A8WJT6	Clostridium_phage	1.1e-07	31.6
WP_024078920.1\|710674_710860_-	hypothetical protein	NA	NA	NA	NA
WP_024078921.1\|710886_711402_-	hypothetical protein	NA	NA	NA	NA
WP_024078922.1\|711404_712364_-	hypothetical protein	G8DH51	Emiliania_huxleyi_virus	5.8e-64	44.5
WP_024078923.1\|712382_712811_-	hypothetical protein	G8DH50	Emiliania_huxleyi_virus	1.3e-28	47.5
WP_024078924.1\|712861_713119_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_024078925.1\|713115_713388_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_024078926.1\|713394_714033_-	hypothetical protein	G8DH49	Emiliania_huxleyi_virus	2.7e-41	46.2
WP_024078927.1\|714029_714326_-	hypothetical protein	NA	NA	NA	NA
WP_024078928.1\|714325_715348_-\|capsid	major capsid protein	K4I3Z3	Acidithiobacillus_phage	3.5e-107	57.5
WP_024078929.1\|715361_715751_-\|head	head decoration protein	K4ICP8	Acidithiobacillus_phage	2.9e-30	59.7
WP_024078930.1\|715763_716990_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	8.7e-97	50.5
WP_024078931.1\|717065_717326_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_024078932.1\|717325_717730_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_024078933.1\|717710_719144_-\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	7.8e-198	74.3
WP_024078934.1\|719146_719359_-	hypothetical protein	NA	NA	NA	NA
WP_024078935.1\|719364_721326_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	2.0e-212	59.0
WP_024078936.1\|721291_721837_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	3.2e-35	47.8
WP_024078937.1\|721935_722292_+	hypothetical protein	K4ICP1	Acidithiobacillus_phage	1.8e-31	60.0
WP_024078939.1\|722905_723103_+	hypothetical protein	NA	NA	NA	NA
WP_024078941.1\|723337_723547_-	hypothetical protein	K4I1E3	Acidithiobacillus_phage	2.3e-13	56.5
WP_024078942.1\|723639_723804_+	hypothetical protein	NA	NA	NA	NA
WP_024078943.1\|723805_724015_+	hypothetical protein	NA	NA	NA	NA
WP_041633429.1\|724001_725270_-	site-specific DNA-methyltransferase	A0A0A8ILE7	Aurantimonas_phage	3.6e-122	52.1
WP_024078945.1\|725266_726787_-	DNA cytosine methyltransferase	Q6V7R9	Burkholderia_virus	5.5e-93	44.5
WP_158497725.1\|727495_728290_+	putative Ig domain-containing protein	NA	NA	NA	NA
WP_084027894.1\|728301_729939_+	TolC family protein	NA	NA	NA	NA
WP_158497726.1\|730392_733350_+	DUF4347 domain-containing protein	A0A1V0SEH2	Indivirus	4.5e-30	32.2
WP_144084269.1\|733443_735099_+	TolC family protein	NA	NA	NA	NA
WP_024078953.1\|735095_735812_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024078956.1\|737174_739274_+	biotin/lipoyl-binding protein	NA	NA	NA	NA
WP_024078957.1\|739289_739619_+	hypothetical protein	NA	NA	NA	NA
WP_084027896.1\|739894_740341_-	HipA domain-containing protein	NA	NA	NA	NA
WP_144084247.1\|740827_741789_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.7e-10	26.2

DBSCAN-SWA_2

906752 : 914515

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024079117.1\|906752_907463_-	transcriptional repressor LexA	A0A0N9RTK0	Paenibacillus_phage	1.3e-07	36.5
WP_024079118.1\|907577_908054_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_024079119.1\|908056_908860_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	6.0e-62	52.9
WP_024079120.1\|908861_909905_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	5.4e-63	39.4
WP_024079121.1\|909904_910495_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	8.0e-56	52.6
WP_024079122.1\|910574_911960_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.0e-10	41.4
WP_041633444.1\|912127_914515_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.5e-110	38.7

DBSCAN-SWA_3

1088631 : 1098740

uncultured_Mediterranean_phage(90.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041634096.1\|1088631_1089636_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.4e-20	36.7
WP_024079288.1\|1089632_1090316_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_024079289.1\|1090317_1091112_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.3e-36	36.4
WP_024079290.1\|1091108_1091771_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	5.1e-43	48.8
WP_024079291.1\|1091850_1092087_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.1e-06	58.1
WP_024079292.1\|1092127_1092487_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_052589088.1\|1092510_1093311_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.0e-53	48.5
WP_024079294.1\|1093336_1094599_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.3e-107	48.9
WP_024079295.1\|1094604_1095387_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.7e-40	39.8
WP_024079296.1\|1095394_1096039_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.2e-30	44.8
WP_041633458.1\|1096077_1097112_+	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	A0A2D0WXW0	Clostridium_phage	4.6e-14	37.5
WP_024079298.1\|1097344_1098199_-	ATP-binding protein	NA	NA	NA	NA
WP_024079299.1\|1098362_1098740_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.7e-14	50.0

DBSCAN-SWA_4

1500018 : 1551960

uncultured_Mediterranean_phage(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024079702.1\|1500018_1501173_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_024079703.1\|1501169_1502036_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_024079704.1\|1502032_1502233_+	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_052588889.1\|1502301_1503768_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	4.9e-22	29.1
WP_024079706.1\|1504014_1505928_-	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	3.0e-59	29.8
WP_084027972.1\|1506217_1506394_-	YdcH family protein	NA	NA	NA	NA
WP_041634194.1\|1506528_1507098_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_024079709.1\|1507257_1508352_-	ATP-dependent 6-phosphofructokinase	NA	NA	NA	NA
WP_024079710.1\|1508450_1508657_+	DUF465 domain-containing protein	NA	NA	NA	NA
WP_024079711.1\|1508694_1509873_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_024079712.1\|1509881_1510613_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_041633513.1\|1510732_1511248_+	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_041633514.1\|1511252_1512332_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_024079715.1\|1512434_1512869_+	CBS domain-containing protein	NA	NA	NA	NA
WP_024079716.1\|1512976_1513708_+	DedA family protein	NA	NA	NA	NA
WP_052588890.1\|1513708_1514524_-	murein transglycosylase	NA	NA	NA	NA
WP_024079718.1\|1515093_1515723_-	BLUF domain-containing protein	NA	NA	NA	NA
WP_144084247.1\|1515910_1516871_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.7e-10	26.2
WP_024079719.1\|1516879_1517095_-	hypothetical protein	NA	NA	NA	NA
WP_024079720.1\|1517331_1518312_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_024079721.1\|1518386_1519646_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_024079722.1\|1519721_1519955_-	acyl carrier protein	NA	NA	NA	NA
WP_024079723.1\|1520115_1520853_-	3-oxoacyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
WP_024079724.1\|1520875_1521817_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_024079725.1\|1521989_1522415_+	hypothetical protein	NA	NA	NA	NA
WP_024079726.1\|1522566_1523001_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_024079727.1\|1523000_1523273_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_024079728.1\|1523289_1524228_+	hypothetical protein	NA	NA	NA	NA
WP_024079729.1\|1524229_1524796_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_024079730.1\|1524950_1526162_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	7.1e-43	35.7
WP_024079731.1\|1526227_1527388_+	hypothetical protein	NA	NA	NA	NA
WP_024079732.1\|1527415_1528909_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.1e-84	41.1
WP_041633516.1\|1528908_1530018_+	alanine racemase	NA	NA	NA	NA
WP_024079734.1\|1530017_1530791_+	ABC transporter permease	NA	NA	NA	NA
WP_041633517.1\|1530793_1531567_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_041634199.1\|1531663_1532404_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_024079737.1\|1532406_1534314_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_024079738.1\|1534347_1535721_+	DNA repair protein RadA	NA	NA	NA	NA
WP_024079739.1\|1535743_1536427_+	CvpA family protein	NA	NA	NA	NA
WP_024079740.1\|1536447_1537908_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.0e-51	30.2
WP_024079741.1\|1537904_1538621_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_024079743.1\|1538807_1540082_+	hypothetical protein	NA	NA	NA	NA
WP_041634200.1\|1540154_1541345_+	hypothetical protein	NA	NA	NA	NA
WP_024079745.1\|1541498_1542296_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_024079746.1\|1542292_1543258_-	nucleoside-diphosphate sugar epimerase	NA	NA	NA	NA
WP_024079747.1\|1543254_1544034_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_024079748.1\|1544125_1544815_+	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	4.5e-10	32.5
WP_024079749.1\|1544946_1545363_-	hypothetical protein	NA	NA	NA	NA
WP_024079750.1\|1545551_1546139_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.5e-22	40.9
WP_024079751.1\|1546135_1547023_-	N-formylglutamate amidohydrolase	NA	NA	NA	NA
WP_024079059.1\|1547372_1548980_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-106	45.1
WP_024078582.1\|1549037_1549385_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.5e-30	55.7
WP_024079338.1\|1549381_1549747_-	IS66 family insertion sequence hypothetical protein	A0A1B0YZU7	Pseudomonas_phage	6.8e-05	50.0
WP_024079752.1\|1550229_1551960_-	sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.2e-08	24.5

DBSCAN-SWA_5

2054513 : 2066466

uncultured_Mediterranean_phage(28.57%)

integrase

attL 2053233:2053252|attR 2063339:2063358

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2053233:2053252	attL	NA	NA	NA	NA
WP_041633558.1\|2054513_2057132_+	DEAD/DEAH box helicase	A0A160DHD3	Gordonia_phage	1.2e-47	28.5
WP_024080188.1\|2057137_2057968_+	Zinc finger, SWIM-type	NA	NA	NA	NA
WP_024080189.1\|2058633_2059788_+\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	3.7e-49	34.2
WP_024080190.1\|2059926_2060178_+	helix-turn-helix domain-containing protein	A0A1B1IUF9	uncultured_Mediterranean_phage	3.1e-17	59.0
WP_041633559.1\|2060170_2061265_+	DNA cytosine methyltransferase	A0A0R6PG08	Moraxella_phage	1.6e-105	54.9
WP_084028022.1\|2061278_2061677_+	very short patch repair endonuclease	V5UTF4	Oenococcus_phage	2.0e-10	36.4
WP_084028024.1\|2061673_2063230_+	DUF4143 domain-containing protein	A0A1B1IUI1	uncultured_Mediterranean_phage	1.0e-57	36.7
WP_084028026.1\|2063553_2066466_-	EAL domain-containing protein	G3MA91	Bacillus_virus	5.0e-26	38.0
2063339:2063358	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2451163 : 2519031

Stx2-converting_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024079059.1\|2451163_2452771_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-106	45.1
WP_024080536.1\|2452987_2453953_-	protein kinase family protein	NA	NA	NA	NA
WP_024080537.1\|2453959_2454865_-	hypothetical protein	NA	NA	NA	NA
WP_024080538.1\|2454893_2455874_-	hypothetical protein	NA	NA	NA	NA
WP_041634407.1\|2457499_2458264_+	magnetochrome domain-containing protein	NA	NA	NA	NA
WP_041633585.1\|2458247_2460179_+	MFS transporter	NA	NA	NA	NA
WP_024080542.1\|2460220_2461156_+	cell division protein FtsZ	NA	NA	NA	NA
WP_144084247.1\|2461478_2462440_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.7e-10	26.2
WP_024079338.1\|2462643_2463009_+	IS66 family insertion sequence hypothetical protein	A0A1B0YZU7	Pseudomonas_phage	6.8e-05	50.0
WP_024078582.1\|2463005_2463353_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.5e-30	55.7
WP_024079059.1\|2463410_2465018_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-106	45.1
WP_041633586.1\|2466157_2466406_+	hypothetical protein	NA	NA	NA	NA
WP_024080554.1\|2470889_2471264_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_024080555.1\|2471506_2472703_-	hypothetical protein	NA	NA	NA	NA
WP_024080556.1\|2472861_2473095_+	DUF2798 domain-containing protein	NA	NA	NA	NA
WP_052588954.1\|2473261_2474224_+	cation transporter	NA	NA	NA	NA
WP_024080558.1\|2474253_2474607_+	CZB domain-containing protein	NA	NA	NA	NA
WP_024080559.1\|2474620_2474926_+	DNA-binding protein	NA	NA	NA	NA
WP_024080560.1\|2474922_2475882_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_144084247.1\|2476934_2477896_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.7e-10	26.2
WP_024080564.1\|2478164_2478389_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_041633587.1\|2478385_2478808_+	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_024080566.1\|2478829_2479006_+	hypothetical protein	NA	NA	NA	NA
WP_024080569.1\|2480746_2481361_-	hypothetical protein	NA	NA	NA	NA
WP_024080570.1\|2481363_2481993_-	ParA family protein	NA	NA	NA	NA
WP_052588956.1\|2482148_2482463_-	hypothetical protein	NA	NA	NA	NA
WP_024080575.1\|2485303_2486527_-	hypothetical protein	NA	NA	NA	NA
WP_041633589.1\|2486857_2487751_-	sphingosine kinase	NA	NA	NA	NA
WP_084028067.1\|2487792_2488287_-	magnetochrome domain-containing protein	NA	NA	NA	NA
WP_024080578.1\|2488342_2488885_-	hypothetical protein	NA	NA	NA	NA
WP_024080579.1\|2488901_2489795_-	magnetosome biogenesis CDF transporter MamB	NA	NA	NA	NA
WP_024080580.1\|2489791_2490046_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024080581.1\|2490042_2490861_-	LemA family protein	NA	NA	NA	NA
WP_041633591.1\|2490911_2491577_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_024080583.1\|2491599_2492412_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_024080584.1\|2492439_2494338_-	TSUP family transporter	NA	NA	NA	NA
WP_024080585.1\|2494378_2495692_-	ArsB/NhaD family transporter	NA	NA	NA	NA
WP_024080586.1\|2495692_2496649_-	magnetosome biogenesis CDF transporter MamM	NA	NA	NA	NA
WP_024080587.1\|2496697_2496934_-	hypothetical protein	NA	NA	NA	NA
WP_024080588.1\|2496986_2498030_-	rod shape-determining protein	NA	NA	NA	NA
WP_024080589.1\|2498073_2499474_-	hypothetical protein	NA	NA	NA	NA
WP_024080590.1\|2499489_2501808_-	magnetochrome domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	3.5e-14	30.0
WP_024080591.1\|2501807_2502017_-	hypothetical protein	NA	NA	NA	NA
WP_024080592.1\|2502054_2503350_-	MFS transporter	NA	NA	NA	NA
WP_024080593.1\|2503529_2504777_+	DUF445 domain-containing protein	NA	NA	NA	NA
WP_024080598.1\|2506463_2506913_+	hemerythrin family protein	NA	NA	NA	NA
WP_024080599.1\|2506961_2508539_+	bacteriohemerythrin	NA	NA	NA	NA
WP_158497757.1\|2508542_2508680_+	hypothetical protein	NA	NA	NA	NA
WP_169733387.1\|2509530_2509821_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_169733388.1\|2509754_2510012_+	MerR family DNA-binding protein	NA	NA	NA	NA
WP_041633593.1\|2510121_2510370_+	hypothetical protein	NA	NA	NA	NA
WP_144084247.1\|2510377_2511339_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.7e-10	26.2
WP_084028071.1\|2511439_2512300_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_024080602.1\|2512595_2512973_-	magnetosome protein MamC	NA	NA	NA	NA
WP_024080604.1\|2514067_2514403_-	hypothetical protein	NA	NA	NA	NA
WP_024080605.1\|2515327_2515807_+	hypothetical protein	NA	NA	NA	NA
WP_024080606.1\|2515822_2516146_+	hypothetical protein	NA	NA	NA	NA
WP_024080607.1\|2516321_2517365_+	hypothetical protein	NA	NA	NA	NA
WP_024080608.1\|2517368_2518718_+	hypothetical protein	NA	NA	NA	NA
WP_158497758.1\|2518830_2519031_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_7

2524460 : 2542842

Morganella_phage(40.0%)

protease,integrase,transposase

attL 2525036:2525051|attR 2548026:2548041

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024080617.1\|2524460_2525768_+\|transposase	IS701 family transposase	NA	NA	NA	NA
2525036:2525051	attL	NA	NA	NA	NA
WP_106001317.1\|2525973_2526727_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.8e-26	45.6
WP_052588958.1\|2527459_2527753_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_024080622.1\|2527992_2528883_+	hypothetical protein	NA	NA	NA	NA
WP_024080624.1\|2528923_2529694_-	hypothetical protein	NA	NA	NA	NA
WP_024080625.1\|2529747_2531007_-\|integrase	integrase family protein	NA	NA	NA	NA
WP_011899488.1\|2531496_2532696_+	hypothetical protein	NA	NA	NA	NA
WP_011899489.1\|2532806_2533097_+	thermonuclease family protein	NA	NA	NA	NA
WP_011899490.1\|2533329_2533644_+	hypothetical protein	NA	NA	NA	NA
WP_024080627.1\|2533743_2534052_+	hypothetical protein	NA	NA	NA	NA
WP_011899492.1\|2534048_2534600_+	hypothetical protein	NA	NA	NA	NA
WP_024080628.1\|2534602_2534968_+	hypothetical protein	NA	NA	NA	NA
WP_024080629.1\|2535160_2535709_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_011899495.1\|2535799_2536096_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_011899496.1\|2536092_2536503_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_024080630.1\|2536606_2536864_-	hypothetical protein	NA	NA	NA	NA
WP_011899498.1\|2536931_2538506_-	recombinase family protein	R9TP69	Rhizobium_phage	1.4e-51	30.2
WP_024080155.1\|2538820_2539291_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.9e-23	42.1
WP_011899500.1\|2539297_2540575_+	Y-family DNA polymerase	A0A1W6JNT0	Morganella_phage	2.2e-82	42.9
WP_011899501.1\|2540738_2541647_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	5.8e-29	31.8
WP_024080631.1\|2541651_2542842_+\|transposase	IS91 family transposase	NA	NA	NA	NA
2548026:2548041	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2620498 : 2658170

Acidithiobacillus_phage(35.71%)

capsid,protease,terminase,portal,tail,head,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024080688.1\|2620498_2620954_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_024080689.1\|2620935_2621427_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_024080690.1\|2621559_2622543_+	cytochrome C peroxidase (cpp-like)	NA	NA	NA	NA
WP_024080691.1\|2622539_2624750_+	PAS domain S-box protein	NA	NA	NA	NA
WP_041634455.1\|2624746_2625043_-	N(2)-fixation sustaining protein CowN	NA	NA	NA	NA
WP_041634456.1\|2625169_2625865_-	PAS domain-containing transcriptional regulator	NA	NA	NA	NA
WP_024080694.1\|2625978_2626266_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_024080695.1\|2626265_2627738_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_024080696.1\|2627737_2629189_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_144084381.1\|2629679_2630033_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_024080699.1\|2630096_2630741_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_024080700.1\|2630740_2631742_+	inorganic phosphate transporter	NA	NA	NA	NA
WP_024080701.1\|2631791_2633450_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_024080702.1\|2633819_2634437_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_024080704.1\|2634925_2635315_-	response regulator	NA	NA	NA	NA
WP_041633605.1\|2635304_2636363_-	response regulator	Q6XM27	Feldmannia_irregularis_virus	6.7e-05	27.9
WP_052588967.1\|2636355_2638500_-	response regulator	A0A1V0SGX0	Hokovirus	9.4e-30	30.3
WP_024080708.1\|2638688_2639846_+	GGDEF domain-containing protein	A0A2D0WBV8	Bordetella_phage	1.9e-08	37.9
WP_158497759.1\|2640209_2640995_+	diguanylate cyclase	G3MA91	Bacillus_virus	1.8e-26	41.2
WP_084028281.1\|2641133_2642939_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.7e-16	34.4
WP_024080711.1\|2644284_2644452_-	hypothetical protein	NA	NA	NA	NA
WP_008615258.1\|2644577_2644823_-	hypothetical protein	NA	NA	NA	NA
WP_008617245.1\|2644917_2645322_-	hypothetical protein	K4HZX2	Acidithiobacillus_phage	3.2e-16	43.3
WP_041633606.1\|2645352_2647281_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	2.9e-211	59.8
WP_024080713.1\|2647283_2647493_+	hypothetical protein	NA	NA	NA	NA
WP_024080714.1\|2647495_2648926_+\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	1.3e-189	69.8
WP_024080715.1\|2648934_2650167_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	1.4e-99	53.4
WP_024080716.1\|2650179_2650569_+\|head	head decoration protein	K4ICP8	Acidithiobacillus_phage	2.1e-28	58.1
WP_024080717.1\|2650583_2651606_+\|capsid	major capsid protein	K4I3Z3	Acidithiobacillus_phage	3.8e-106	56.9
WP_024080718.1\|2651608_2651905_+	hypothetical protein	NA	NA	NA	NA
WP_024080719.1\|2651910_2652639_-	hypothetical protein	NA	NA	NA	NA
WP_024080720.1\|2652738_2653374_+	hypothetical protein	G8DH49	Emiliania_huxleyi_virus	1.2e-36	44.0
WP_024080721.1\|2653366_2653801_+	hypothetical protein	NA	NA	NA	NA
WP_024080722.1\|2653823_2654783_+	hypothetical protein	G8DH51	Emiliania_huxleyi_virus	1.1e-57	41.3
WP_041633608.1\|2654794_2655319_+	hypothetical protein	NA	NA	NA	NA
WP_024080724.1\|2655357_2655510_+	hypothetical protein	NA	NA	NA	NA
WP_024080725.1\|2655608_2658170_+\|tail	phage tail protein	A0A2I7RV30	Vibrio_phage	1.2e-26	36.5

DBSCAN-SWA_9

2697146 : 2757022

Acidithiobacillus_phage(41.67%)

capsid,terminase,portal,head,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024080762.1\|2697146_2697551_-	hypothetical protein	Q9JML1	Wolbachia_phage	9.4e-16	41.4
WP_158497764.1\|2698770_2698944_-	hypothetical protein	NA	NA	NA	NA
WP_144084306.1\|2698978_2699287_+	hypothetical protein	NA	NA	NA	NA
WP_024080766.1\|2699319_2699601_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.0e-13	41.6
WP_024080767.1\|2699604_2699904_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	3.6e-20	50.0
WP_024080768.1\|2699960_2701265_+	AAA family ATPase	A0A0F6SJ43	Sinorhizobium_phage	4.1e-68	38.3
WP_024080769.1\|2701261_2703769_+	toprim domain-containing protein	A0A2D1GN57	Marinobacter_phage	1.1e-74	37.4
WP_024080772.1\|2704263_2704731_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	3.0e-50	64.5
WP_024080773.1\|2704727_2704919_+	hypothetical protein	NA	NA	NA	NA
WP_024080774.1\|2704911_2705400_+	hypothetical protein	NA	NA	NA	NA
WP_052588972.1\|2706565_2707837_+	site-specific DNA-methyltransferase	K4HZA5	Acidithiobacillus_phage	2.8e-146	62.2
WP_024080778.1\|2707823_2708039_-	hypothetical protein	NA	NA	NA	NA
WP_024080779.1\|2708041_2708206_-	hypothetical protein	A0A1X9I6B9	Streptococcus_phage	2.7e-06	56.5
WP_041633614.1\|2708298_2708508_+	hypothetical protein	K4I1E3	Acidithiobacillus_phage	6.3e-16	63.8
WP_024080781.1\|2708568_2708832_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_144084307.1\|2708840_2709032_+	hypothetical protein	NA	NA	NA	NA
WP_024080782.1\|2709007_2709586_-	DUF3489 domain-containing protein	K4HZZ2	Acidithiobacillus_phage	2.5e-14	38.2
WP_024080783.1\|2709680_2709860_-	hypothetical protein	NA	NA	NA	NA
WP_024080784.1\|2709902_2710268_-	hypothetical protein	K4ICP1	Acidithiobacillus_phage	8.5e-24	50.4
WP_024080785.1\|2710365_2710917_+	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	6.8e-33	46.1
WP_041633615.1\|2710897_2712865_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	6.5e-211	58.8
WP_024080787.1\|2712867_2713077_+	hypothetical protein	NA	NA	NA	NA
WP_024080788.1\|2713079_2714510_+\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	2.7e-190	70.4
WP_024080789.1\|2714518_2715751_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	2.7e-98	52.4
WP_024080790.1\|2715762_2716152_+\|head	head decoration protein	K4ICP8	Acidithiobacillus_phage	1.4e-29	58.9
WP_024080791.1\|2716166_2717189_+\|capsid	major capsid protein	K4I3Z3	Acidithiobacillus_phage	1.1e-105	56.9
WP_024080792.1\|2717191_2717488_+	hypothetical protein	NA	NA	NA	NA
WP_024080793.1\|2717484_2718117_+	hypothetical protein	G8DH49	Emiliania_huxleyi_virus	7.8e-41	46.7
WP_158497766.1\|2718335_2721152_+	EAL domain-containing protein	NA	NA	NA	NA
WP_041634478.1\|2721575_2722013_+	structural protein	A0A2I7RXE2	Vibrio_phage	1.4e-28	46.2
WP_024080798.1\|2722015_2722615_+	hypothetical protein	NA	NA	NA	NA
WP_084028088.1\|2722935_2724003_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024080800.1\|2724336_2725068_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024080801.1\|2725064_2725334_+	hypothetical protein	NA	NA	NA	NA
WP_024080803.1\|2727096_2727858_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_052588974.1\|2727880_2733502_+	DUF4347 domain-containing protein	NA	NA	NA	NA
WP_024080806.1\|2738213_2739524_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024080807.1\|2739526_2741632_+	Peptidase, M50 family protein	NA	NA	NA	NA
WP_041633618.1\|2741667_2741982_+	hypothetical protein	NA	NA	NA	NA
WP_024080809.1\|2742543_2742981_-	hemerythrin family protein	NA	NA	NA	NA
WP_024080811.1\|2743355_2744849_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.4e-17	32.8
WP_024080813.1\|2745173_2745635_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_024080815.1\|2745931_2746333_-	hypothetical protein	K4HZX2	Acidithiobacillus_phage	3.2e-16	43.3
WP_041634487.1\|2749391_2750303_+	hypothetical protein	NA	NA	NA	NA
WP_024080821.1\|2750417_2750594_+	hypothetical protein	NA	NA	NA	NA
WP_041633621.1\|2752038_2752353_-	response regulator transcription factor	NA	NA	NA	NA
WP_041633622.1\|2752503_2752743_-	hypothetical protein	NA	NA	NA	NA
WP_158497768.1\|2753188_2753329_+	hypothetical protein	NA	NA	NA	NA
WP_052588975.1\|2753458_2753797_-\|transposase	transposase	NA	NA	NA	NA
WP_024079338.1\|2754647_2755013_+	IS66 family insertion sequence hypothetical protein	A0A1B0YZU7	Pseudomonas_phage	6.8e-05	50.0
WP_024078582.1\|2755009_2755357_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.5e-30	55.7
WP_024079059.1\|2755414_2757022_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-106	45.1

DBSCAN-SWA_10

2982956 : 2993966

Prochlorococcus_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024081047.1\|2982956_2983865_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	4.7e-07	34.7
WP_024081048.1\|2983867_2984380_-	peptide deformylase	E3SLL2	Synechococcus_phage	8.8e-27	47.9
WP_024081049.1\|2984466_2986149_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_024081050.1\|2986237_2986669_-	DsrE family protein	NA	NA	NA	NA
WP_024081051.1\|2986655_2987456_-	molybdopterin-synthase adenylyltransferase MoeB	A0A291ATS8	Pandoravirus	1.8e-10	37.7
WP_024081052.1\|2987563_2988505_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.1e-80	54.5
WP_024081053.1\|2988558_2989014_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_024081054.1\|2989025_2989478_-	dUTP diphosphatase	K4JSC8	Caulobacter_phage	4.4e-30	54.4
WP_041634555.1\|2989474_2990680_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	8.7e-41	33.2
WP_024081056.1\|2990751_2992284_-	2-polyprenylphenol 6-hydroxylase	A0A2N9QVT9	Dishui_lake_phycodnavirus	2.3e-30	27.5
WP_024081057.1\|2992283_2993045_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_024081058.1\|2993129_2993966_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	3.9e-24	31.6

DBSCAN-SWA_11

3150894 : 3160806

Acidithiobacillus_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144084247.1\|3150894_3151856_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.7e-10	26.2
WP_169733391.1\|3152444_3152891_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	2.0e-11	50.0
WP_024081221.1\|3152957_3153167_-	hypothetical protein	K4I1E3	Acidithiobacillus_phage	5.0e-13	59.4
WP_024081222.1\|3153259_3153466_+	hypothetical protein	A0A1B0RXC3	Streptococcus_phage	7.6e-06	63.6
WP_041634605.1\|3153468_3153684_+	hypothetical protein	NA	NA	NA	NA
WP_024081224.1\|3153775_3154048_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_024081225.1\|3154053_3154377_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_144084317.1\|3154383_3154848_-	hypothetical protein	NA	NA	NA	NA
WP_052589001.1\|3154940_3156236_-	site-specific DNA-methyltransferase	K4HZA5	Acidithiobacillus_phage	1.0e-140	59.1
WP_041634608.1\|3156180_3157563_-	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	6.9e-151	57.3
WP_084028118.1\|3157791_3158367_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.3e-10	26.2
WP_024081231.1\|3158618_3159068_+	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	1.9e-17	39.9
WP_024081232.1\|3159064_3160408_+	recombinase family protein	K4ICM1	Acidithiobacillus_phage	8.9e-119	51.1
WP_024081233.1\|3160404_3160806_+	hypothetical protein	K4HZX2	Acidithiobacillus_phage	4.2e-16	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_023065

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection