CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP007068	Rhizobium leguminosarum bv. trifolii CB782 plasmid unnamed, complete sequence	0 crisprs	csa3	0	0
NZ_CP007070	Rhizobium leguminosarum bv. trifolii CB782 plasmid unnamed, complete sequence	0 crisprs	NA	0	1
NZ_CP007067	Rhizobium leguminosarum bv. trifolii CB782 chromosome, complete genome	3 crisprs	csa3,WYL,cas3,DEDDh	1	5
NZ_CP007069	Rhizobium leguminosarum bv. trifolii CB782 plasmid unnamed, complete sequence	0 crisprs	DEDDh,csa3,WYL	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

76427 : 143282

Acinetobacter_phage(18.18%)

integrase,transposase

attL 64943:64957|attR 110365:110379

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
64943:64957	attL	NA	NA	NA	NA
WP_080687673.1\|76427_76649_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0P0I4A4	Acinetobacter_phage	2.2e-06	43.5
WP_080687674.1\|76588_77125_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-11	31.6
WP_025419103.1\|78237_78960_+	type IV secretion system lytic transglycosylase VirB1	NA	NA	NA	NA
WP_025419104.1\|78959_79319_+	pilin major subunit VirB2	NA	NA	NA	NA
WP_025419105.1\|79318_79645_+	type IV secretion system protein VirB3	NA	NA	NA	NA
WP_025419106.1\|79644_82014_+	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_025419107.1\|82027_82696_+	type IV secretion system protein VirB5	NA	NA	NA	NA
WP_025419108.1\|82761_83649_+	type IV secretion system protein	NA	NA	NA	NA
WP_080687676.1\|83678_83837_+	type IV secretion system lipoprotein VirB7	NA	NA	NA	NA
WP_025419109.1\|83833_84547_+	type IV secretion system protein VirB8	NA	NA	NA	NA
WP_025419110.1\|84543_85425_+	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_041686884.1\|85421_86516_+	type IV secretion system protein VirB10	NA	NA	NA	NA
WP_155256699.1\|86849_87149_+\|transposase	transposase	NA	NA	NA	NA
WP_025419113.1\|87261_88302_+	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_025419114.1\|88860_89637_+	winged helix-turn-helix domain-containing protein	W8CYM9	Bacillus_phage	3.1e-15	29.1
WP_025419115.1\|89652_91347_-	type IV secretion system ATPase VirD4	NA	NA	NA	NA
WP_025419116.1\|92487_93591_+	acyltransferase	A9YX16	Burkholderia_phage	9.8e-15	29.8
WP_025419117.1\|94307_94796_-	MaoC family dehydratase	NA	NA	NA	NA
WP_025419118.1\|94872_96699_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HHR4	Paramecium_bursaria_Chlorella_virus	1.3e-104	39.8
WP_025419119.1\|96944_97496_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_025419120.1\|97852_99061_-	beta-ketoacyl-[acyl-carrier-protein] synthase family protein	NA	NA	NA	NA
WP_025419121.1\|99060_99339_-	nodulation protein NodF	NA	NA	NA	NA
WP_025419122.1\|99853_100801_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025419123.1\|101021_101612_+	NodA family N-acyltransferase	NA	NA	NA	NA
WP_025419124.1\|101608_102259_+	chitooligosaccharide deacetylase NodB	NA	NA	NA	NA
WP_025419125.1\|102279_103560_+	chitooligosaccharide synthase NodC	NA	NA	NA	NA
WP_025419126.1\|103597_104626_+	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	9.7e-25	36.8
WP_025419127.1\|104622_105411_+	ABC transporter permease	NA	NA	NA	NA
WP_172644342.1\|105748_106183_+	hypothetical protein	NA	NA	NA	NA
WP_025419129.1\|106708_107374_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_025419130.1\|107402_107561_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_025419131.1\|107557_109846_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.0e-78	29.9
WP_025419132.1\|109842_110328_-	FixH family protein	NA	NA	NA	NA
WP_025419133.1\|110324_111893_-	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
110365:110379	attR	NA	NA	NA	NA
WP_003568506.1\|112082_112268_-	hypothetical protein	NA	NA	NA	NA
WP_025419134.1\|112278_113142_-	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_025419135.1\|113143_113296_-	CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone	NA	NA	NA	NA
WP_025419136.1\|113304_114039_-	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_025419137.1\|114047_115670_-	cytochrome-c oxidase, cbb3-type subunit I	NA	NA	NA	NA
WP_025419139.1\|116618_118415_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-33	27.3
WP_080687677.1\|118575_118926_-	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_025419140.1\|119164_119518_-	hypothetical protein	NA	NA	NA	NA
WP_025419141.1\|119696_120944_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_025419142.1\|122023_124645_+	ornithine decarboxylase	NA	NA	NA	NA
WP_025419143.1\|124706_126149_+	biotin carboxylase	NA	NA	NA	NA
WP_025419144.1\|126210_127359_+	hypothetical protein	NA	NA	NA	NA
WP_025419145.1\|127355_128387_+	hypothetical protein	NA	NA	NA	NA
WP_080687679.1\|128503_128815_+\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	4.2e-16	40.6
WP_025419146.1\|129228_129525_-	hypothetical protein	NA	NA	NA	NA
WP_080687680.1\|130600_130828_-\|transposase	transposase	NA	NA	NA	NA
WP_025419148.1\|131291_132839_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025419149.1\|132877_133816_+	ABC transporter permease	NA	NA	NA	NA
WP_025419150.1\|133827_134679_+	ABC transporter permease	NA	NA	NA	NA
WP_025419151.1\|134675_136340_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-12	25.8
WP_025419152.1\|136733_137663_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_025419153.1\|137692_138883_+	serine hydrolase	NA	NA	NA	NA
WP_155256711.1\|140251_140896_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025419155.1\|141012_141756_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_080687681.1\|142970_143282_+\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-18	42.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP007067

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007067_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007067_1

781902-782001

Orphan

Consensus_repeat	Method
TCTCCCCGCCTGCGGGGAGAAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007067_1

>merge|NZ_CP007067|1|781902-782001|CRISPRCasFinder
TCTCCCCGCCTGCGGGGAGAAGGGGATATGCCGCACCGGCTTCGTCAATCCTCGACGTTGCGTTTGGCACGTCCCCTCTCCCCGCCTGCGGGGAGAGGGT

>NZ_CP007067|1|1|781902-782001|CRISPRCasFinder
TCTCCCCGCCTGCGGGGAGAAGGG	GATATGCCGCACCGGCTTCGTCAATCCTCGACGTTGCGTTTGGCACGTCCCC
TCTCCCCGCCTGCGGGGAGAGGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007067.1\|WP_025415624.1\|791384_792392_+\|asparaginase	unknown	unknown	gnl\|CDD\|226856
NZ_CP007067.1\|WP_025415609.1\|773534_775031_-\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|235349
NZ_CP007067.1\|WP_025415619.1\|784944_785187_+\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	unknown	unknown	gnl\|CDD\|226136
NZ_CP007067.1\|WP_025415608.1\|772091_773045_-\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NZ_CP007067.1\|WP_003569590.1\|777278_777725_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_CP007067.1\|WP_037092283.1\|783500_784082_-\|transcriptional-regulator-BetI	unknown	unknown	gnl\|CDD\|179115
NZ_CP007067.1\|WP_025415616.1\|782035_783499_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|183918
NZ_CP007067.1\|WP_025415607.1\|771114_772035_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP007067.1\|WP_025415622.1\|789093_789717_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
NZ_CP007067.1\|WP_025415612.1\|777725_779069_-\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238506
NZ_CP007067.1\|WP_025415621.1\|787562_788990_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP007067.1\|WP_025415610.1\|775032_775986_-\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP007067.1\|WP_025415625.1\|792466_793222_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP007067.1\|WP_025415623.1\|789741_790953_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341024
NZ_CP007067.1\|WP_025415618.1\|784238_784838_+\|HdeD-family-acid-resistance-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP007067.1\|WP_025415620.1\|786583_787582_+\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP007067.1\|WP_025415613.1\|779205_779592_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_025415615.1\|780167_781820_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|235000
NZ_CP007067.1\|WP_025415611.1\|776100_776859_-\|phosphoadenylyl-sulfate-reductase	unknown	unknown	gnl\|CDD\|273945
NZ_CP007067.1\|WP_025415614.1\|779609_780083_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP007067.1\|WP_025415624.1\|791384_792392_+\|asparaginase	gnl\|CDD\|226856	COG4448, AnsA, L-asparaginase II [Amino acid transport and metabolism].	0
NZ_CP007067.1\|WP_025415609.1\|773534_775031_-\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
NZ_CP007067.1\|WP_025415619.1\|784944_785187_+\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	gnl\|CDD\|226136	COG3609, COG3609, Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain [Transcription].	2.87294e-09
NZ_CP007067.1\|WP_025415608.1\|772091_773045_-\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.71021e-69
NZ_CP007067.1\|WP_003569590.1\|777278_777725_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	3.52115e-44
NZ_CP007067.1\|WP_037092283.1\|783500_784082_-\|transcriptional-regulator-BetI	gnl\|CDD\|179115	PRK00767, PRK00767, transcriptional regulator BetI; Validated.	2.40111e-96
NZ_CP007067.1\|WP_025415616.1\|782035_783499_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|183918	PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional.	0
NZ_CP007067.1\|WP_025415607.1\|771114_772035_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.3418e-60
NZ_CP007067.1\|WP_025415622.1\|789093_789717_+\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	4.33905e-53
NZ_CP007067.1\|WP_025415612.1\|777725_779069_-\|chloride-channel-protein	gnl\|CDD\|238506	cd01034, EriC_like, ClC chloride channel family. These protein sequences, closely related to the ClC Eric family, are putative halogen ion (Cl-, Br- and I-) transport proteins found in eubacteria. They belong to the ClC superfamily of chloride ion channels, which share a unique double-barreled architecture and voltage-dependent gating mechanism. This superfamily lacks any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. The voltage-dependent gating is conferred by the permeating anion itself, acting as the gating charge.	4.05102e-139
NZ_CP007067.1\|WP_025415621.1\|787562_788990_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.57771e-26
NZ_CP007067.1\|WP_025415610.1\|775032_775986_-\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP007067.1\|WP_025415625.1\|792466_793222_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	3.26776e-71
NZ_CP007067.1\|WP_025415623.1\|789741_790953_-\|MFS-transporter	gnl\|CDD\|341024	cd17471, MFS_Set, Sugar efflux transporter (Set) family of the Major Facilitator Superfamily of transporters. This family is composed of sugar transporters such as Escherichia coli Sugar efflux transporter SetA, SetB, SetC and other sugar transporters. SetA, SetB, and SetC are involved in the efflux of sugars such as lactose, glucose, IPTG, and substituted glucosides or galactosides. They may be involved in the detoxification of non-metabolizable sugar analogs. The Set family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.60427e-52
NZ_CP007067.1\|WP_025415618.1\|784238_784838_+\|HdeD-family-acid-resistance-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	3.0364e-33
NZ_CP007067.1\|WP_025415620.1\|786583_787582_+\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP007067.1\|WP_025415615.1\|780167_781820_-\|choline-dehydrogenase	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_CP007067.1\|WP_025415611.1\|776100_776859_-\|phosphoadenylyl-sulfate-reductase	gnl\|CDD\|273945	TIGR02055, Phosphoadenosine_phosphosulfate_reductase, thioredoxin-dependent adenylylsulfate APS reductase. This model describes recently identified adenosine 5'-phosphosulfate (APS) reductase activity found in sulfate-assimilatory prokaryotes, thus separating it from the traditionally described phosphoadenosine 5'-phosphosulfate (PAPS) reductases found in bacteria and fungi. Homologous to PAPS reductase in enterobacteria, cyanobacteria, and yeast, APS reductase here clusters with, and demonstrates greater homology to plant APS reductase. Additionally, the presence of two conserved C-terminal motifs (CCXXRKXXPL & SXGCXXCT) distinguishes APS substrate specificity and serves as a FeS cluster. [Central intermediary metabolism, Sulfur metabolism].	1.85963e-99

>NZ_CP007067.1|WP_025415615.1|780167_781820_-|choline-dehydrogenase
MQQADFVIIGSGSAGSALAYRLSEGGQNSVLVIEAGGSDFGPFIQMPAALAWPMSMKRYNWGYLSEPEPNLNNRRITAPRGKVIGGSSSINGMVYVRGHAEDFNRWEELGASGWAYADVLPYFKRMEHSHGGEDGWRGTDGPLHVQRGGFTNPLFRAFIEAGKQAGFETTEDYNGSKQEGFGLMEQTIFAGRRWSTANAYLKPALKRKNVGIVYAFARKIVIEDGRATGVEIERNGKVEVVRANREVIVSASSFNSPKLLMLSGIGPGEHLKEMGIEVKADRPGVGANLQDHMEFYFQQVSTKPVSLYSWLPWFWQGVAGAQWLLSKGGLGASNQFEACAFLRSAPGLKQPDIQYHFLPVAISYDGKAAAKSHGFQVHVGYNLSKSRGSVTLRSSDPKADPVLRFNYMSHAEDWEKFRHCVRLTRELFGQSAFDDYRGAEIQPGEGVQSDDEIDAFLREHLESAYHPCGTCKMGAKDDPMAVVDPQTRVIGVDGLRVADSSIFPHVTYGNLNGPSIMTGEKAADHILGKQPLARSNQEPWVNPRAAVSDR
>NZ_CP007067.1|WP_025415614.1|779609_780083_+|hypothetical-protein
MIDILEWLSATTPAVALRRSGTLYMFVNAAHILAIGLLVGAILPLDLRLAGFFRKVPVDIVAPFLSRSAGVGLVLAIATGFCLFSVRAVEYAENPAFLAKLGLIAFGLLNLLTVHVGGGWKTLIATGLIQPSLRFSAASSVAIWIGAVLAGRWIGFL
>NZ_CP007067.1|WP_025415613.1|779205_779592_+|hypothetical-protein
MLPISIQRVVAAAMLSMSFATGAIAHHGWSWAEADQIELRGTIEKISMGGPHPTLDVATADDGLWRVELGNPRQTERSGFVEGVAKPGDQVVALGNRSQDPKEKRMKAVRITIGEKRYDIYPDRIRTN
>NZ_CP007067.1|WP_025415612.1|777725_779069_-|chloride-channel-protein
MPVLYRKSRLLRRSRVLWGSFSVWRPRLIFWFGALAIGVISVGFARLADLAQHAFAGVTASGQWSFLLPLIITPLGFMLSAYLAATFFPNAQGSGIPQAIAARHLRDPDDRARLLSLRLVVGKIVLTVLGLASGASIGREGPTVQVGASIMLAVARFGGMAQARGLILAGSAAGIAAAFNTPLAGVVFAIEEMSRTYESRANGLVLTAVILSGLAALGLAGSYSYFGSAAVAPASVRDWELVLVCGIGGGALGAAFSGLALHLGQHVRRWAHPQPLRRMVMLATVCGLAVAVIGILSDGTTFGTGYDQAKAAVEGNPLPLLFFLEKLLAGFLSMISGIPGGIFAPSLAVGAGFGSTVGSLLGSSIALAAILGMAGYFSGVVQAPMTAFVIILEMTGDHQAVIPIMAVSMIGYITSRILSREPLYHGLSRVFIAAAIRARRARETVEN
>NZ_CP007067.1|WP_003569590.1|777278_777725_+|Rrf2-family-transcriptional-regulator
MITQKAKYALRALTVLADADADEPVMISDIAAQQKIPKKFLEQILLDLKHHGIVVSRRGKQGGYLLLKPAHTITFGEILRIIDGPIAPLPCLSITAYRRCDDCDGEQNCQIRHVFAKVADATRKVLFSTTIADAVGPRHGAEVTRLLA
>NZ_CP007067.1|WP_025415611.1|776100_776859_-|phosphoadenylyl-sulfate-reductase
MTVIKSIAEKGPIAEAEALNARLAGLDLAGRLSLVAGLGGRVVFTTSLGIEDQVITAEIGTHRLPIDVATLQTGRLFAETLALIEETESQYDLKIQRYEPEKADIDAYAAQYGLNGFYESVEARHACCGVRKLKPLARALEGATIWITGLRRGQSANRAETPFAEYDAERHLLKVNPLADWDLEAIKAFVSANGVPVNPLHTRGYPSIGCEPCTRAIKPGEPERAGRWWWEQDETRECGLHVAEEAAAVAAV
>NZ_CP007067.1|WP_025415610.1|775032_775986_-|sulfate-adenylyltransferase-subunit-CysD
MPDSRPDTELSNPQSAKAPLDPHLKALENESIHIFREVAAEFERPVMLYSIGKDSSVLLHLARKAFYPGRVPFPLLHVNTGWKFREMIAFRDATAKTYDLDLIEHINPRGAAENITPFTHGSAAFTDIMKTEGLRQALDAGQFDAAFGGARRDEEASRAKERIYSFRTPDHRWDPRNQRPELWNVYNGMIRKGESVRAFPLSNWTEVDIWRYIQAEDIPLVPLYYAKKRPFVERDGMMILAEDPRLELLPGEVRQEGMIRFRTLGDFPLTGAIRSEATTLEEVIAELEIATVSERQGRAIDRDQSGSMEKKKREGYF
>NZ_CP007067.1|WP_025415609.1|773534_775031_-|sulfate-adenylyltransferase-subunit-CysN
MTVVQTAVSAATAVSLPAAEPQKAQRDTRPLRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAATLQRDSTGKQNDLGLPDFALLLDGLQAEREQGITIDVAYRYFSTDKRSFIVADTPGHEQYTRNMATGASTADLAILLVDARFGILEQTRRHATIASLLGIKQFVLAVNKIDLTGYDRAGFDKISHEFREFALSLGVKQITAIPMSALKGENVVYSGQAAMPWYAGPTLVETLELATVRSSQTVGFRLSVQRVSRPGESFRGYQGTVAGGSVKPGDSVMILPSGMVANVSKIVTFDLVRNAAVAGDAITLVLDRQVDVARGDMIVSIDAQPQVGLAFDAQIVALQPEGIEPGKRYWLKSGSRRQRVQVQPLSQLELKTGTWNAAQRLYMNAIGKVRLVFDEAAIFDPYEQNRQSGSFILIDPETNNTVAGGMVTGKRTELGGLHNGEGRVILSLPADLAEQIMASELFASRSHEAEVRRMTAAEAADLWSSAASDI
>NZ_CP007067.1|WP_025415608.1|772091_773045_-|NmrA/HSCARG-family-protein
MSTDSKPLIAVMGATSKQGRSVVATLLESQRFRVRAFTRRKDSPEALRLEQLGAEIATVPLELGLQKELVAAFKGADSAFLMTPPIAPPETSEAPLGRQLADAAVEAGIGHIVFSTLENVDKIAGGTKYAPHFTDKARVADYIRGLPISHSFIMLAFFYTNLLEYYAPRMEGDTLLLPIYLPEDFAAPFVDPLTATGPVVLEIFSNPERYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLHYFPEFAANEFLVREILGMVEYAVEYGYFGKEHDLEWSRRLNPETHDWEQFLRTTGWRGDKRSFGG
>NZ_CP007067.1|WP_025415607.1|771114_772035_+|LysR-family-transcriptional-regulator
MDKAGLSFDRMRTFVRVAERGNLSMVARELGVGQSTVTRHLNELEEAVGVPLLSRTTRRVTLTDEGSRYYTNCLQILRLVEQAAEEARDARQAPAGAVRLSCTAALGVMHVTRMIFDFQDRHPDIRVDLNLTDERIDLVREGVDVALRLGPLADSAMKLHALGESQRLLVGAPAYLSVRGRPQRPADLSRYETVVMSNVAGSNQLLLSSPDGTSLVVPVSGRLRVDHGLAAREALAAGRGIGPTHLWLIHDLLDDGRLEVVLGDYRPSPVPVSLLIVPERAAIARVRLLVDFLAAEISKLPGIRQS
>NZ_CP007067.1|WP_025415616.1|782035_783499_-|betaine-aldehyde-dehydrogenase
MKAQPKASHFIDGEYVEDTDGTVIESLYPATGEVIARLHAATPAIIEKAIAAAKRAQPEWAAMSPMVRGRILKRAAEIMRERNRSLSELETLDTGKPIQETIVADPTSGADAFEFFGGVAPAGLNGAHIPLGQDFAYTKRVPLGVCVGIGAWNYPQQIACWKAAPALVCGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQGDRDTGPLLVNHANVAKVSLTGSVPTGRRVAAAAAGNLKHVTMELGGKSPLIVFDDADLDSAVGGAMLGNFYSTGQVCSNGTRVFVQKGIKTEFLKRLKARTEAMLIGDPMDEATQIGPMVSWAQREKVIAYIEKGKSEGATLVAGGGIPNNVAGEGYYVQPTVFADVTDEMTIAREEIFGPVMSVLDFDDEDEVIARANASEFGLSGGVFTADLTRAHRVVDRLEAGTLWINTYNLCPVEIPFGGSKQSGFGRENSLAALEHYSELKTVYVGMGPVAAPY
>NZ_CP007067.1|WP_037092283.1|783500_784082_-|transcriptional-regulator-BetI
MEPVRRKALVDAALRVIGDHGSLAVTMSDIARQAGVSPALAHHYFGSKEQLLIETIRSLLRQLRHDTVAALAVARTPRERLSAIIRVNFHADQFAPETIAAWLAFYAEAQRSEETRRFLVIYASRLRSNLLADLKALLPAEAAERIAEGAAAMIDGLYIRQSLKSAPIGIEASIALTEDYLNALLSTTSPKDK
>NZ_CP007067.1|WP_025415618.1|784238_784838_+|HdeD-family-acid-resistance-protein
MADVFNAEPTTSSLQSKWIWFVGLGVLLLVCGLIALGNLMLATVVSVYYVGMLMLFGGVVYLVHAFQVRGWDHVLFWALSGLLYVLAGICAFVNPILTSAALTLFLSLALVIAGVFRTWVGVRMKPTKGWRWVVASGVITALAGFVIALGWPVNSLWILGLFLAADLIIQGWTMIAFGLGIRSGPAKSDTPAPLSDRSF
>NZ_CP007067.1|WP_025415619.1|784944_785187_+|type-II-toxin-antitoxin-system-ParD-family-antitoxin
MPMVTVSISPQQAAGIRAAVDNGGYASSSEVVREALRLWDTARKLNEFRDDVLDDEGAPSGGRCVADMFADHEAERRRTA
>NZ_CP007067.1|WP_025415620.1|786583_787582_+|NAD(P)H-quinone-oxidoreductase
MPLPQEMRFVDLPSFGGPEVMTIGRGPLPEPGEGQVLVRAEAVGVNRPDVAQREGSYPAPKDASPILGLELAGEIVAIGPGVSGYSPGDKVCGLANGGAYAEYCLLPAGQILPVPKGYDAVKAAALPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGAEVYATAGSAQKCEACERLGAKRAINYRSEDFAAVIKAETGQGVDIILDMIGASYFERNLASLAKDGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVVEAHRLMEDGSHVGKIMLRVD
>NZ_CP007067.1|WP_025415621.1|787562_788990_-|MFS-transporter
MSDIDQTATIANASSLLRLFLPEHLPATLILAGGVTLYAVETYIMATIAPSIVRDIGGLALFSWVTSLFVAAAVLGSIFVAMRPRGIGLRAVYVIAALVFGVGSLIAATAPSMPVVLIGRAVQGLGTGALAALGYAFIRFVYPEPLWTKASTLYAAIWGVATVIGPTLGGFFSGGSNWRYAFVALVPLGLAMAVLAPRLLPEVADDRDHAKTPLAQIGLLLGAVLMVSTAGTIETMAAKIALIAASVVAVAGMLFIEGRSPNRLLPSGAVSFSRPIARVYLTMLAMAIVLVSDVFIPYFLQVLHGVTPLVSGYLVALVALGWTFAAFLSGSLTGRQAYFAIIAGALIEAAATASLAAFLANDNPHAQMLFIVPAAIGMFMMGFGVGLGWAHLVAMVLTLVADSEQDKASAAIPTMSSLGGAFGAAFAGLIANGAGLVDPGGIAGALSAAYWLYLLTALPGVLAVGVSLTLNRRAA
>NZ_CP007067.1|WP_025415622.1|789093_789717_+|transcriptional-regulator
MRQSPANRILILIKTDGPQLGGAIGDALGISAEAARQQLAKLAEQGLVEPVTIGATGRGRPRQLWHLTAAGNRQFPDGHAELTANLLVTLVEQLGPAALDTVISAREADTLQRYRLELENAGDLAARVEVLAAIRTREGYMADHWQEADGSFTLVENHCPICAAATACAGFCRSELETFRTALGADVERREHILAGARRCAYRITPR
>NZ_CP007067.1|WP_025415623.1|789741_790953_-|MFS-transporter
MPSTFSLILGDNRIRIPTVTLIALAFTYASTAPYQSIIGINELGLSNGTYSALIFFSAIVNVTTSLTLGIWSDRLKERRPLVLGLSVAGMLGFGSIAIFHNPAVFIVSTLLLVPMSNSTYSLLFASLRARTNQMDRGQGAAVTATVRALFSGSWALAPGLIGLYLVNSPSMTPAYGIAAFASLTCFCLYFFFAPGNGTAGRAPDPVGFLASLKRIFMPYVLVRVIVMALLFGLQRLNSMLLPLIITHAAGGTVVDVGFIAGLTALLEMPFMMMWGMAQRRFRTVHVLAFGALIYCAYLLLLGFASAPLHIYALLLLNAGGAAAILSVPITYLQDLIADRPGLGTSLISLNTFIGTGIAAGLFAFGTSVSDYSGTAFVGAAAGLASVGVLLYLESSRRQARQPA
>NZ_CP007067.1|WP_025415624.1|791384_792392_+|asparaginase
MTNPVTVEVTRGLLVESRHRGAVAVVDGDGKLVFSLGDIEAAVFPRSACKAMQALPLIESGAADAYGFGDKELALACASHNGEDEHVALAASMLSRAGRNAEALECGAHWSMSQKVLIHQVRTLDVPTALHNNCSGKHAGFICACCHRDIDPKGYVGYQHPLQVEIRAVMESLTGAVLGAESCGTDGCSIPTYAVPLKSLAHGFAKMATGVGLEPLRAKASRRLIEACMAEPFYVAGTGRACTELMQIAPGRIFVKTGAEGVFCAAIPEKGIAIALKCEDGTTRAAEAMVAATLARFFETESEVHAALMGFAATSMRNWNGIHVGDIRATSALTA
>NZ_CP007067.1|WP_025415625.1|792466_793222_-|DeoR/GlpR-transcriptional-regulator
MLTTQRKALILDILRRDGQVIAKRVAEDFSLSEDTIRRDLREMAAEGLLKRVHGGAMPLSPDLPDFTARRSVSSEIKARLGAAAAAMVRPGQMIFLDGGTTTAEIARHLSRDMPLTVATHSPTIAAELEHHPTAEVILTGGRLYKHSMVATGAAAVAAISQLRPDLFFLGVTAAHPVHGLSTGDFEEAAIKRHIAGCSAETHVLLTEEKFDLVSPCPVLGISEVAGLIVPAEMPAERLKPYRDLNGTIAVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007067_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007067_2

1509443-1509528

Orphan

Consensus_repeat	Method
GCCGCCCCGAAGAAGAAGGCTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007067_2

>merge|NZ_CP007067|2|1509443-1509528|CRISPRCasFinder
GCCGCCCCGAAGAAGAAGGCTGCCGCCAAGGCCGAAGCTGCCGACGCCGGCGAAGGCGAAGAAGCCGCTCCGAAGAAGAAGGCTGC

>NZ_CP007067|2|2|1509443-1509528|CRISPRCasFinder
GCCGCCCCGAAGAAGAAGGCTGC	CGCCAAGGCCGAAGCTGCCGACGCCGGCGAAGGCGAAGAA
GCCGCTCCGAAGAAGAAGGCTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007067.1\|WP_003573526.1\|1503003_1504437_-\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	unknown	unknown	gnl\|CDD\|235416
NZ_CP007067.1\|WP_025416072.1\|1512228_1513032_-\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|197317
NZ_CP007067.1\|WP_003573508.1\|1513096_1514503_-\|Si-specific-NAD(P)(+)-transhydrogenase	unknown	unknown	gnl\|CDD\|235373
NZ_CP007067.1\|WP_003573498.1\|1517506_1517839_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573528.1\|1502527_1502995_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573500.1\|1517336_1517510_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573534.1\|1498269_1498617_+\|preprotein-translocase-subunit-YajC	unknown	unknown	gnl\|CDD\|224775
NZ_CP007067.1\|WP_025416068.1\|1505975_1507079_+\|DUF2157-domain-containing-protein	unknown	unknown	gnl\|CDD\|227209
NZ_CP007067.1\|WP_038574203.1\|1517775_1518270_-\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|234639
NZ_CP007067.1\|WP_025416066.1\|1498662_1501203_+\|protein-translocase-subunit-SecDF	unknown	unknown	gnl\|CDD\|237805
NZ_CP007067.1\|WP_003573515.1\|1509795_1510218_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226158
NZ_CP007067.1\|WP_025416073.1\|1514622_1515450_-\|DNA-repair-protein-RadC	unknown	unknown	gnl\|CDD\|178801
NZ_CP007067.1\|WP_025416074.1\|1516544_1517204_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007067.1\|WP_025416069.1\|1507075_1507666_+\|GDYXXLXY-domain-containing-protein	unknown	unknown	gnl\|CDD\|379571
NZ_CP007067.1\|WP_003573522.1\|1504982_1505129_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP007067.1\|WP_003573524.1\|1504537_1504681_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP007067.1\|WP_025416067.1\|1501597_1502455_+\|phytoene/squalene-synthase-family-protein	unknown	unknown	gnl\|CDD\|224478
NZ_CP007067.1\|WP_025416071.1\|1510297_1512067_-\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|214792
NZ_CP007067.1\|WP_003573530.1\|1501207_1501594_+\|membrane-protein	unknown	unknown	gnl\|CDD\|226260
NZ_CP007067.1\|WP_003573504.1\|1515457_1516294_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576

Protein	Function_ID	Function_description	E-value
NZ_CP007067.1\|WP_003573526.1\|1503003_1504437_-\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	gnl\|CDD\|235416	PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed.	0
NZ_CP007067.1\|WP_025416072.1\|1512228_1513032_-\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|197317	cd09083, EEP-1, Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1. This family of uncharacterized proteins belongs to a superfamily that includes the catalytic domain (exonuclease/endonuclease/phosphatase, EEP, domain) of a diverse set of proteins including the ExoIII family of apurinic/apyrimidinic (AP) endonucleases, inositol polyphosphate 5-phosphatases (INPP5), neutral sphingomyelinases (nSMases), deadenylases (such as the vertebrate circadian-clock regulated nocturnin), bacterial cytolethal distending toxin B (CdtB), deoxyribonuclease 1 (DNase1), the endonuclease domain of the non-LTR retrotransposon LINE-1, and related domains. These diverse enzymes share a common catalytic mechanism of cleaving phosphodiester bonds. Their substrates range from nucleic acids to phospholipids and perhaps, proteins.	4.8023e-14
NZ_CP007067.1\|WP_003573508.1\|1513096_1514503_-\|Si-specific-NAD(P)(+)-transhydrogenase	gnl\|CDD\|235373	PRK05249, PRK05249, Si-specific NAD(P)(+) transhydrogenase.	0
NZ_CP007067.1\|WP_003573534.1\|1498269_1498617_+\|preprotein-translocase-subunit-YajC	gnl\|CDD\|224775	COG1862, YajC, Preprotein translocase subunit YajC [Intracellular trafficking and secretion].	2.17356e-32
NZ_CP007067.1\|WP_025416068.1\|1505975_1507079_+\|DUF2157-domain-containing-protein	gnl\|CDD\|227209	COG4872, COG4872, Predicted membrane protein [Function unknown].	1.13877e-41
NZ_CP007067.1\|WP_038574203.1\|1517775_1518270_-\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|234639	PRK00109, PRK00109, Holliday junction resolvase RuvX.	2.98598e-53
NZ_CP007067.1\|WP_025416066.1\|1498662_1501203_+\|protein-translocase-subunit-SecDF	gnl\|CDD\|237805	PRK14726, PRK14726, protein translocase subunit SecDF.	0
NZ_CP007067.1\|WP_003573515.1\|1509795_1510218_+\|hypothetical-protein	gnl\|CDD\|226158	COG3631, COG3631, Ketosteroid isomerase-related protein [General function prediction only].	4.148e-06
NZ_CP007067.1\|WP_025416073.1\|1514622_1515450_-\|DNA-repair-protein-RadC	gnl\|CDD\|178801	PRK00024, PRK00024, DNA repair protein RadC.	1.61149e-107
NZ_CP007067.1\|WP_025416074.1\|1516544_1517204_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	6.23667e-08
NZ_CP007067.1\|WP_025416069.1\|1507075_1507666_+\|GDYXXLXY-domain-containing-protein	gnl\|CDD\|379571	pfam14345, GDYXXLXY, GDYXXLXY protein. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 171 and 199 amino acids in length. It contains a conserved GDYXXLXY motif.	1.63627e-41
NZ_CP007067.1\|WP_003573522.1\|1504982_1505129_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	3.87456e-08
NZ_CP007067.1\|WP_003573524.1\|1504537_1504681_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	1.44994e-11
NZ_CP007067.1\|WP_025416067.1\|1501597_1502455_+\|phytoene/squalene-synthase-family-protein	gnl\|CDD\|224478	COG1562, ERG9, Phytoene/squalene synthetase [Lipid metabolism].	3.67274e-61
NZ_CP007067.1\|WP_025416071.1\|1510297_1512067_-\|radical-SAM-protein	gnl\|CDD\|214792	smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.	2.17001e-20
NZ_CP007067.1\|WP_003573530.1\|1501207_1501594_+\|membrane-protein	gnl\|CDD\|226260	COG3737, COG3737, Uncharacterized conserved protein [Function unknown].	2.09801e-60
NZ_CP007067.1\|WP_003573504.1\|1515457_1516294_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	7.64205e-161

>NZ_CP007067.1|WP_025416069.1|1507075_1507666_+|GDYXXLXY-domain-containing-protein
MNSLLARLQSGRGYVLSAIIVAGLQTVILGTIIQSRASILNSGAEVLLKTAPVDPRDFLRGDYVVLNYDISSVPVQTVSGGIPAEPGERTLWVRLKKQEDGFWTVIESSFHGLPPLPETVILRSQPFYSGGLAAGDSIRVEYGIERYYVPEGEGKPIEEARNGGNVAISVRVSPDGSAQVRGLLVDNKPVYDEPLY
>NZ_CP007067.1|WP_025416068.1|1505975_1507079_+|DUF2157-domain-containing-protein
MYRGRLERDLSLWVGKGLLGQETATTLLAEYDGRPASFSLGRVLMALAAVLLASAILLVVASNWEAIPRLVRVGVILALIWVVHIAAARMLARGATAAAGGLLVIGAMSFGGAISLVGQMYHLSGDEQTVMYLWFAIATISAILFRSGAVTVVAGFLSWASFAVYLQNYDTHWVGLDPWMAPVMAAITIALVRYTDAERARHLAYLLLIGWLAWLYTLYEEIAVALAFAVGGMAAVVLAALPLPRIASLVRTAGAAPAFYSFLVAAIGFLLLHIEIEDGWRLVVLGVATLAASVLAIALHGRDNGAVRYLAYMSFAAEMLYLASVTVGSILGTSSLFLFSGLVVALVAWLVIRLERRFSANAQGERA
>NZ_CP007067.1|WP_003573522.1|1504982_1505129_-|DUF1127-domain-containing-protein
MNFSRSFNNWRKYRQTITELGRMSNRELHDLGIDRSDIHRVAREASSR
>NZ_CP007067.1|WP_003573524.1|1504537_1504681_-|DUF1127-domain-containing-protein
MNPIRIAKSWLSYRRTLNELGGLSNQTLSDIGVSRYDIRNIASRSFR
>NZ_CP007067.1|WP_003573526.1|1503003_1504437_-|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO
MNTISSYSPIHVVGGGLAGSEAAWQIASSGVPVILHEMRGVRGTDAHKTDGLAELVCSNSFRSDDATSNAVGVIHAEMRMAGSLIMATADRHQVPAGGALAVDRDGFSEAVTRAIDDHPLITVVREEITGLPPNDWDLAIVATGPLTAPSLASAIQAETGEDSLAFFDAIAPIVYRESIDMDICWYQSRYDKVGPGGTGKDYINCPMDEAQYNAFVDALISGDTVGFKEWEGTPYFDGCLPIEVMAERGRETLRHGPMKPMGLTNAHNPTVKAYAVVQLRQDNALGTLYNMVGFQTKLKYGAQAEIFRMIPGLENAEFARLGGLHRNTYINSPTLLTPSLTLKSRPGLRFAGQITGCEGYVESASVGLMAGRFAAAERKGEAISLPPATTALGSLLGHITGGHIVTDEEPGKRSFQPMNINFGLFPELQPGSIVKPEGVKRFRGKDKTIMKRQLIARRALADCAAWLGQNSPLADSA
>NZ_CP007067.1|WP_003573528.1|1502527_1502995_+|hypothetical-protein
MGIIVWCVLFAIVIFFAFVATRLAAQNKEDGLHDTGLAIIEFGRAFPNEAIRQLQATENGQAIFVRLHDNKAGFMRNMSRHFACHLIEPGRVRVVSSQTGRGLVIDFLDAPHQNGDFEFASAKESSEVALWLLGNYIAEPDKDLPSNHISAANKH
>NZ_CP007067.1|WP_025416067.1|1501597_1502455_+|phytoene/squalene-synthase-family-protein
MAEAKTATNQEICLAMLRDSDRDRYLACLLSPDDKRGALAALYTFNAELARIRDLVHEPLPGEVRLQYWRDLLEGSAHGSTAANPVAAALLTAVETHRLPRKTLIDMIEARTFDLYDDPMETRLSLEGYAGETASALIQLASLVLSPEEAARSADAAGHAGVAQAVAGLLLLMPLHRRRGQVYIPLQILSATGLNRDAFLAGEDRPRISAAIEAFAGLGREHLAKARAAGPITPRVFPAFLPATLAEPVLLRAQKLGAVPFDRTLQPPQWRRQLSMALSASRKKI
>NZ_CP007067.1|WP_003573530.1|1501207_1501594_+|membrane-protein
MAKGIEIRAAHFPGRAPIDTYGNGGFRFADMSHRGSILCLPSGIHGWDMDMSKPLSPENFRRVLDEADDIEVLLVGTGTELRRLPEELKQALKSRGIASDPMSTGAAVRTFNIMLAEQRAVAAALIAV
>NZ_CP007067.1|WP_025416066.1|1498662_1501203_+|protein-translocase-subunit-SecDF
MLHFSRWKTLLIWLAAFAAIIIAAPNLLSEAQRSSLPGWLRHDRVTLGLDLQGGSHIVLKVERSDIVKDRLEEVVANVRNVLRGAGIRYTGLTGNDQTVTVRITDPAETQKAVDLLKPLTTAGGRSGPDVALQQGEEGQLSLQISDAGITADVASARTRSLDIVSRRIAGFGYENFLVRPDDADRIVVQVLGSVDAERLKNLLNQPAKLSFHLIDASMSGQEALNGRWPATSQVLYSLDDPPVPYLVDRTAFANASNMVEIEPVVDPQTEDTSIAYRFDAEGTRRLAEVTGQNIGKHLAIVFDDQVMSAPSIDAAITGGEGAISANFSEDGVRDLAVMLRAGALPATLTSVEERSVSPRFGADSIFSGLVAGLVAVVLVAALMIALYRILGVIAVVSLVFNLILIIAVLSLAGATLTLPGIAGIVLIVGMAVDSNVLIYERIREEERTAHSFAEAVRRGFQRAFATIVDANVTIFIAAIILFFLGSESIRGFAVTLAVGILATVFTAFTLTRSIVAVWLKGRHPRHLPKSVLTHLFEHANIRFMGIRRYVFTASAIISLIAMAAFATAGLRLGIDFTGGSLIEVTAKQGNADLADLQSRLNDLNLGEISVQRTGGPSNARIRIASQGGGENAEQSAATLVRGELQEDYDFRRVEVVGPAISGELTMMATLGVLAALAAILIYIWIRFEWQFAVGAIIATLHDVIIMLGLFVLTGMEFNLTSVAALLTVVGYSLNDTVVVYDRMRENLKRYKKMPLPILIDASINQTLSRTILTAATTLLALLALYLFGGEVIRSFTFTMLFGVALGTFSSIYIAAPVLIVFRLRPASPDEEESNKTDAGVKSGTVV
>NZ_CP007067.1|WP_003573534.1|1498269_1498617_+|preprotein-translocase-subunit-YajC
MFITPAFAQSATDTATGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGDQVVTGGGLVGKVTKVIDDKEVEVEIADGVRVRIVRSGISDVRVKGEPVKADAA
>NZ_CP007067.1|WP_003573515.1|1509795_1510218_+|hypothetical-protein
MTAKKDMKTLVEEIYSVRDRGDIEGTLALIGDGCTFRMVGNARLAPLTTETSGHDFRQTITQLIAAWDLSKIRTTGIYVDEDEQMVFAHREGEVRHVPSGVSFNTEFVDKIHFQDGKPVKIVEFVDTLQVAETSRMIQFA
>NZ_CP007067.1|WP_025416071.1|1510297_1512067_-|radical-SAM-protein
MSHVLEAARRRFQLILIKPSHYDDDGYVIRWWRAMIPSNSLAALYGIAAECAERKVLGPDTAIDITVIDETNTRIDFAGLLAQFKRHDNFGMIALVGVQTNQYPRALDIARPFRDAGLPVSIGGFHVSGCLSMLDGKAVGLDACRDMGISMFAGEAEGRLEMVLRDAAGGELKPLYNFMNDLPGIGGTPVPFLPKDNIQRTLGLSTSFDAGRGCPYQCSFCTIINVQGRKSRFRSADDVEKLVRMNWAQGIHKFFITDDNFARNKDWEAIFDRLIELKERDGIPLGLMIQVDTLCHKIPNFIEKSRRAGVTRVFIGLENVNPDNLTAAKKNQNKITEYRKMLLAWKAQGIMTLAGYILGFPADTPESIRRDIAIIQEELPLDVIEFFILTPLPGSEDHQVLWKKGVEMDGDLNIYDVEHVCTAHPKMSKQEWEDIYHEAWALYYSPDHMKTLLRRAVATGVPLARLVKVLVSFATTVPLENVHPLQSGLLRLKTPSERRPELPRENPLVFWPRFAWETFRKHASLAGTIIGLTISAFLISREAKSKTYMDQALTPVADDEEETLSLFTKTSGGTAAVSHVRKVAELTRH
>NZ_CP007067.1|WP_025416072.1|1512228_1513032_-|endonuclease/exonuclease/phosphatase-family-protein
MRIISLNAWGGRLHEALIDYVRQADADVLCLQEVLRAPGADGGWSIYRDAGLELPQRANLFAEISAALPGHDGFFCPTSRGELFNGDSAIAAEFGLATFVRKSHSVIAQGLDFVHGGFSADGWGEHPRPRNAHCIRVFSHEQASAVTIAHMHGLRDPAGKDDTAARQEQAAALVKLVERIWPGNEGLVVCGDFNVLPDSATFAILTRLGLCELVTGNGLVDTRTSYYLKPGRFADYMLVTPGVSVAKFEVVETPEVSDHRALLLDIG
>NZ_CP007067.1|WP_003573508.1|1513096_1514503_-|Si-specific-NAD(P)(+)-transhydrogenase
MLQYDLVVVGSGPAGRRGAIQAAKLGKKVLVIEQGKRVGGVSVHTGTIPSKTLRETALNLSGWRERGFYGRSYRVKEEISADDLRRRLLITLNHEVEVLEHQFARNRVQHIRGKASFIDASTLQVIKDDGEITQVTGASVLLAVGTKPFRPDYIPFDGKTVLDSDELLDIQELPRSMVVIGAGVIGIEYATIFSALDTAVTVIDPKTTMLDFIDKEIVEDFTYQLRDRNMKLLLGQKADKVETLDGGKVELTLDSGRRLTTDMVLFAAGRMGATDALNLPAIGLEADSRGRLKVNPETFQTSVANVYAAGDVVGFPSLASTSMEQGRIAARVAIGAVAKEPPKYFPYGIYAVPEISTCGLTEEEMKERGIPYECGIARFRETSRGHIMGLDTGLLKLIFSLKTRRLLGVHIVGEGATELVHIGQAVLNLKGTVEYFVENTFNYPTLAEAYKIAGLDAWNRMGDIKSEL
>NZ_CP007067.1|WP_025416073.1|1514622_1515450_-|DNA-repair-protein-RadC
MAKGPVSTSSDDELPFATQEPIAADERSFFGGQPQKPAGPNAKSALPASLAAQEHYHGHRERLRDRFREQGDIALADYEILELLLFRLIPRRDTKPIAKALIERFGSLSGVFGAPAALLTEVKGVGEAVALDLKLISTVAHRTLKSELRAKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAMILVHNHPSGDPTPSRADIDMTKVIIDAAKALDITVHDHVIIGKDGHVSLKGLKLI
>NZ_CP007067.1|WP_003573504.1|1515457_1516294_-|type-I-methionyl-aminopeptidase
MVNYIEASSAPSKNTGAIRLYDAQAFEGMRRACQLTARCLDALADIVKPGLVTDDIDRFVFDFGMDHGAHPATLNYRGYTKSTCTSINHVVCHGIPNDKPLREGDIVNIDVTFVLDGWHGDSSRMYPVGTIKRAAERLLEVTYESLMRGISAVRPGARTGAIGEAIQTFAEAERCSVVRDFCGHGVGRLFHDSPNILHYGRANEGPELREGMIFTIEPMINLGRPHVKVLADGWTAVTRDRSLSAQYEHTVGVTSDGCEIFTLSPGGLDRPGLPSHNG
>NZ_CP007067.1|WP_025416074.1|1516544_1517204_+|TetR/AcrR-family-transcriptional-regulator
MLDEAVKLENLLEAGGEPERRVRDRGATERAILAAAKGLLAEEGFQNFGINAVARRAGCDKQLIYRYYGGLDGLVEAIGADLGTWVRDRIPEDAGGMFLLTYGDLMERLSLLLLGALRDDPLMRRILAWEISENTEQVRRLAEARSKALALWLERMRGSLAPPKGVDAAAVNAVIIAAIQHLVLAAASGEQCAGLSLKTSKDWEKTATALKRIVRGVYG
>NZ_CP007067.1|WP_003573500.1|1517336_1517510_+|hypothetical-protein
MGPKIGRATFFVTAMMFFAVLALDIAIPTLVLCIMALSTWLVSLDLPVTRKQGGEAA
>NZ_CP007067.1|WP_003573498.1|1517506_1517839_+|hypothetical-protein
MKWFLIFWAGPIVFLGGWYWLSYYDMNFGIFMLSRQVHDLTFQLYGEALGIPPETIPPLVARAIAVDSLIVFAILGFRKRKSIIAWWTARQALNSSPADLASKESLSSAP
>NZ_CP007067.1|WP_038574203.1|1517775_1518270_-|Holliday-junction-resolvase-RuvX
MTVLTIEEMAETLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRIKFTIDAQALMDFAIAEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNMEQKTALPFVYWDERLSTVAAERTLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSAGDEFSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007067_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007067_3

1630790-1630890

Orphan

Consensus_repeat	Method
GACCCAAAGCATGTCGCGCAAAAGTGTGCAGCGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007067_3

>merge|NZ_CP007067|3|1630790-1630890|CRISPRCasFinder
GACCCAAAGCATGTCGCGCAAAAGTGTGCAGCGGTTTCGCGACAACGACATGCGTAAAAACAAAGACCCAAAGCATGTCGCGCAAAAGTGTGCAGCGGTTT

>NZ_CP007067|3|3|1630790-1630890|CRISPRCasFinder
GACCCAAAGCATGTCGCGCAAAAGTGTGCAGCGGTTT	CGCGACAACGACATGCGTAAAAACAAA
GACCCAAAGCATGTCGCGCAAAAGTGTGCAGCGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007067.1\|WP_003573270.1\|1637704_1637941_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573295.1\|1630099_1630726_+\|porin-family-protein	unknown	unknown	gnl\|CDD\|226163
NZ_CP007067.1\|WP_003573292.1\|1631077_1631281_+\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|225777
NZ_CP007067.1\|WP_025416121.1\|1625327_1626539_+\|UbiH/UbiF-family-hydroxylase	unknown	unknown	gnl\|CDD\|181001
NZ_CP007067.1\|WP_003573274.1\|1637175_1637433_+\|DUF982-domain-containing-protein	unknown	unknown	gnl\|CDD\|368772
NZ_CP007067.1\|WP_003573306.1\|1623095_1624766_+\|nitrite/sulfite-reductase	unknown	unknown	gnl\|CDD\|223233
NZ_CP007067.1\|WP_003573297.1\|1628760_1629510_-\|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|223856
NZ_CP007067.1\|WP_025416123.1\|1631393_1631621_-\|membrane-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573278.1\|1635531_1635825_+\|DUF982-domain-containing-protein	unknown	unknown	gnl\|CDD\|368772
NZ_CP007067.1\|WP_003573287.1\|1631779_1631950_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_025416120.1\|1621333_1622770_+\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|381169
NZ_CP007067.1\|WP_025416122.1\|1626506_1627469_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP007067.1\|WP_003573276.1\|1635962_1636790_-\|DUF4242-domain-containing-protein	unknown	unknown	gnl\|CDD\|143636
NZ_CP007067.1\|WP_003579112.1\|1622772_1623087_+\|DUF2849-domain-containing-protein	unknown	unknown	gnl\|CDD\|371340
NZ_CP007067.1\|WP_025416124.1\|1632275_1633790_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|235870
NZ_CP007067.1\|WP_010069037.1\|1637534_1637705_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573309.1\|1620478_1621066_-\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NZ_CP007067.1\|WP_025416125.1\|1635042_1635225_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007067.1\|WP_003573305.1\|1624776_1625289_+\|DUF934-domain-containing-protein	unknown	unknown	gnl\|CDD\|226272
NZ_CP007067.1\|WP_003573299.1\|1627643_1628579_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293806

Protein	Function_ID	Function_description	E-value
NZ_CP007067.1\|WP_003573295.1\|1630099_1630726_+\|porin-family-protein	gnl\|CDD\|226163	COG3637, COG3637, Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane].	2.60602e-30
NZ_CP007067.1\|WP_003573292.1\|1631077_1631281_+\|CsbD-family-protein	gnl\|CDD\|225777	COG3237, COG3237, Uncharacterized protein conserved in bacteria [Function unknown].	9.29715e-21
NZ_CP007067.1\|WP_025416121.1\|1625327_1626539_+\|UbiH/UbiF-family-hydroxylase	gnl\|CDD\|181001	PRK07494, PRK07494, UbiH/UbiF family hydroxylase.	0
NZ_CP007067.1\|WP_003573306.1\|1623095_1624766_+\|nitrite/sulfite-reductase	gnl\|CDD\|223233	COG0155, CysI, Sulfite reductase, beta subunit (hemoprotein) [Inorganic ion transport and metabolism].	0
NZ_CP007067.1\|WP_003573297.1\|1628760_1629510_-\|cytochrome-c-biogenesis-protein-CcdA	gnl\|CDD\|223856	COG0785, CcdA, Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones].	9.09254e-48
NZ_CP007067.1\|WP_003573274.1\|1637175_1637433_+\|DUF982-domain-containing-protein	gnl\|CDD\|368772	pfam06169, DUF982, Protein of unknown function (DUF982). This family consists of several hypothetical proteins from Rhizobium meliloti, Rhizobium loti and Agrobacterium tumefaciens. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.	7.23631e-23
NZ_CP007067.1\|WP_003573278.1\|1635531_1635825_+\|DUF982-domain-containing-protein	gnl\|CDD\|368772	pfam06169, DUF982, Protein of unknown function (DUF982). This family consists of several hypothetical proteins from Rhizobium meliloti, Rhizobium loti and Agrobacterium tumefaciens. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.	1.04966e-15
NZ_CP007067.1\|WP_025416120.1\|1621333_1622770_+\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|381169	cd11642, SUMT, Uroporphyrin-III C-methyltransferase (also known as S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT). SUMT is an enzyme of the cobalamin and siroheme biosynthetic pathway. It catalyzes the first of three steps leading to the formation of siroheme from uroporphyrinogen III; it transfers two methyl groups from S-adenosyl-L-methionine to the C-2 and C-7 atoms of uroporphyrinogen III to yield precorrin-2 via the intermediate formation of precorrin-1. Precorrin-2 is also a precursor for the biosynthesis of vitamin B12, coenzyme F430, siroheme and heme d1. This family includes proteins in which the SUMT domain is fused to other functional domains, such as to a uroporphyrinogen-III synthase domain to form bifunctional uroporphyrinogen-III methylase/uroporphyrinogen-III synthase, or to a dual function dehydrogenase-chelatase domain, as in the case of the multifunctional S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase/dehydrogenase/ferrochelatase CysG, which catalyzes all three steps that transform uroporphyrinogen III into siroheme.	3.47629e-108
NZ_CP007067.1\|WP_025416122.1\|1626506_1627469_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	2.43627e-53
NZ_CP007067.1\|WP_003573276.1\|1635962_1636790_-\|DUF4242-domain-containing-protein	gnl\|CDD\|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	8.208e-36
NZ_CP007067.1\|WP_003579112.1\|1622772_1623087_+\|DUF2849-domain-containing-protein	gnl\|CDD\|371340	pfam11011, DUF2849, Protein of unknown function (DUF2849). This bacterial family of proteins has no known function.	4.0519e-32
NZ_CP007067.1\|WP_025416124.1\|1632275_1633790_+\|FAD-dependent-monooxygenase	gnl\|CDD\|235870	PRK06834, PRK06834, hypothetical protein; Provisional.	0
NZ_CP007067.1\|WP_003573309.1\|1620478_1621066_-\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	1.01219e-36
NZ_CP007067.1\|WP_003573305.1\|1624776_1625289_+\|DUF934-domain-containing-protein	gnl\|CDD\|226272	COG3749, COG3749, Uncharacterized protein conserved in bacteria [Function unknown].	2.60484e-63
NZ_CP007067.1\|WP_003573299.1\|1627643_1628579_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293806	cd07720, OPHC2-like_MBL-fold, Pseudomonas pseudoalcaligenes organophosphorus hydrolase C2, and related proteins; MBL-fold metallo hydrolase domain. Pseudomonas pseudoalcaligenes OPHC2 is a thermostable organophosphorus hydrolase which a broad substrate activity spectrum: it hydrolyzes various phosphotriesters, esters, and a lactone. This subgroup also includes Pseudomonas oleovorans PoOPH which exhibits high lactonase and esterase activities, and latent PTE activity. However, double mutations His250Ile/Ile263Trp switch PoOPH into an efficient and thermostable PTE. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.15907e-83

>NZ_CP007067.1|WP_003573295.1|1630099_1630726_+|porin-family-protein
MKLTIATTFLALVASTAFAADAVQDIPAAPVAAAPVFTWSGPYFGIDGGAGWLNGDFDFGGGASASEDFNGGVFGAFAGYNFQFDSIVVGIEGNVEHNWNEEDVLGAEIGTDWSGAVRGRVGYAFDKALIYGAAGWTATRGYVDVPGFDKETETFNGYTVGAGVDFAITNNIFARGEYRYNDFGKQDILGVDVDLDQHEVKFGVGVKF
>NZ_CP007067.1|WP_003573297.1|1628760_1629510_-|cytochrome-c-biogenesis-protein-CcdA
MSIADISLWSALIAGALSFLSPCVLPLVPPYLCYMAGISVEQFRGGGAVAVAPDVRRGVLFSALLFTLGFATVFVALGAGASSIGMALRQHLDLLSKIGGLIIIVMGLNFLGVFRLGLLAREARFQGGGKPATLTGAYIMGLAFAFGWTPCIGPVLGAILGVAASRETVGSGAGLLAVYSLGLAIPFWIAAGFSGAFMRFLSRFRRHLGTVEKVMGVFLVLTGLAFLFGWVSDVAIWFQQTFPVLMQIG
>NZ_CP007067.1|WP_003573299.1|1627643_1628579_-|MBL-fold-metallo-hydrolase
MNLETKMSLENTAHPGRHRLDELVPSRYALNIGDIEVLVVSDGVLPLPTAMLGHNIDPAVRATWLKDMFLPPDALDWALNVVVVRSGEQIILLDAGLGIDPDLHLPRAGQLIKRLGAAGIDLASVTDVVLTHMHMDHIGGLLVDGVKDQLRPDLRIHVAAAEVKFWEAPDFSRVSMPPGFPDALRAAAKRFAKEYSSHLRLFDEEYEVAPGVVVHRTGGHTPGHSVIRLASGGDRLMFAGDAVFAVGFEHPDWFNGFEHDPEEAVRVRVRLLRELAETGEQLVATHLPFPSVGRVAVDGDAFRWVAAFWDY
>NZ_CP007067.1|WP_025416122.1|1626506_1627469_-|AEC-family-transporter
MADIVSLLLPFFGLILIGFIAAKATKQPAEALGWLNTFIIYAALPALFFKLVSRTPIEELTRVDFIVTDIAATYAVFILLFAVGRVLRGNSLADCTIQSFAGAYGNIGYMGPGLALLALGEGAAVPVALIICFENALHFIVAPALMAAAGDDKRSPGRLAADIARKVALHPFILSTAAGFAVAALDIDQPLAFQRLVDYLAQAAAPCALFAMGVTLALRPLKRIPAEISYIVPAKLILHPIAVFIALTAVGGFDPVWIQAAVLLACLPTATNVFVIGQQYGVWQERASATILITTVLSLASVSLWLIAIRSGLLPFQLLP
>NZ_CP007067.1|WP_025416121.1|1625327_1626539_+|UbiH/UbiF-family-hydroxylase
MKTFEVAVIGGGLAGMIAAIALARGGRSVALVAPVAAKEDRRTTALMDQSIRFLDRLTLWEKLRPAAAPLSSMRIIDGTDRLLRAPTTTFRAAEVGLDAFGYNFPNKALTEILETAAAGEGNITRLTEMAESIAISNEAVSITLANGETVTADFAVGADGRGSKLRETAAIDTRKWSYPQSAMVLNFAHSLPHQNISTEFHTKHGPFTQVPLPQGRSSLVWVQDPTEAAARMELPLAELGSLVEAQMQSMLGKVSIEEGVQVWPLSGMMAHRFGKGRIALIGEAAHVFPPIGAQGLNLSLRDIMALADILCDRAELPVPADAGDSFDRKRRADIMTRTASVDLLNRSLLSDFLPVQMLRAAGLHILAALPPLRSIVMREGIEPGRGFRDIPDALREKLKRKKA
>NZ_CP007067.1|WP_003573305.1|1624776_1625289_+|DUF934-domain-containing-protein
MTKIWRETGFVENDPWVIETEEVKATGEQKPLLSLDELIARADESNDVGLGVLIKPADDVRRLEPYLDRLEIIAVAFPAFNDGRAFSHASLLRQRLGYTSELRAVGDVLIDQVPLMLRVGIDSFSVTNATALKRLAENRLPAIPHHYQPAVRDAEAGKGYSWRRQAKPAA
>NZ_CP007067.1|WP_003573306.1|1623095_1624766_+|nitrite/sulfite-reductase
MYRYDEFDHAFVTERVEQFRDQVQRRLAGELAEDAFKPLRLMNGVYLQLHAYMLRIAIPYGTLSARQMRMLAHIARTYDRGYGHFTTRQNLQFNWPKLSEIPDALADLASVEMHALQTSGNCIRNVTADHFAGAAADEVADPRPYAEILRQWSSVHPEFSFLPRKFKIAVTGAERDRAAIQVHDIGLHLKTNDKGEIGFAVYVGGGQGRTPMIAKLIRDFLPEEDLLSYTTAIVRVYNLHGRRDNKYKARIKILVHETGAEELTRQVEAEFAALKDTELKLPEKDVEAIASYFALPDLPERAEGWENLARWKKADAGFARWVQQNVQPHKNPDYGMVTISLKPIGGIPGDATDAQMDAIADLAEEYAFDEIRVSHEQNLILPHVALADLEAVYRGLVAINLAEANAGLITDIIACPGLDYCALANARSIPLAQEISRRFGSAERQAEIGELKIKISGCINACGHHHVGHIGLLGVEKKGAELYQITLGGSGDEHTSIGEIIGRGFEPDRVTDAIETIVDTYLGLRLDPSEIFLATYRRVGPQPFKTALYGSAAEAA
>NZ_CP007067.1|WP_003579112.1|1622772_1623087_+|DUF2849-domain-containing-protein
MGDKVLTANRLTDGIAVWLDANGKWSTSLQEALVARHNEAVEALEAIGKKSYADNEVVDVAVVDVQETDGILWPLRLRERIRAQGPTMEYAPGYAPADPEFIAV
>NZ_CP007067.1|WP_025416120.1|1621333_1622770_+|uroporphyrinogen-III-C-methyltransferase
MPSKTEQLSVFPAFFRVEGQKTAVFGNGDEAFAKVRLLLNTRARIIAYAVRPEADYHAFLIANRIETVRAAFSAEQVETAALVFAATGNEADDREIVDAARAAGIPANAVDQPDYCDFFTPALVNRAPVAVAIGTEGAGPVLAQMIRAQIDQLLSPSLGRLAGLATSYRKSVEQLVPRGVSRRVFWRRFFSGPVADAVANGNLPQAQHAADRLLRSMDKVAGHVWLVGAGPGAEDLLTLRAQRVMMEADVIVYDALVPQAIVDMGRRDAERLSVGKRKGCHSKSQEEINELLVDLGRQGRRVVRLKSGDPLVYGRAGEEMAALRAAGITYEVVPGITSAFAAAADFELPLTLRGVASSLVFTTGHDLTGDVLPDWASLAVSGATIAVYMGRTVAASVAERLMQAGIPAETTVAVIENASRAERRLLHGTLADLPDLQHRDELTGPVMVIIGDAVAGANFELSEPLVRANARLEELARS
>NZ_CP007067.1|WP_003573309.1|1620478_1621066_-|nucleoside-deaminase
MPDETIASRLLSVMEEDILPLTERGVSLGNKVFGAAILRKSDLSLVVAETNNELENPLWHGEVHTLKRFYELGDKPATKDLIFLSTHEPCTMCMSAITWAGFDNFYYFFSHEDSRDAFAIPHDLKILKEVFGLEPGGYRRQNAFWNSFAIADLVETEEAPLKTALKAQTARIKARYDALSSSYQSSKSANDIPLN
>NZ_CP007067.1|WP_003573292.1|1631077_1631281_+|CsbD-family-protein
MDWNRVEGNWKQAKGKIKEQWGKLTDDDLDQIAGKRDQLEGKIQERYGIERDRIRRDIDDWYGRQTW
>NZ_CP007067.1|WP_025416123.1|1631393_1631621_-|membrane-protein
MWVILIGAALIIGGLLFLFSSVLGRKPSNPHQLPQGGTTLEPRRQGLRFLGLSQNWPALAVIALGAILLAFGRYS
>NZ_CP007067.1|WP_003573287.1|1631779_1631950_+|hypothetical-protein
MDKTPKTAIRGMILYVLALLVLGVLAGAIYTIYGHPGDPSERPAAETIPQKAPPPQ
>NZ_CP007067.1|WP_025416124.1|1632275_1633790_+|FAD-dependent-monooxygenase
MKEHAVVISGGGPTGLMLAGELALAGVDVAIVERRQNQEIVGSRAGGLSARTLEVLDQRGVVDRFLAEGQIAQVTGFAVTRLDISDFPTRHNYGLALRQKHIERILAGWVGELPVAIYRGRELTRFAEDDTGVTIELSDGASLRAGYLVGCDGGRSLVRKMAGIEFPGWDATTSNILAEAEMEEEPPLGVHRTALGMHAFGREEYEIRDGKVIFASEGPVNVMVTEKNAGGTGEPTLGDLRQALIETCGTDYGIHSLRWISRFTDMSRQATAYRKGRIFLAGDAAHVHSPVGGQGLNTGVQDAVNLGWKLAQVVKGISPASLLDTYHAERHPVAARVLRTTMAQVALQRTDDRTEALRDIVLELLAMQEPRKKIAAEMSGLAIHYDLGEGHPLLGRRMPDLDLTTSDGPLRVYALLKNVQPVLLNLGAPGSLDNGPWSGRVQRVDAGYDGVWELPALGAVSAPTAALIRPDGYVAWVGEGTPDGLLEAMTTWFGQPDKETPKPG
>NZ_CP007067.1|WP_025416125.1|1635042_1635225_-|hypothetical-protein
MNRFLTFVAIGALLGVSAITSSCTSPAKHDREDFQYQRDTSINPACAGGFRPGNARSCSY
>NZ_CP007067.1|WP_003573278.1|1635531_1635825_+|DUF982-domain-containing-protein
MSETRFDPVLLHRQHFIAEITCLDEIIDFLDEWPEDKRGLAYDTLLKACRDTASGRFPLSAARENFRRFLKMSGVLAKVEGAPKFEQLMGDRNIGNA
>NZ_CP007067.1|WP_003573276.1|1635962_1636790_-|DUF4242-domain-containing-protein
MPIFMDRHFLEGTSAADVARAHRMDLDIQDRYGVKFLTYWFDQRRGTAFCLVDAPDMETAQCVHREAHGLVAGEIVEVALSAVEAFLGRIHDPEPAPGQSSAQVDPGHRAILFTDIVGSTEMTARLGDRIGTEMVRAHDAIVRRCLGQNSGREVKHTGDGIMAAFSATTAAVECAMAIQQEFRRYNGGNTEPIHIRIGLDCGEPVEDSNDLFGSTVQLAARLCAAASSDQILVSENIFREYGATDLFGHASRRRLKGFSKPVMVFRCDWANGATA
>NZ_CP007067.1|WP_003573274.1|1637175_1637433_+|DUF982-domain-containing-protein
MRQTANFRPVGLASMGLGHYAVINSVWDAARTLLHDWPVDDGEDYLEAVKSCLDAIIGDLPPDEVRASFIRAAQEAGIAVIEAAD
>NZ_CP007067.1|WP_010069037.1|1637534_1637705_+|hypothetical-protein
MTHTEQVIANALALVEASRAARERDQLRRAAWQRKVELSRPLPPLPRPVQLPLALN
>NZ_CP007067.1|WP_003573270.1|1637704_1637941_+|hypothetical-protein
MQPAKILEPDTIWPDPAWPDPAWEVEAVLAWHDDNAKAAIRSLLDDCKHLRRQLALAERAMSRGMTRGWTPRYERDAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050084	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence	80628-80654	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	287496-287522	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1304365-1304391	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	212438-212464	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	401194-401220	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	680367-680393	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053209	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence	145808-145834	1	0.963
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	648857-648883	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	485257-485283	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	472935-472961	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	501979-502005	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	389445-389471	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	24345-24371	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	767230-767256	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	575324-575350	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	551826-551852	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP025017	Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence	160199-160225	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	516775-516801	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP020897	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	55769-55795	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021026	Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence	95-121	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	349369-349395	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013528	Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	551828-551854	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	205089-205115	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013581	Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	113-139	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	148061-148087	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	55991-56017	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	111277-111303	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	16-42	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	763186-763212	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	50116-50142	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	219295-219321	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	473161-473187	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	168719-168745	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	151275-151301	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	126587-126613	2	0.926
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	34929-34955	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1284954-1284980	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	529453-529479	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	643869-643895	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	648953-648979	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	50135-50161	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	503349-503375	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	237131-237157	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	239599-239625	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	339721-339747	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	650631-650657	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	212850-212876	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	494221-494247	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	55709-55735	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1988929-1988955	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	69653-69679	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	241891-241917	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	95673-95699	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	737340-737366	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	233801-233827	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	802526-802552	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	937173-937199	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_007762	Rhizobium etli CFN 42 plasmid p42a, complete sequence	44580-44606	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	232176-232202	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	328928-328954	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	495329-495355	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	86-112	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	648937-648963	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	435122-435148	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	514504-514530	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	512011-512037	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	5244-5270	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	461093-461119	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	113-139	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP016293	Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence	80605-80631	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_011371	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence	146090-146116	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	675705-675731	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	644863-644889	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	662045-662071	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	1146208-1146234	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	665446-665472	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	659285-659311	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	322905-322931	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	662045-662071	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	322905-322931	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	322905-322931	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	644863-644889	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	54383-54409	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	322905-322931	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	682443-682469	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	53824-53850	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	176485-176511	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	641125-641151	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	207130-207156	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	233773-233799	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	802767-802793	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	102040-102066	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	459877-459903	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	375812-375838	3	0.889
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	271210-271236	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	291321-291347	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	214465-214491	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	6513-6539	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	322315-322341	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_007762	Rhizobium etli CFN 42 plasmid p42a, complete sequence	23929-23955	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	322645-322671	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	11127-11153	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	99450-99476	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	307438-307464	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	307437-307463	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	26244-26270	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	371137-371163	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	371131-371157	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	837674-837700	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	908323-908349	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1924327-1924353	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	643251-643277	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	643252-643278	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	641692-641718	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	645939-645965	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	632811-632837	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	643252-643278	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	519944-519970	4	0.852
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	607673-607699	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	726427-726453	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	537955-537981	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	610825-610851	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	109148-109174	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	156844-156870	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	706459-706485	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	26973-26999	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	521782-521808	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	698031-698057	5	0.815
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	34943-34969	6	0.778
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	34938-34964	6	0.778
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	421408-421434	6	0.778
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	421402-421428	6	0.778
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	424585-424611	6	0.778
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP022605	Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence	898184-898210	6	0.778
NZ_CP007067_3	3.1\|1630827\|27\|NZ_CP007067\|CRISPRCasFinder	1630827-1630853	27	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	76700-76726	8	0.704

1. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050084 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ggcgacaacgacatgcgtaaaaacaaa	Protospacer
 **************************

2. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaaa	Protospacer
.**************************

3. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaaa	Protospacer
.**************************

4. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaaa	Protospacer
.**************************

5. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaaa	Protospacer
.**************************

6. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaaa	Protospacer
.**************************

7. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053209 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence) position: , mismatch: 1, identity: 0.963

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ggcgacaacgacatgcgtaaaaacaaa	Protospacer
 **************************

8. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacggcatgcgtaaaaacaaa	Protospacer
.*********.****************

9. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaag	Protospacer
.*************************.

10. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaag	Protospacer
.*************************.

11. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaaaaacaag	Protospacer
.*************************.

12. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

13. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcggaaaaacaaa	Protospacer
.**************** *********

14. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacggcatgcgtaaaaacaaa	Protospacer
.*********.****************

15. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaagaacaaa	Protospacer
.*******************.******

16. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacaacaaa	Protospacer
.******************* ******

17. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP025017 (Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacaacaaa	Protospacer
.******************* ******

18. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaagaacaaa	Protospacer
.*******************.******

19. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP020897 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

20. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtgaaaacaaa	Protospacer
.*****************.********

21. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021026 (Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

22. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgttaaaacaaa	Protospacer
.***************** ********

23. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

24. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

25. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

26. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

27. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

28. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013528 (Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

29. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

30. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

31. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

32. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

33. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

34. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacaacaaa	Protospacer
.******************* ******

35. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaaa	Protospacer
.****.*********************

36. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013581 (Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

37. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

38. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

39. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

40. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

41. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

42. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaaa	Protospacer
.****.*********************

43. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

44. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

45. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtgaaaacaaa	Protospacer
.*****************.********

46. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaaa	Protospacer
.****.*********************

47. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaaacaaa	Protospacer
.***.**********************

48. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaaa	Protospacer
.****.*********************

49. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacggcatgcgtaaaaacaaa	Protospacer
.*********.****************

50. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaaa	Protospacer
.****.*********************

51. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaagaacaaa	Protospacer
.*******************.******

52. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
cgggacaacgacatgcataaaaacaaa	Protospacer
** *************.**********

53. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
cgggacaacgacatgcataaaaacaaa	Protospacer
** *************.**********

54. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
cgggacaacgacatgcataaaaacaaa	Protospacer
** *************.**********

55. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaag	Protospacer
.****.********************.

56. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaag	Protospacer
.****.********************.

57. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaag	Protospacer
.****.********************.

58. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataccgacatgcgtaaaaacaaa	Protospacer
.****.* *******************

59. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgagaacgacatgcgtaaaaacaag	Protospacer
.**** ********************.

60. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaag	Protospacer
.****.********************.

61. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacaaa	Protospacer
.*** .*********************

62. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacgtgcgtagaaacaaa	Protospacer
.***********.******.*******

63. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacggcatgcgtaaaaacaaa	Protospacer
.***.*****.****************

64. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacaaa	Protospacer
.*** .*********************

65. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaaacaag	Protospacer
.****.********************.

66. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacggcatgcgtaaaaacaaa	Protospacer
.***.*****.****************

67. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tacgacaaggacatgcgtaaaaacaaa	Protospacer
..****** ******************

68. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacctgcgtaaaaacaaa	Protospacer
.****.****** **************

69. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgcaaaaacaag	Protospacer
.****************.********.

70. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgatatgcgtaaaaacaat	Protospacer
.**********.**************

71. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacggcatgcgtaaaaacaaa	Protospacer
.***.*****.****************

72. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
cgggacaacgacatgcataaaaacaag	Protospacer
** *************.*********.

73. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacggcatgcgtaaaaacaaa	Protospacer
.****.****.****************

74. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacgtgcgtagaaacaaa	Protospacer
.***********.******.*******

75. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaaaggcatgcgtaaaaacaaa	Protospacer
.******* *.****************

76. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

77. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_007762 (Rhizobium etli CFN 42 plasmid p42a, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgttaaaacaaa	Protospacer
.***.************* ********

78. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacacgcgtaaaaacaaa	Protospacer
.****.*******.*************

79. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

80. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgaaaaaacaaa	Protospacer
.***.************ *********

81. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgctgcaacgacatgcgtaaaaacaaa	Protospacer
.** .**********************

82. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

83. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtgaaaacaaa	Protospacer
.***.*************.********

84. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgccgcaacgacatgcgtaaaaacaaa	Protospacer
.** .**********************

85. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgtgtaaaaacaaa	Protospacer
.****.*********.***********

86. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacaaa	Protospacer
.*** .*********************

87. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacaataaa	Protospacer
.******************* **.***

88. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgggtaaaaacaaa	Protospacer
.***.********** ***********

89. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP016293 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacaaa	Protospacer
.*** .*********************

90. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_011371 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtcaaaacaaa	Protospacer
.***.************* ********

91. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

92. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

93. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

94. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgaaaacgacatgcgcaaaaacaaa	Protospacer
.**** ***********.*********

95. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

96. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

97. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

98. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

99. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

100. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

101. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

102. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtgaaaacaaa	Protospacer
.***.*************.********

103. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

104. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtgagaacaaa	Protospacer
.*****************.*.******

105. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacggcatgcgtaaaaacaaa	Protospacer
.***.*****.****************

106. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacaataaa	Protospacer
.******************* **.***

107. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaaa	Protospacer
.****.** ******************

108. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcaacaacggcatgcgtaaaaacaaa	Protospacer
.**.******.****************

109. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacgtgcgtagaaacaaa	Protospacer
.***********.******.*******

110. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaaaggcatgcgtaaaaacaaa	Protospacer
.******* *.****************

111. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgcaaaaacaaa	Protospacer
.***.************.*********

112. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacaataaa	Protospacer
.******************* **.***

113. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 3, identity: 0.889

cgcgac-aacgacatgcgtaaaaacaaa	CRISPR spacer
-gcgataaaagacatgcgtaaaaacaaa	Protospacer
 ****. ** ******************

114. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgagaacgacatgcgtaaaaaacaa	Protospacer
.**** *****************  **

115. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgctgcaacggcatgcgtaaaaacaaa	Protospacer
.** .*****.****************

116. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgccgcgacgacatgcgtaaaaacaaa	Protospacer
.** .*.********************

117. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
cggaataacgacatgcgtaaacacaaa	Protospacer
** .*.*************** *****

118. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcggaaaaacaag	Protospacer
.****.*********** ********.

119. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_007762 (Rhizobium etli CFN 42 plasmid p42a, complete sequence) position: , mismatch: 4, identity: 0.852

-cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ttgcaa-agcgacatgcgtaaaaacaaa	Protospacer
 .**.* *.*******************

120. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcggaaaaacaag	Protospacer
.****.*********** ********.

121. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

122. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
cggaataacgacatgcataaaaacaaa	Protospacer
** .*.**********.**********

123. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgaaaaatcaag	Protospacer
.**************** **** ***.

124. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgaaaaatcaag	Protospacer
.**************** **** ***.

125. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
caaaacaacgacatgcggaaaaacaaa	Protospacer
*. .************* *********

126. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaag	Protospacer
.****.** *****************.

127. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataaagacatgcgtaaaaacaag	Protospacer
.****.** *****************.

128. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgcgaaaacaga	Protospacer
.****************..******.*

129. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgcgaaaacaga	Protospacer
.****************..******.*

130. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgggacaacgacatgcatgaaaacaaa	Protospacer
.* *************.*.********

131. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

132. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

133. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

134. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

135. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

136. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgctaacgacatgcgtaaaaacata	Protospacer
.*** .******************* *

137. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 4, identity: 0.852

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ctggacaacgacatgcatcaaaacaaa	Protospacer
*  *************.* ********

138. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacacaaag	Protospacer
.******************* *  **.

139. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacacaaag	Protospacer
.******************* *  **.

140. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgagaacgacatgcgtaaaacaaag	Protospacer
.**** ****************  **.

141. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgagaacgacatgcgtaaaacaaag	Protospacer
.**** ****************  **.

142. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaacaaag	Protospacer
.****.****************  **.

143. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgtggtaacgacatgtgtaaaaacaaa	Protospacer
.*.*..*********.***********

144. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcggcaacgacatgcgtaaaacaaag	Protospacer
.***.*****************  **.

145. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgcaaaacaaag	Protospacer
.****************.****  **.

146. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaacaaag	Protospacer
.****.****************  **.

147. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 5, identity: 0.815

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgacaacgacatgcgtaacacaaag	Protospacer
.******************* *  **.

148. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 6, identity: 0.778

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaataagg	Protospacer
.****.****************  *..

149. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 6, identity: 0.778

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
tgcgataacgacatgcgtaaaacaagg	Protospacer
.****.****************  *..

150. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 6, identity: 0.778

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ttcgataacgacatgcataaaaacagg	Protospacer
. ***.**********.********..

151. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 6, identity: 0.778

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ttcgataacgacatgcataaaaacagg	Protospacer
. ***.**********.********..

152. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 6, identity: 0.778

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ttcgataacgacatgcataaaaacagg	Protospacer
. ***.**********.********..

153. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP022605 (Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ttgaataaagacatgcgtaaaaacaaa	Protospacer
.  .*.** ******************

154. spacer 3.1|1630827|27|NZ_CP007067|CRISPRCasFinder matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

cgcgacaacgacatgcgtaaaaacaaa	CRISPR spacer
ggcgacaacgacatgcgtaattgtcgt	Protospacer
 *******************  .. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1119899 : 1129109

Aeromonas_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025415833.1\|1119899_1121198_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	4.9e-98	51.3
WP_003547190.1\|1121207_1121684_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_025415834.1\|1121687_1122989_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.2e-33	37.2
WP_003574063.1\|1122988_1123600_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.2e-17	35.6
WP_003574061.1\|1123697_1124567_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.4e-95	59.5
WP_025415835.1\|1124576_1125464_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_025415836.1\|1125467_1126523_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.3e-96	51.8
WP_025415837.1\|1126529_1127108_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	3.2e-33	43.4
WP_025415838.1\|1127132_1129109_-	glycosyltransferase family 1 protein	F2Y0P4	Organic_Lake_phycodnavirus	8.7e-06	36.4

DBSCAN-SWA_2

1394795 : 1458712

Rhizobium_phage(40.0%)

integrase,tRNA,head,portal,tail,protease,capsid,terminase

attL 1427442:1427461|attR 1463054:1463073

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025415973.1\|1394795_1395533_-\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA
WP_025415974.1\|1395538_1396576_-	cysteine synthase A	NA	NA	NA	NA
WP_025415975.1\|1396801_1397458_+	cupin domain-containing protein	NA	NA	NA	NA
WP_025415976.1\|1397556_1398390_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_003573637.1\|1398390_1399653_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	8.2e-42	33.8
WP_025415977.1\|1399859_1401308_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	2.8e-54	29.7
WP_003573634.1\|1401459_1401786_-	hypothetical protein	NA	NA	NA	NA
WP_025415978.1\|1401987_1402302_+	hypothetical protein	NA	NA	NA	NA
WP_003573630.1\|1402319_1402805_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_003573628.1\|1402943_1403363_+	DUF2000 domain-containing protein	NA	NA	NA	NA
WP_003573626.1\|1403493_1404171_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_025415979.1\|1404195_1406853_-	nitrate reductase	NA	NA	NA	NA
WP_025415980.1\|1406852_1407188_-	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_025415981.1\|1407192_1409643_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003573619.1\|1409660_1410902_-	NarK/NasA family nitrate transporter	NA	NA	NA	NA
WP_025415982.1\|1411296_1412580_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_037092785.1\|1412614_1413202_-	ANTAR domain-containing response regulator	NA	NA	NA	NA
WP_025415984.1\|1413533_1415357_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_025415985.1\|1415373_1416372_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_003573610.1\|1416663_1417323_+	peroxiredoxin	NA	NA	NA	NA
WP_003573608.1\|1417472_1418429_+	lytic transglycosylase domain-containing protein	A0A0A0P1R1	Enterobacteria_phage	2.5e-06	34.6
WP_025415986.1\|1418526_1419480_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_025415987.1\|1419491_1420757_-	glycerate kinase	NA	NA	NA	NA
WP_003573603.1\|1420951_1421251_+	hypothetical protein	NA	NA	NA	NA
WP_025415988.1\|1421267_1422353_-	PHB depolymerase family esterase	NA	NA	NA	NA
WP_025415989.1\|1422563_1422971_+	low affinity iron permease family protein	Q19XG2	Mycobacterium_phage	1.3e-09	42.9
WP_025415990.1\|1422997_1423357_-	low affinity iron permease family protein	NA	NA	NA	NA
WP_025415991.1\|1423508_1425623_-	catalase	A0A2K9L572	Tupanvirus	2.9e-140	49.4
WP_025415992.1\|1425800_1426697_-	hypothetical protein	NA	NA	NA	NA
WP_080687562.1\|1426911_1427178_-	hypothetical protein	NA	NA	NA	NA
WP_025415993.1\|1427174_1427411_-	hypothetical protein	NA	NA	NA	NA
1427442:1427461	attL	NA	NA	NA	NA
WP_025415995.1\|1428612_1428927_+	hypothetical protein	NA	NA	NA	NA
WP_155256625.1\|1429182_1429482_-	hypothetical protein	NA	NA	NA	NA
WP_025415997.1\|1429724_1430909_+\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.6e-79	44.6
WP_172644311.1\|1431136_1431343_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_025415999.1\|1431433_1432003_+	hypothetical protein	NA	NA	NA	NA
WP_025416000.1\|1432251_1434603_+	DUF3987 domain-containing protein	A0A249XYW6	Clostridium_phage	6.7e-05	34.1
WP_025416001.1\|1434830_1435232_+	hypothetical protein	NA	NA	NA	NA
WP_025416002.1\|1436633_1437647_+	hypothetical protein	A0A0R6PIZ6	Moraxella_phage	4.3e-25	26.7
WP_025416004.1\|1438054_1438525_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_052349976.1\|1438554_1440123_+\|terminase	terminase large subunit	F1C585	Cronobacter_phage	2.8e-100	44.6
WP_025416006.1\|1440138_1441380_+\|portal	phage portal protein	B0VK31	Azospirillum_phage	3.1e-94	43.2
WP_155256626.1\|1441376_1442117_+\|head,protease	HK97 family phage prohead protease	B0VK32	Azospirillum_phage	7.7e-24	43.4
WP_025416008.1\|1442160_1443450_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	2.1e-48	32.8
WP_025416009.1\|1443515_1443947_+	hypothetical protein	B0VK34	Azospirillum_phage	3.0e-28	54.0
WP_025416010.1\|1443946_1444189_+	hypothetical protein	NA	NA	NA	NA
WP_025416011.1\|1444194_1444758_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	1.5e-06	44.6
WP_025416012.1\|1444775_1445186_+	hypothetical protein	B4UTP8	Rhizobium_phage	1.9e-32	59.0
WP_025416013.1\|1445337_1445688_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_025416014.1\|1445684_1446146_+	HK97 gp10 family phage protein	B4UTQ0	Rhizobium_phage	1.3e-24	45.2
WP_025416015.1\|1446149_1446566_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_025416016.1\|1446605_1447043_+	hypothetical protein	NA	NA	NA	NA
WP_025416017.1\|1447042_1447408_+	gene transfer agent family protein	B4UTQ4	Rhizobium_phage	7.4e-12	41.3
WP_025416018.1\|1447633_1449904_+	tape measure protein	A0A141GEX2	Brucella_phage	9.3e-36	27.6
WP_025416019.1\|1449913_1450636_+	hypothetical protein	B4UTQ7	Rhizobium_phage	4.2e-91	66.7
WP_080687588.1\|1450665_1451205_+	hypothetical protein	B4UTQ9	Rhizobium_phage	1.3e-52	52.5
WP_025416021.1\|1451290_1451509_-	hypothetical protein	NA	NA	NA	NA
WP_025416022.1\|1451507_1451948_+	hypothetical protein	B4UTR0	Rhizobium_phage	4.3e-38	60.9
WP_025416023.1\|1451948_1453994_+	hypothetical protein	B4UTR1	Rhizobium_phage	8.0e-204	53.3
WP_025416024.1\|1454032_1455502_+	hypothetical protein	B4UTR2	Rhizobium_phage	3.3e-66	64.3
WP_155256627.1\|1455506_1456598_+	hypothetical protein	NA	NA	NA	NA
WP_025416026.1\|1456615_1456909_-	hypothetical protein	NA	NA	NA	NA
WP_025416027.1\|1457020_1457230_+	hypothetical protein	NA	NA	NA	NA
WP_025416028.1\|1457216_1457813_+	lysozyme	L7TM06	Rhizobium_phage	2.2e-61	61.8
WP_025416029.1\|1457809_1458181_+	hypothetical protein	NA	NA	NA	NA
WP_038573798.1\|1458101_1458404_+	hypothetical protein	NA	NA	NA	NA
WP_025416031.1\|1458400_1458712_+	hypothetical protein	B4UTS1	Rhizobium_phage	6.1e-23	53.7
1463054:1463073	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1488099 : 1501203

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025416059.1\|1488099_1489113_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	4.8e-24	42.6
WP_003573554.1\|1489161_1490019_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.2e-33	37.2
WP_025416060.1\|1490015_1490732_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.1e-38	47.5
WP_003538990.1\|1490915_1491107_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_025416061.1\|1491157_1491772_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003573547.1\|1491768_1492596_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.2e-52	46.1
WP_025416062.1\|1492695_1493979_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.3e-98	45.3
WP_025416063.1\|1493983_1494757_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.2e-23	30.2
WP_003573541.1\|1494753_1495407_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.6e-17	35.9
WP_025416064.1\|1495546_1497139_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	8.6e-12	29.2
WP_025416065.1\|1497193_1498066_-	ATP-binding protein	NA	NA	NA	NA
WP_003573534.1\|1498269_1498617_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	3.2e-12	38.0
WP_025416066.1\|1498662_1501203_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.3e-57	47.8

DBSCAN-SWA_4

1704475 : 1714675

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025416163.1\|1704475_1707397_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.0
WP_025416164.1\|1707680_1708190_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	9.3e-45	56.8
WP_003573165.1\|1708276_1708924_-	MarC family protein	NA	NA	NA	NA
WP_025416165.1\|1709160_1711980_+	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	1.1e-75	41.9
WP_003573160.1\|1712330_1712486_-	hypothetical protein	NA	NA	NA	NA
WP_025416166.1\|1712628_1712907_-	hypothetical protein	NA	NA	NA	NA
WP_025416167.1\|1712996_1713491_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.7e-24	36.5
WP_025416168.1\|1713564_1714137_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.9e-42	52.6
WP_003573154.1\|1714165_1714675_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.2e-45	59.4

DBSCAN-SWA_5

3468924 : 3476084

Mycobacterium_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025417122.1\|3468924_3469635_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	1.3e-47	47.3
WP_003566894.1\|3469634_3469991_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_025417123.1\|3469987_3470716_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	4.4e-40	38.3
WP_025417124.1\|3470722_3471946_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	3.2e-14	27.5
WP_025417125.1\|3472050_3473025_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	3.3e-139	75.1
WP_025417126.1\|3473256_3475455_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	6.1e-210	51.5
WP_025417127.1\|3475433_3475850_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	2.9e-12	34.1
WP_025417128.1\|3475862_3476084_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	6.1e-17	52.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP007067

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection