CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP004042	Burkholderia pseudomallei MSHR146 chromosome 1, complete sequence	2 crisprs	cas3,DEDDh,csa3,DinG,WYL	2	1	10	1
NZ_CP004043	Burkholderia pseudomallei MSHR146 chromosome 2, complete sequence	4 crisprs	DinG,csa3,cas3	1	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP004042_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004042_1

3881341-3881507

Orphan

Consensus_repeat	Method
GCGTCGGGCGTCGGGCGTCGGGC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP004042_1

>merge|NZ_CP004042|1|3881341-3881507|CRISPRCasFinder
GCGCGGCGTGACGGGCGGCGCGCCGCCCGGCCGCGGATGTTTCGATGTGCCGGGCGCGAAGCGTTGTGCGTTGTGCGTTGTGCGTTGTGCGTTGTGCGTTGTGCGTCGGGCGTCGGGCGTCGGGCGTCGGGCGTCGGGCGTCGGGCGTCGGGCGTCGGGCGTCGGGC

>NZ_CP004042|1|1|3881341-3881507|CRISPRCasFinder
GCGCGGCGTGACGGGCGGCGCGC	CGCCCGGCCGCGGATGTTTCGATGTGCCGGGCGCGAA
GCGTTGTGCGTTGTGCGTTGTGC	GTTGTGCGTTGTGCGTTGT
GCGTCGGGCGTCGGGCGTCGGGC	GTCGGGCGTCGGGCGTCGG
GCGTCGGGCGTCGGGCGTCGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004042.1\|WP_004198307.1\|3872841_3873645_+\|pyrimidine-5'-nucleotidase	unknown	unknown	gnl\|CDD\|319791
NZ_CP004042.1\|WP_004531039.1\|3879132_3880077_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377694
NZ_CP004042.1\|WP_024430105.1\|3875792_3876407_+\|methionine-biosynthesis-protein-MetW	unknown	unknown	gnl\|CDD\|273958
NZ_CP004042.1\|WP_004189550.1\|3887174_3888218_+\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237562
NZ_CP004042.1\|WP_038723725.1\|3877721_3878759_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NZ_CP004042.1\|WP_004523085.1\|3873611_3874301_+\|nucleoid-occlusion-factor-SlmA	unknown	unknown	gnl\|CDD\|181894
NZ_CP004042.1\|WP_004198312.1\|3871369_3871621_-\|cysteine-rich-CWC-family-protein	unknown	unknown	gnl\|CDD\|379586
NZ_CP004042.1\|WP_004198314.1\|3870071_3871352_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP004042.1\|WP_038723724.1\|3876418_3877732_+\|AmpG-family-muropeptide-MFS-transporter	unknown	unknown	gnl\|CDD\|341039
NZ_CP004042.1\|WP_004189331.1\|3888337_3889411_+\|rod-shape-determining-protein-MreC	unknown	unknown	gnl\|CDD\|237560
NZ_CP004042.1\|WP_004198305.1\|3874650_3875796_+\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|234678
NZ_CP004042.1\|WP_004189747.1\|3882465_3883305_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274737
NZ_CP004042.1\|WP_004190029.1\|3881663_3882434_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NZ_CP004042.1\|WP_012730580.1\|3890103_3892515_+\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|274573
NZ_CP004042.1\|WP_004200214.1\|3871945_3872845_+\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NZ_CP004042.1\|WP_004189171.1\|3892526_3893675_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP004042.1\|WP_004523090.1\|3883431_3884904_-\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatB	unknown	unknown	gnl\|CDD\|235489
NZ_CP004042.1\|WP_004189769.1\|3886509_3886809_-\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatC	unknown	unknown	gnl\|CDD\|178810
NZ_CP004042.1\|WP_004525859.1\|3884906_3886397_-\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatA	unknown	unknown	gnl\|CDD\|234572
NZ_CP004042.1\|WP_004523092.1\|3889407_3889920_+\|rod-shape-determining-protein-MreD	unknown	unknown	gnl\|CDD\|225444

Protein	Function_ID	Function_description	E-value
NZ_CP004042.1\|WP_004198307.1\|3872841_3873645_+\|pyrimidine-5'-nucleotidase	gnl\|CDD\|319791	cd02604, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to Saccharomyces cerevisiae Phm8p and Sdt1p. This family includes Saccharomyces cerevisiae Phm8p (phosphate metabolism protein 8) and Sdt1p (Suppressor of disruption of TFIIS). Phm8p participates in the ribose salvage pathway, it catalyzes the dephosphorylation of nucleotide monophosphates to nucleosides, its preferred substrates are nucleotide monophosphates AMP, GMP, CMP, and UMP. Phm8p is also a lysophosphatidic acid phosphatase, dephosphorylating lysophosphatidic acids (LPAs) to monoacylglycerol in response to phosphate starvation. Sdt1p is a pyrimidine and pyridine-specific 5'-nucleotidase; it is an NMN/NaMN 5'-nucleotidases involved in the production of nicotinamide riboside and nicotinic acid riboside, and is a pyrimidine 5'-nucleotidase with high specificity for UMP and CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.16502e-43
NZ_CP004042.1\|WP_004531039.1\|3879132_3880077_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|377694	pfam06719, AraC_N, AraC-type transcriptional regulator N-terminus. This family represents the N-terminus of bacterial ARAC-type transcriptional regulators. In E. coli, these regulate the L-arabinose operon through sensing the presence of arabinose, and when the sugar is present, transmitting this information from the arabinose-binding domains to the protein's DNA-binding domains. This family might represent the N-terminal arm of the protein, which binds to the C-terminal DNA binding domains to hold them in a state where the protein prefers to loop and remain non-activating. All family members contain the pfam00165 domain.	3.05588e-65
NZ_CP004042.1\|WP_024430105.1\|3875792_3876407_+\|methionine-biosynthesis-protein-MetW	gnl\|CDD\|273958	TIGR02081, conserved_hypothetical_protein, methionine biosynthesis protein MetW. This protein is found alongside MetX, of the enzyme that acylates homoserine as a first step toward methionine biosynthesis, in many species. It appears to act in methionine biosynthesis but is not fully characterized. [Amino acid biosynthesis, Aspartate family].	2.89616e-98
NZ_CP004042.1\|WP_004189550.1\|3887174_3888218_+\|rod-shape-determining-protein	gnl\|CDD\|237562	PRK13927, PRK13927, rod shape-determining protein MreB; Provisional.	0
NZ_CP004042.1\|WP_038723725.1\|3877721_3878759_+\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	7.78672e-57
NZ_CP004042.1\|WP_004523085.1\|3873611_3874301_+\|nucleoid-occlusion-factor-SlmA	gnl\|CDD\|181894	PRK09480, slmA, division inhibitor protein; Provisional.	4.5091e-116
NZ_CP004042.1\|WP_004198312.1\|3871369_3871621_-\|cysteine-rich-CWC-family-protein	gnl\|CDD\|379586	pfam14375, Cys_rich_CWC, Cysteine-rich CWC. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 74 and 102 amino acids in length. It contains eight conserved cysteines, including a conserved CWC sequence motif.	0.00163135
NZ_CP004042.1\|WP_004198314.1\|3870071_3871352_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	8.12029e-22
NZ_CP004042.1\|WP_038723724.1\|3876418_3877732_+\|AmpG-family-muropeptide-MFS-transporter	gnl\|CDD\|341039	cd17486, MFS_AmpG_like, AmpG and similar transporters of the Major Facilitator Superfamily. AmpG acts as an inner membrane permease in the beta-lactamase induction system and in peptidoglycan recycling. It transports meuropeptide from the periplasm into the cytosol in gram-negative bacteria, which is essential for the induction of the ampC encoding beta-lactamase. The AmpG family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.42967e-138
NZ_CP004042.1\|WP_004189331.1\|3888337_3889411_+\|rod-shape-determining-protein-MreC	gnl\|CDD\|237560	PRK13922, PRK13922, rod shape-determining protein MreC; Provisional.	3.47407e-94
NZ_CP004042.1\|WP_004198305.1\|3874650_3875796_+\|homoserine-O-acetyltransferase	gnl\|CDD\|234678	PRK00175, metX, homoserine O-acetyltransferase; Provisional.	0
NZ_CP004042.1\|WP_004189747.1\|3882465_3883305_-\|hypothetical-protein	gnl\|CDD\|274737	TIGR03709, PPK2_rel_1, polyphosphate:nucleotide phosphotransferase, PPK2 family. Members of this protein family belong to the polyphosphate kinase 2 (PPK2) family, which is not related in sequence to PPK1. While PPK1 tends to act in the biosynthesis of polyphosphate, or poly(P), members of the PPK2 family tend to use the terminal phosphate of poly(P) to regenerate ATP or GTP from the corresponding nucleoside diphosphate, or ADP from AMP as is the case with polyphosphate:AMP phosphotransferase (PAP). Members of this protein family most likely transfer the terminal phosphate between poly(P) and some nucleotide, but it is not clear which. [Central intermediary metabolism, Phosphorus compounds].	1.36509e-134
NZ_CP004042.1\|WP_004190029.1\|3881663_3882434_-\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	3.18354e-149
NZ_CP004042.1\|WP_012730580.1\|3890103_3892515_+\|penicillin-binding-protein-2	gnl\|CDD\|274573	TIGR03423, pbp2_mrdA, penicillin-binding protein 2. Members of this protein family are penicillin-binding protein 2 (PBP-2), a protein whose gene (designated pbpA or mrdA) generally is found next to the gene for RodA, a protein required for rod (bacillus) shape in many bacteria. PBP-2 acts as a transpeptidase for cell elongation (hence, rod-shape). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP004042.1\|WP_004200214.1\|3871945_3872845_+\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	7.33242e-162
NZ_CP004042.1\|WP_004189171.1\|3892526_3893675_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	2.02827e-157
NZ_CP004042.1\|WP_004523090.1\|3883431_3884904_-\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatB	gnl\|CDD\|235489	PRK05477, gatB, Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB.	0
NZ_CP004042.1\|WP_004189769.1\|3886509_3886809_-\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatC	gnl\|CDD\|178810	PRK00034, gatC, Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC.	1.96939e-34
NZ_CP004042.1\|WP_004525859.1\|3884906_3886397_-\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatA	gnl\|CDD\|234572	PRK00012, gatA, Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA.	0
NZ_CP004042.1\|WP_004523092.1\|3889407_3889920_+\|rod-shape-determining-protein-MreD	gnl\|CDD\|225444	COG2891, MreD, Cell shape-determining protein [Cell envelope biogenesis, outer membrane].	3.78327e-28

>NZ_CP004042.1|WP_004531039.1|3879132_3880077_-|AraC-family-transcriptional-regulator
MSFEPLFADGGARLQRRILALFGQLAPNEGYTHAAIDGVRFIRSNRPVPRMPVLYDPSIVVVCQGRKRGYVGERSFVYDAQQYLVLSVPLPFECETFATPDEPFLAISIRIDLAVIAELAILLDETHGASVSEPRGIYSTPLDAPLADAVLRLLEALASPADTRVLGPAIMREIGYRVLTGAQGDAIRAALAQQHHFGRVARALRRIHADLSGELDVETLASEAGMSLAVFHAQFKSVTATSPMQYVKATRLHHARLMMVQDGLNAGAAAARVGYASASQFSREFKRLFGRSPSDEVRWVQAGGRQPVALEAGE
>NZ_CP004042.1|WP_038723725.1|3877721_3878759_+|M48-family-metallopeptidase
MQAKLRVARAALTFVGGVALGVAGPALGFELCMAEPMLVADNGAPPVPSAPAVATPAAPAAAPAAGNPQPYALGDQQVRYGNAIVFRSLIPSPLLEQLTDNEYRQTVQDAAQRKRLLPPNNARVKRLRTIVMRLAPYAVKWSERVKGWNWEIEVLRSRSIRAFCLPGGKVLVDSGLLERLRLTDDELGVLFAHEIAHALREHARSSLGEQQAASLGTGATPLPPLFGLSEPLPAPLGVVERFASVRYDPTDETEADVIGGDIAARAGFDPRAAITLWDKLAVATRADKDNGFIHAHPYDTRRRNDLRKRLADLMPLYRKALVKNADARANAAAGAKQRGAAATNR
>NZ_CP004042.1|WP_038723724.1|3876418_3877732_+|AmpG-family-muropeptide-MFS-transporter
MTKPPHDAPALNAHEDHPGWRAFLNTHMLICVFLGFTSGLPLFTLVYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRFIPSLPGWRPGRRRGWMFVTQLLVAGAIAALGFVSPRESIWTVAALTTLVAFFGASADIVIDAYRRELLRDTEQGLGNAVHVNAYKVAALIPGSLSLILSDHLPWDAVFALTAAFMLPGILMTLVVREPDVHGAPPKNLSEAVIMPFREFIGRDGWRGALLVLGFIFLYKLGDTMATTLSTSFFLDLGFNKTQIGVIAKTTAFWASLAGGIIGGVWLVKIGIARGLWIFGVLQIVSTLGFAWLAKAGPDPVLMAAIYGFETFSTGLTLAAFTAYIASTTDPRYTATQFALFTSLASVPRTLASASSGFIVAQIGWFDYFLVCAALGIPGMLLLFKIAPWNGSMSGNEAARAG
>NZ_CP004042.1|WP_024430105.1|3875792_3876407_+|methionine-biosynthesis-protein-MetW
MNQQALNTLSARADFRAIARWVEPRSTVLDLGCGDGSLLSLLTEELEVSGYGVEINDAGVLASVKNGVNVIQQNLEDGLRLFEDHSFDFAILSQTLQTIHQTAAILRETARVGRECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEALAPEVGVEILDRVVLHEGQPIRWGVNWRGSLAVYRVKRRQP
>NZ_CP004042.1|WP_004198305.1|3874650_3875796_+|homoserine-O-acetyltransferase
MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAARSNAVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTGPMSIDPATGTPYGARFPVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLLYPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARMIGHITYLSDDDMAEKFGRALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDPAKAFNGDLSAALAHTKAKYLIASFMTDWRFAPARSREIVKALLDNRRSVSYAEIDAPHGHDAFLLDDARYHNLVRAYYERIAEEVGA
>NZ_CP004042.1|WP_004523085.1|3873611_3874301_+|nucleoid-occlusion-factor-SlmA
MQPTHPHDPAVTAAAENERSAATASRTRPKPGERRVHILQTLASMLEAPKSEKITTAALAARLDVSEAALYRHFSSKAQMFEGLIEFIEETFFGLVNQIAANEPNGVLQARSIALMLLNFSAKNPGMTRVLTGEALVGEHERLAERVNQMLERVEASIKQCLRVALLEAQAHAAGGAPPPVPLPDDYDPALRASLVISYVLGRWHRYAKSGFTKAPGEHADAQLRLILQ
>NZ_CP004042.1|WP_004198307.1|3872841_3873645_+|pyrimidine-5'-nucleotidase
MSARRQPRRPASPAASEQAPERPRRRRARPQAGGPVWLFDLDNTLHHASHAIFPAINRAMTQYIIDTLKVERAHADHLRTHYTRRYGAALLGLARHHPIDPHDFLKVVHTFADLPSMVRAERGLARLVAALPGRKIVLTNAPETYARAVLRELKIDRLFERVIAIEQMRDRRAWRAKPDATMLRRAMRAAHARLPDAILVEDTRGHLKRYKRLGIRTVWITGHLPGHLPSYGRPHYVDRRIGSLKSLRLGTRSGRRKCSRLTRMTRQ
>NZ_CP004042.1|WP_004200214.1|3871945_3872845_+|acetylglutamate-kinase
MSEPIDLSQISPALKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKLMMPDRDNPGEYVDIGQVGEVEAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLVMMTNIPGVMDKEGNLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHSVLLEILTEQPFGTMIRSH
>NZ_CP004042.1|WP_004198312.1|3871369_3871621_-|cysteine-rich-CWC-family-protein
MTEPAATPGLISKRCPRCGSAFDCGARTRPFTCWCAAMPAMPAGAQPATGARCLCPACLADEIARRVAASTAGEGPARPERED
>NZ_CP004042.1|WP_004198314.1|3870071_3871352_-|HAMP-domain-containing-histidine-kinase
MQRITTTGRVNLSHLFWLRNLAIIGQLVTIAVVQTYFGVHLPLPAMLMVIALEIVFNALTWVRVLRARPETNFELLGQLWVDLGALSALLFLSGGTTNPFVSLYLPSLAIAAAVLPWHLMIWLAAFAVACYLALGFDSVPLNLDNPANLFDYFRAGMWVNFMVSVGLIAWFVARMSSALRQRDAALGEAQQALLRDERAVALGVQAATVAHEMGTPLSTIAMLTEELREAARTDAGLARYDADLKVLEEQMSQCTSALARLRSRASERPSREPVGEWLDTFVEHWRLRHPHVLFEQRGPQPVGVALDDTVAVGQILTILLDNAARASRDRVTLAATIAHDGARDEIEFEVCDNGPGIPAALRDTLGAAPVDSTQGGHGVGLYLAFSAAARLGGSIELADAQPRGTRAILRLPVARQVAAEMANENG
>NZ_CP004042.1|WP_004190029.1|3881663_3882434_-|exodeoxyribonuclease-III
MLRVITANLNGIRSAAKKGFFEWLGEQNADCVCVQEIKVSADDLPAEFVEPHGLRSYFHHAQKKGYSGAGLYSRREPDDVIIGYGSSEFDAEGRYVEARFGKLSVVSVYVPSGSSGDERQQAKYRFMDEFMPHLAELKAKREVILCGDVNIVHKEIDIKNWKSNQKNSGCLPEERAWLTKLFDDVGYVDVFRTLDPRPEQYTWWSNRGQAYAKNVGWRIDYQIATPGVAGTAKNTSIFRDIKFSDHAPLTVDYDYK
>NZ_CP004042.1|WP_004189747.1|3882465_3883305_-|hypothetical-protein
MAKQPSLDDYRVPYHTREKEAAAFTLDAFDPAAKPFSSGSKETDRERLSAVALQLDTLQERLHTQRHKRMLLVLQGMDSSGKDGTVRAVFHEVDPLGLRIVSFKAPTPVERSHDFLWRVHAQAPAAGELTIFNRSHYEDVLVPRVTAEIDKAECERRYRQIRQFEEMLAESGTRLVKCFLHISKDEQRARLQARIDDPNKHWKFDISDLEARKHWDAYQAAYRDALAATSAEHAPWYVIPADSKTHRNVMIAELLLRELTAMKLEYPPAKPELAGIQIQ
>NZ_CP004042.1|WP_004523090.1|3883431_3884904_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatB
MTQWEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHGLVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGEMPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVSSQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVNELLKKKLG
>NZ_CP004042.1|WP_004525859.1|3884906_3886397_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatA
MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDAELTLAQAKAADAALANGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVVARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCALLLNAMAGFDERDSTSLERADEDYTRHLGKAWAAGGDAGKPLAGLRIGLPAEYFGAGLADDVRAAIDAALKTYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKSCDVIMGPASPTVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFDEARMLQVADAFQRATDWHVQEPAGV
>NZ_CP004042.1|WP_004189769.1|3886509_3886809_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatC
MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE
>NZ_CP004042.1|WP_004189550.1|3887174_3888218_+|rod-shape-determining-protein
MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEGGPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRMFSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKEIGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKLGSIFSYE
>NZ_CP004042.1|WP_004189331.1|3888337_3889411_+|rod-shape-determining-protein-MreC
MEYSPPPLFKQGPSALARLIFFVVLAIALLVSDARFNTLEIVRGVLGTVLYPLQRAALVPRDLIVGAAELATSSTALRHENQQLRDRNLKLSLQANQAGQLAADNAHLRAVLELRQQIAAQATPVEIQYDTGDPFSQKIIIGHGSQAGIQDGAPVVNEDGVIGQVTRVFPLQSEVTLVTDRDLAIPVQVLRTGLRSVIYGTPKGDALDLRFVPTSADLLAGDELVTSGLDGVYPPGLPVAKVVRVDKLADTAFAHVVCAPIAAVRGAREMLVLHYRNDIPPPPVTDDAASDAKAAKGKKATKGADKSAKAADKGADKDKGAKPAAAPPVPARSRPAGPAQPAAPLKPATAPSPGAPR
>NZ_CP004042.1|WP_004523092.1|3889407_3889920_+|rod-shape-determining-protein-MreD
MSRPQYILQPVNPYFIVFSLAAAFLLNLMPWGRVPGVPDCVALVLLFWNIHQPRKVGMGVAFALGILMDVHDAGLLGEHALAYTLLSYGAITIHRRVLWLPLGVQIFYVAPLLVIAQLVPFVIRLLMGAAFPGWSYLVDGFVEAALWPVASHLLLMPQRRPVDPDDTRPI
>NZ_CP004042.1|WP_012730580.1|3890103_3892515_+|penicillin-binding-protein-2
MTEFKDTQQQLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHGKYALQAEENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLADTLDNTINALAEVVQIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRWRFPGVDVRARLFRQYPLGPTAAHVIGYIGRISKRDQDRIDAMSDENDSDPETYDPRRDANNYKGTDYIGKVGVEQSYETELHGITGFEEVEVTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFAGKRGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPPGSTYKPFMALAGLALGKRTPGWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSNDTYFYMLARDLGVTAIANFMKPFGFGQLTGIDIQGEARGILPSPEWKKKTFKKAAQQKWFDGETISLGIGQGYNSFTILQLAHATATLANDGVIMKPHLVKEVENPISRARHLTVPKESGVIPLKQSDLDVVKRGMENVVESPSGTAFKVFRGAPYLAAGKTGTAQVFSLQGGNYRGHLLAEHLRDHALFIAYAPVDHPQIALALIVENGGWGAQSAGPIARRVLDFYLLERKNPSTEAAAVAAAASATEPVNAPVIGDATKPVGIAAGFKALPQPVPPASASGADGASGASGAGGEPTEHANAGGNPAGGGIAGGAAGTANNGSGAAAPGGMPGANGAATGAPPASRRLPPRKPRRTPASDAAISAAASRDDPRKPSSGAPKTPAQDDNHAVSAARPAAGGIDE
>NZ_CP004042.1|WP_004189171.1|3892526_3893675_+|rod-shape-determining-protein-RodA
MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASVDVPGRVEDQLRNIMLTFVLMWVIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKRWLNVGVVIQPSEILKIATPLMLAWYYQRRESSLRWYDFVVAFAILMVPVGLIAKQPDLGTAVLVFAAGLFVIYLAGLSFKLIVPVLVAGVLAVGSIAVFEERICQPEVVWPLMHDYQKHRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAVFSEEFGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVSGVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRLMKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP004042_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004042_2

3940891-3940970

Orphan

Consensus_repeat	Method
ACGGAATGGGCCCCGGCATGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP004042_2

>merge|NZ_CP004042|2|3940891-3940970|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATGGGCGGCGGCTACGGGCGCGGAATGATGGGCGGCTACGGAATGGGGCCCGGCATGATG

>NZ_CP004042|2|2|3940891-3940970|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATG	GGCGGCGGCTACGGGCGCGGAATGATGGGCGGCT
ACGGAATGGGGCCCGGCATGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004042.1\|WP_038723745.1\|3939686_3940655_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP004042.1\|WP_004523107.1\|3933972_3934257_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004042.1\|WP_004524602.1\|3951293_3951464_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004042.1\|WP_038723742.1\|3936422_3937298_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
NZ_CP004042.1\|WP_004525845.1\|3933493_3933976_+\|DUF2778-domain-containing-protein	unknown	unknown	gnl\|CDD\|378506
NZ_CP004042.1\|WP_038723748.1\|3944198_3945812_-\|glutamate--cysteine-ligase	unknown	unknown	gnl\|CDD\|235001
NZ_CP004042.1\|WP_038723749.1\|3945970_3946912_-\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP004042.1\|WP_004530511.1\|3948968_3949523_-\|YaeQ-family-protein	unknown	unknown	gnl\|CDD\|377782
NZ_CP004042.1\|WP_128972475.1\|3930477_3931251_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004042.1\|WP_038723741.1\|3935820_3936285_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004042.1\|WP_004524603.1\|3950571_3951132_-\|spermidine-N1-acetyltransferase	unknown	unknown	gnl\|CDD\|237916
NZ_CP004042.1\|WP_038723739.1\|3931955_3932960_+\|SIR2-family-protein	unknown	unknown	gnl\|CDD\|369676
NZ_CP004042.1\|WP_004525837.1\|3941919_3942468_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004042.1\|WP_038723747.1\|3942731_3944180_+\|RNA-polymerase-sigma-factor-RpoD/SigA	unknown	unknown	gnl\|CDD\|274108
NZ_CP004042.1\|WP_004523120.1\|3946908_3948003_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	unknown	unknown	gnl\|CDD\|185333
NZ_CP004042.1\|WP_038723744.1\|3938449_3939544_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP004042.1\|WP_004197761.1\|3948404_3948821_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319916
NZ_CP004042.1\|WP_038723740.1\|3934330_3935422_-\|phage-portal-protein	unknown	unknown	gnl\|CDD\|222860
NZ_CP004042.1\|WP_004525830.1\|3949738_3950086_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004042.1\|WP_038723743.1\|3937308_3938421_-\|histone-deacetylase	unknown	unknown	gnl\|CDD\|212521

Protein	Function_ID	Function_description	E-value
NZ_CP004042.1\|WP_038723745.1\|3939686_3940655_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.24316e-71
NZ_CP004042.1\|WP_038723742.1\|3936422_3937298_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP004042.1\|WP_004525845.1\|3933493_3933976_+\|DUF2778-domain-containing-protein	gnl\|CDD\|378506	pfam10908, DUF2778, Protein of unknown function (DUF2778). This is a bacterial family of uncharacterized proteins.	5.97651e-49
NZ_CP004042.1\|WP_038723749.1\|3945970_3946912_-\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	3.24507e-53
NZ_CP004042.1\|WP_004530511.1\|3948968_3949523_-\|YaeQ-family-protein	gnl\|CDD\|377782	pfam07152, YaeQ, YaeQ protein. This family consists of several hypothetical bacterial proteins of around 180 residues in length which are often known as YaeQ. YaeQ is homologous to RfaH, a specialized transcription elongation protein. YaeQ is known to compensate for loss of RfaH function.	1.52049e-103
NZ_CP004042.1\|WP_038723743.1\|3937308_3938421_-\|histone-deacetylase	gnl\|CDD\|212521	cd09996, HDAC_classII_1, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes bacterial as well as eukaryotic Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Included in this family is a bacterial HDAC-like amidohydrolase (Bordetella/Alcaligenes species FB18817, denoted as FB188 HDAH) shown to be most similar in sequence and function to class II HDAC6 domain 3 or b (HDAC6b). FB188 HDAH is able to remove the acetyl moiety from acetylated histones, and can be inhibited by common HDAC inhibitors such as SAHA (suberoylanilide hydroxamic acid) as well as class II-specific but not class I specific inhibitors.	1.31187e-172
NZ_CP004042.1\|WP_038723739.1\|3931955_3932960_+\|SIR2-family-protein	gnl\|CDD\|369676	pfam08065, K167R, K167R (NUC007) repeat. This family represents the K167/Chmadrin repeat. The function of this repeat is unknown.	0.00532192
NZ_CP004042.1\|WP_038723748.1\|3944198_3945812_-\|glutamate--cysteine-ligase	gnl\|CDD\|235001	PRK02107, PRK02107, glutamate--cysteine ligase; Provisional.	0
NZ_CP004042.1\|WP_004523120.1\|3946908_3948003_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	gnl\|CDD\|185333	PRK15435, PRK15435, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada.	8.19665e-122
NZ_CP004042.1\|WP_038723744.1\|3938449_3939544_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.45908e-149
NZ_CP004042.1\|WP_038723747.1\|3942731_3944180_+\|RNA-polymerase-sigma-factor-RpoD/SigA	gnl\|CDD\|274108	TIGR02393, RNA_polymerase_sigma_factor_RpoD, RNA polymerase sigma factor RpoD, C-terminal domain. This model represents the well-conserved C-terminal region of the major, essential sigma factor of most bacteria. Members of this clade show considerable variability in domain architecture and molecular weight, as well as in nomenclature: RpoD in E. coli and other Proteobacteria, SigA in Bacillus subtilis and many other Gram-positive bacteria, HrdB in Streptomyces, MysA in Mycobacterium smegmatis, etc. [Transcription, Transcription factors].	1.05375e-87
NZ_CP004042.1\|WP_004197761.1\|3948404_3948821_+\|VOC-family-protein	gnl\|CDD\|319916	cd07253, GLOD5, Human glyoxalase domain-containing protein 5 and similar proteins. Uncharacterized subfamily of VOC family contains human glyoxalase domain-containing protein 5 and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46868e-30
NZ_CP004042.1\|WP_038723740.1\|3934330_3935422_-\|phage-portal-protein	gnl\|CDD\|222860	PHA02536, Q, portal vertex protein; Provisional.	0
NZ_CP004042.1\|WP_004524603.1\|3950571_3951132_-\|spermidine-N1-acetyltransferase	gnl\|CDD\|237916	PRK15130, PRK15130, spermidine N1-acetyltransferase; Provisional.	7.47948e-86

>NZ_CP004042.1|WP_038723745.1|3939686_3940655_+|LysR-family-transcriptional-regulator
MRRIDLLSALETFVCAVEEGSLSQAARRLAKTPSAVTKAIAGLEATLGVQLLERTTRRLALTESGRLYLATATDVLRRLADGARQLSERDDEPRGLLRVTAAHSFGHAILAPLCAPFAQAFPRVRIELSLSDHYVDIVGEGFDLALRMGNYDLPSQIVKPIGSNRGLLCASPGYLARRGRPTAPADLAQHDCVIYRHPTLANTWTFERGGVRARLEPKGPLVTDDYGLALAAALDGAGVLPCPQWSVVDALEEGRLVPLLVDWRFESASFGEDRICAAYPSSRRGSTKIRRLVERVQARLADSEARVARVLGDALCADLARR
>NZ_CP004042.1|WP_038723744.1|3938449_3939544_-|polyamine-ABC-transporter-substrate-binding-protein
MKRIAWLAAVLASLACAAARAAGGNVLNIYNWAEYFAPDTIAGFEKETGIKVRLDVYDSNEALQTKLTTGNSGYDLVFPSNDFLARQIQAGLYRKLDKSRLPNLTNLDPAIVARAAEVDPGNQYSVPYMQGTFGLGLNVAKVKQALGGPLPANTLELIFNPAYAAKLERCGIAFNDAGSEVFPLALRYIGRDPNTTDPRDYEAALDMMKKIRPTIRQFIATPVMNDLATGDVCVVTGYSGAVLVAARRAAEAKNGQQIVYSLPPAGAPFWFDSMAIPKGAAHADHALRFIDYILRPDVVAKISNKVMYPNPNRVATPLVDRRLTANPAIYPDAATMRTLWVKRPMPPQAMRMQTRYWTRFKTGY
>NZ_CP004042.1|WP_038723743.1|3937308_3938421_-|histone-deacetylase
MIPTGLLFDPVFLSHRQGDLVYVVPHGTLNLGEHFDSPLRLAYTKQLLDAVGMTERLTRVAFARATDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSASTEDVARLAAGAACAAVDAVMTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARHAQAAHGVERVAIVDWDVHHGNGTQQAFYDDPSVLFVSLHEAANFPVDGGEARETGGGAGAGYNANVPLPSGTGDAGYRHAFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQRDGFRHMARALRQAAGGACGGRIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQFVQYPLGEGERAAVKAARAALAPYWPTLHRS
>NZ_CP004042.1|WP_038723742.1|3936422_3937298_-|N-carbamoylputrescine-amidase
MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELFETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIFDADGRALGIYRKTHIPDGPGYTEKYYFMPGDTGFRVWDTAYGRIGVGICWDQWFPECARAMALAGAELLLYPSAIGSEPHDASIDSRAHWRNAQRGHAAANLMPVAASNRVGVERGASGEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRALSEGAADRVR
>NZ_CP004042.1|WP_038723741.1|3935820_3936285_+|hypothetical-protein
MEFRPIKESDLGSTYDIRFPVTENRILPHQIHLLERDRVLEQLRSGFGVLAIEGDAAVGYCTATGSGGPGKRSWRTAPKHCHAGPRRLRERAALAAAAPRAARSRPRACVTCKAPSAERRSPSETSCASARTGRRAPFGRFSAFAAHRQAGRRH
>NZ_CP004042.1|WP_038723740.1|3934330_3935422_-|phage-portal-protein
MSSWRRRASTTAPSACSNVTSSAATTLRNRPRQIRAPARAEVFTFDDPTPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTFRPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVRRKADFSGFVYVNGWQERHEFEPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHAGFILYMTDAAQKQDDVDNMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKDEFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAELNDWLGEEVVRFDDYEIPPAPVAA
>NZ_CP004042.1|WP_004523107.1|3933972_3934257_+|hypothetical-protein
MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVFRALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA
>NZ_CP004042.1|WP_004525845.1|3933493_3933976_+|DUF2778-domain-containing-protein
MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVADKGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWLALYRIDGQIDDWTIVNGIRRGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK
>NZ_CP004042.1|WP_038723739.1|3931955_3932960_+|SIR2-family-protein
MAQKKKVVYFLGAGASFGAGAKATVQAGHQLPIPTQATFWPTFLRFCKSQKNRARIESFLFRYFLGYGKTPVRTPAAKRRHLLTSIDVEEVFTFLSERTRAPSTSTQLRTYALQVWGALAEEIGQVFSRFNANSATKAIYKDFLKHHFRRFDTVVSFNYDTIFENSLPARRSARYVGLRDSAGTIPLLKPHGSVNWVQADDGTITVGNPVGPAVIVAPTHLKFISNPDQKEVQHPGYLDQAHEIQKIWAEMEREMRFARSLVFIGYSFPVADLYFASVLRSVLADRDTTPNIVIVNPDAVAISERLLRRFPLVTVSRFFDLAQFIRAGRAVIAQ
>NZ_CP004042.1|WP_128972475.1|3930477_3931251_+|hypothetical-protein
MANDKPNKGRRLRLAVSRFAAMLIQEAKHIGQLSSYRAVDEALDLPYGQSFRYAQYPVGAKTRAPQVAWIQELENRVAKLLKRTAHTVIVENNLIREEMGIPSELTNPRDFSGDNFQLGYEGDWPTYRRLICPEPDLIEMYYWQWGVLWDRGLPLLSREEWGVPADSPIEPFVDALTHDKMRARAKVEELVGNRYRWGEAPDIDPSDVLLEWDFADTVDFLERVGGDVLLFWQRATGGTAGIVPESPRYLELSLEGM
>NZ_CP004042.1|WP_004525837.1|3941919_3942468_+|hypothetical-protein
MEEAYARRALLLHLGSVLQILSRLEGAPDNQSIEALLAANGMLADVPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGWKAYAATLREVSPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRERAAASVESATPAGAPVRRESYE
>NZ_CP004042.1|WP_038723747.1|3942731_3944180_+|RNA-polymerase-sigma-factor-RpoD/SigA
MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFAHDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDTTASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADPALGRARAALQRARARGDEGARAFARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPEKSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLRAIEKFEHRRGFKFSTYATWWIRQAISRAVADRARTIRVPVHVGDEARRVRKAADRIERRSGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLFDALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIEKRALQTLRVTAEACNAHDFLDVQP
>NZ_CP004042.1|WP_038723748.1|3944198_3945812_-|glutamate--cysteine-ligase
MPNNMTSRQTDLLQQRLAVLSASPTREQLPDGLRGIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLERLDELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGASPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYLDALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFGRVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDAHARAIAAQRAKLDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSLAEQAELEGKNAGSFDAFVAAYRAYTLNRFSV
>NZ_CP004042.1|WP_038723749.1|3945970_3946912_-|DNA-3-methyladenine-glycosylase-2-family-protein
MSAAVEPAAVRPDSVVLELPFKSPYDWPRVLRFFAGRAIPGVEAVGDGAYRRTVDHHGAIGTLTVRKHPRKRCLVALVEGDAARHADAAFAARLSTMFDLQADPAAIGAHLARDAWFAPLVGAAPGLRVPGAWSGFELIVRAIVGQQVSVKAATTIVGRLVERAGERLAPHAPGAIGWRFPEPAALAACDVSRIGMPGKRAAALQGVARAVAAGDVPLDAYASDPAGVRAALLALPGIGPWTVEYVAMRAWRDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSARGG
>NZ_CP004042.1|WP_004523120.1|3946908_3948003_-|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada
MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPERIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA
>NZ_CP004042.1|WP_004197761.1|3948404_3948821_+|VOC-family-protein
MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQLRAGRSLIDLLAVGAPIDRAGSGAPGKGRNMDHLCLRVEPFDAAALRTHLAAHGARPGDEARRYGADGYGPSLYLFDPEGNMVELKGPPEAVAP
>NZ_CP004042.1|WP_004530511.1|3948968_3949523_-|YaeQ-family-protein
MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIAAFALFAHERLEFCKGLSDTDEPDLWQKDLTGAIEVWVDVGQPDERRIAKASGRAGRVNVIAYGGRTSDIWWQGARGKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWLSSATHDPVAIEWTTLKAREDA
>NZ_CP004042.1|WP_004525830.1|3949738_3950086_-|hypothetical-protein
MLKRTGLFLALTGGIVAFSVAQANGDASLKPQQEIQLTKNAWGCLSKDNLDSVLNHERDGKAQAKQQYFDDYRCLSVPEGQRFRVVSVDKGDVQFVSAENSDQQGLWTDARFIKQ
>NZ_CP004042.1|WP_004524603.1|3950571_3951132_-|spermidine-N1-acetyltransferase
MQIQNEQHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFTELSQLYDQHVHDQRERRFVAFDSDGELVGLVELIELDYIHRRGEFQIIIAPNRQGRGFATRATRLAVEYAFKVLNLRKLYLIVDKSNVAAIRVYEKCGFKHEAELIEEFFGNGQYHNALRMCIFQRDYFAAQPGAELHARE
>NZ_CP004042.1|WP_004524602.1|3951293_3951464_+|hypothetical-protein
MIEQVILGVFLVLPLLIVAVLYSDELWQEHRLQHPRDEHTPHIDWRHPWRILRRGH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP004042_1	1.2\|3881424\|19\|NZ_CP004042\|CRISPRCasFinder	3881424-3881442	19	NZ_CP004043.1	3007271-3007289	0	1.0
NZ_CP004042_1	1.2\|3881424\|19\|NZ_CP004042\|CRISPRCasFinder	3881424-3881442	19	NZ_CP004043.1	3007278-3007296	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2229166-2229184	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2317515-2317533	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2317522-2317540	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783159-2783177	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783179-2783197	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783186-2783204	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783206-2783224	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783213-2783231	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783220-2783238	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783227-2783245	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783234-2783252	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783241-2783259	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783248-2783266	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783255-2783273	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783262-2783280	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783269-2783287	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783276-2783294	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783283-2783301	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783290-2783308	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783297-2783315	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783304-2783322	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783311-2783329	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783318-2783336	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783325-2783343	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783332-2783350	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	3881494-3881512	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	3881501-3881519	0	1.0
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	72309-72327	1	0.947
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2229159-2229177	1	0.947
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2229173-2229191	1	0.947
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2283237-2283255	1	0.947
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783103-2783121	1	0.947
NZ_CP004042_1	1.2\|3881424\|19\|NZ_CP004042\|CRISPRCasFinder	3881424-3881442	19	NZ_CP004042.1	3518051-3518069	2	0.895
NZ_CP004042_1	1.2\|3881424\|19\|NZ_CP004042\|CRISPRCasFinder	3881424-3881442	19	NZ_CP004042.1	2362183-2362201	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	59458-59476	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	2229152-2229170	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004043.1	268016-268034	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	147206-147224	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	357961-357979	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783082-2783100	2	0.895
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NZ_CP004042.1	2783110-2783128	2	0.895

1. spacer 1.2|3881424|19|NZ_CP004042|CRISPRCasFinder matches to position: 3007271-3007289, mismatch: 0, identity: 1.0

gttgtgcgttgtgcgttgt	CRISPR spacer
gttgtgcgttgtgcgttgt	Protospacer
*******************

2. spacer 1.2|3881424|19|NZ_CP004042|CRISPRCasFinder matches to position: 3007278-3007296, mismatch: 0, identity: 1.0

gttgtgcgttgtgcgttgt	CRISPR spacer
gttgtgcgttgtgcgttgt	Protospacer
*******************

3. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2229166-2229184, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

4. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2317515-2317533, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

5. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2317522-2317540, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

6. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783159-2783177, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

7. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783179-2783197, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

8. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783186-2783204, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

9. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783206-2783224, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

10. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783213-2783231, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

11. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783220-2783238, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

12. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783227-2783245, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

13. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783234-2783252, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

14. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783241-2783259, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

15. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783248-2783266, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

16. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783255-2783273, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

17. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783262-2783280, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

18. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783269-2783287, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

19. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783276-2783294, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

20. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783283-2783301, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

21. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783290-2783308, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

22. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783297-2783315, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

23. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783304-2783322, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

24. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783311-2783329, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

25. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783318-2783336, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

26. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783325-2783343, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

27. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783332-2783350, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

28. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 3881494-3881512, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

29. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 3881501-3881519, mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

30. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 72309-72327, mismatch: 1, identity: 0.947

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgcgcgtcgg	Protospacer
*********** *******

31. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2229159-2229177, mismatch: 1, identity: 0.947

gtcgggcgtcgggcgtcgg	CRISPR spacer
gttgggcgtcgggcgtcgg	Protospacer
**.****************

32. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2229173-2229191, mismatch: 1, identity: 0.947

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcggacgtcgg	Protospacer
************.******

33. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2283237-2283255, mismatch: 1, identity: 0.947

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgccgggcgtcgg	Protospacer
********.**********

34. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783103-2783121, mismatch: 1, identity: 0.947

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcatcgg	Protospacer
**************.****

35. spacer 1.2|3881424|19|NZ_CP004042|CRISPRCasFinder matches to position: 3518051-3518069, mismatch: 2, identity: 0.895

gttgtgcgttgtgcgttgt	CRISPR spacer
gttgtgcgtcgtgcgtcgt	Protospacer
*********.******.**

36. spacer 1.2|3881424|19|NZ_CP004042|CRISPRCasFinder matches to position: 2362183-2362201, mismatch: 2, identity: 0.895

gttgtgcgttgtgcgttgt	CRISPR spacer
gtagtgcgttatgcgttgt	Protospacer
** *******.********

37. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 59458-59476, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgacgggcgccgg	Protospacer
******** ******.***

38. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2229152-2229170, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gttgggcgttgggcgtcgg	Protospacer
**.******.*********

39. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 268016-268034, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgttgggcgttgg	Protospacer
*********.******.**

40. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 147206-147224, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtgggccgtcgggcgtcgg	Protospacer
** ** *************

41. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 357961-357979, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgtgcgtcgtgcgtcgg	Protospacer
**** ****** *******

42. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783082-2783100, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcatcgggcatcgg	Protospacer
*******.******.****

43. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to position: 2783110-2783128, mismatch: 2, identity: 0.895

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcatcgggcatcgg	Protospacer
*******.******.****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP004042_1	1.3\|3881466\|19\|NZ_CP004042\|CRISPRCasFinder	3881466-3881484	19	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	279064-279082	0	1.0

1. spacer 1.3|3881466|19|NZ_CP004042|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgggcgtcgggcgtcgg	CRISPR spacer
gtcgggcgtcgggcgtcgg	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

85320 : 96548

Burkholderia_virus(22.22%)

integrase

attL 82734:82751|attR 99327:99344

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
82734:82751	attL	NA	NA	NA	NA
WP_038722961.1\|85320_87408_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	3.2e-99	35.8
WP_004202928.1\|87730_88630_-	c-type cytochrome	NA	NA	NA	NA
WP_004553012.1\|89812_90400_+\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	9.1e-44	50.0
WP_024430280.1\|90779_91097_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	3.7e-15	57.0
WP_004530410.1\|91096_92014_+	DUF4935 domain-containing protein	A4PE40	Ralstonia_virus	4.0e-46	40.6
WP_009922654.1\|92267_92810_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.3e-48	56.4
WP_009932249.1\|93067_93520_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.3e-31	58.8
WP_038723776.1\|93519_94599_+	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	1.4e-159	98.3
WP_004525721.1\|94755_95004_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.0e-41	97.6
WP_004195754.1\|95903_96548_+	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	5.7e-07	30.4
99327:99344	attR	NA	NA	NA	NA

DBSCAN-SWA_2

276085 : 328977

Burkholderia_phage(33.33%)

protease,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196743.1\|276085_276799_+\|transposase	transposase	NA	NA	NA	NA
WP_011852289.1\|277089_281793_+	glutamate synthase subunit alpha	NA	NA	NA	NA
WP_004521924.1\|281886_283353_+	glutamate synthase subunit beta	NA	NA	NA	NA
WP_004521925.1\|283633_285145_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_004521926.1\|285141_285702_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_004527892.1\|285899_287666_-	ABC transporter ATP-binding protein/permease	NA	NA	NA	NA
WP_004521927.1\|288268_289402_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004521928.1\|289450_289648_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_004199935.1\|289700_290516_+	thiazole synthase	NA	NA	NA	NA
WP_004521929.1\|290512_291616_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_004521930.1\|291715_292534_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-20	29.4
WP_004199929.1\|292530_293298_+	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
WP_004521931.1\|293310_293886_+	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_004521932.1\|293933_294893_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_004521933.1\|295007_295640_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004199923.1\|295636_295906_+	STAS domain-containing protein	NA	NA	NA	NA
WP_004554063.1\|296201_297128_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-21	29.7
WP_004199919.1\|297124_297880_+	ABC transporter permease	NA	NA	NA	NA
WP_004199917.1\|297965_298205_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_004521935.1\|298218_299568_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_038722992.1\|299564_300221_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_004527888.1\|300262_301600_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_004521936.1\|301755_302826_+	histidinol-phosphate transaminase	A0A1X7BZP2	Faustovirus	5.6e-15	26.9
WP_004199911.1\|302889_303477_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_004199909.1\|303532_304153_+	YchE family NAAT transporter	NA	NA	NA	NA
WP_004199907.1\|304149_304791_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_004199906.1\|304958_305714_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_004557290.1\|305796_306570_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_004201279.1\|306569_306983_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_004202813.1\|306979_307348_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
WP_004202812.1\|307400_307790_+	hypothetical protein	NA	NA	NA	NA
WP_004185206.1\|307818_308184_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_038722994.1\|308272_308506_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_004531855.1\|308532_309060_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_004199900.1\|309098_309881_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	8.7e-26	29.7
WP_038722996.1\|310225_311434_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	8.5e-12	31.9
WP_004202811.1\|311455_312202_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_004204996.1\|312422_313043_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_004199894.1\|313043_314426_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_004521940.1\|314448_315207_+	cytochrome c1	NA	NA	NA	NA
WP_004185176.1\|315299_315911_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_004199890.1\|315980_316502_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
WP_038723778.1\|317195_317522_+\|plate	baseplate assembly protein	K4NZR5	Burkholderia_phage	3.3e-51	98.1
WP_076882245.1\|317823_318426_+	site-specific DNA-methyltransferase	K4NZW3	Burkholderia_phage	1.9e-81	88.5
WP_111952238.1\|318822_319413_+	hypothetical protein	NA	NA	NA	NA
WP_009922432.1\|319516_319882_-	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	1.1e-52	89.3
WP_004521948.1\|319983_320769_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_038722998.1\|320765_322112_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_038723000.1\|322220_322835_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004531875.1\|323209_323881_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004521952.1\|323917_324436_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004521953.1\|324452_325943_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004527837.1\|326015_326519_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004204912.1\|326576_327059_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_038723001.1\|327138_328977_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_3

657861 : 667106

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194034.1\|657861_659814_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004522147.1\|660080_661211_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.6
WP_038723056.1\|661244_663251_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	1.9e-53	35.0
WP_004194137.1\|663434_664250_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004532195.1\|664314_664998_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_004194373.1\|664994_665522_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004522151.1\|665558_667106_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2

DBSCAN-SWA_4

1002687 : 1011570

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522358.1\|1002687_1004088_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-79	38.5
WP_009921652.1\|1004119_1005043_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.1
WP_004190173.1\|1005101_1006094_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004189725.1\|1006165_1006483_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_004532363.1\|1006864_1007767_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.9e-53	39.9
WP_038723131.1\|1007993_1009283_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004188957.1\|1009461_1010385_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_063831528.1\|1010727_1011570_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	7.2e-18	27.2

DBSCAN-SWA_5

1309339 : 1319630

Burkholderia_phage(33.33%)

lysis,integrase

attL 1306540:1306555|attR 1315710:1315725

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1306540:1306555	attL	NA	NA	NA	NA
WP_038723190.1\|1309339_1312024_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	9.3e-27	24.3
WP_038723191.1\|1312183_1313485_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	6.1e-149	58.9
WP_009890227.1\|1313435_1313678_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	9.3e-19	59.2
WP_038723806.1\|1313686_1314160_-	hypothetical protein	B5TA88	Burkholderia_phage	3.0e-05	71.4
WP_038723193.1\|1314168_1314498_-	hypothetical protein	NA	NA	NA	NA
WP_038723808.1\|1315508_1316054_+\|lysis	lysis protein	Q8W6S5	Burkholderia_virus	4.1e-83	96.1
1315710:1315725	attR	NA	NA	NA	NA
WP_038723194.1\|1316197_1316986_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.0e-151	97.3
WP_004539736.1\|1317026_1317737_-	immunity 52 family protein	A4PE26	Ralstonia_virus	1.4e-38	41.5
WP_172644489.1\|1317748_1318417_-	hypothetical protein	NA	NA	NA	NA
WP_080278160.1\|1318701_1319208_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.3e-18	39.7
WP_004539640.1\|1319204_1319630_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	4.9e-15	49.4

DBSCAN-SWA_6

1533475 : 1541663

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196630.1\|1533475_1533739_+	hypothetical protein	Q8W6S4	Burkholderia_virus	2.2e-26	85.5
WP_076804731.1\|1533722_1533908_+	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2
WP_038723235.1\|1533928_1534654_-	immunity 52 family protein	A4PE26	Ralstonia_virus	5.8e-32	44.0
WP_038763587.1\|1534660_1535263_-	hypothetical protein	NA	NA	NA	NA
WP_063832618.1\|1535604_1536111_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.0e-19	40.1
WP_012729878.1\|1536107_1536530_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	4.9e-15	49.4
WP_004557051.1\|1536810_1537206_-	hypothetical protein	NA	NA	NA	NA
WP_004531416.1\|1537459_1537687_+	hypothetical protein	Q8W6S4	Burkholderia_virus	3.8e-22	75.8
WP_004521250.1\|1537722_1537971_-	immunity 52 family protein	A4PE26	Ralstonia_virus	4.6e-13	60.6
WP_004550288.1\|1538031_1538493_-	avidin	NA	NA	NA	NA
WP_004534930.1\|1539426_1539609_+	hypothetical protein	NA	NA	NA	NA
WP_004193371.1\|1539735_1540359_-	phospholipase D family protein	NA	NA	NA	NA
WP_004192901.1\|1540553_1541663_-	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	7.8e-36	31.0

DBSCAN-SWA_7

2320968 : 2393660

Klosneuvirus(14.29%)

tRNA,plate,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004542503.1\|2320968_2323593_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.5e-80	39.2
WP_038723393.1\|2324119_2325340_+	CoA transferase	NA	NA	NA	NA
WP_004196731.1\|2325675_2325915_-	hypothetical protein	NA	NA	NA	NA
WP_004193654.1\|2326164_2327874_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	8.8e-188	57.5
WP_004552886.1\|2328217_2328700_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	1.7e-19	41.3
WP_004545113.1\|2328718_2329105_-	hypothetical protein	NA	NA	NA	NA
WP_012730066.1\|2329392_2331492_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_004521728.1\|2331593_2332454_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_028359092.1\|2332497_2333931_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_004193177.1\|2334164_2335748_+	acid phosphatase	NA	NA	NA	NA
WP_004538373.1\|2335945_2337139_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_038723394.1\|2337762_2338950_+	HlyD family secretion protein	NA	NA	NA	NA
WP_038723395.1\|2339131_2340751_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_038723396.1\|2340752_2342462_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004192810.1\|2342764_2343397_-	response regulator transcription factor	NA	NA	NA	NA
WP_038723397.1\|2343397_2345479_-	response regulator	A0A1V0SGR3	Hokovirus	1.7e-12	26.8
WP_004196717.1\|2345889_2346855_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_038723398.1\|2346870_2349282_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_038723400.1\|2349326_2350166_-	molecular chaperone	NA	NA	NA	NA
WP_004526783.1\|2350183_2350708_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004526782.1\|2350784_2351345_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004538378.1\|2351397_2351943_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004531175.1\|2352203_2352425_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|2352770_2353664_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038723401.1\|2354107_2355367_+	MFS transporter	NA	NA	NA	NA
WP_038723402.1\|2355411_2356395_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004193855.1\|2356862_2357144_+	H-NS histone family protein	NA	NA	NA	NA
WP_009927991.1\|2357406_2357679_-	hypothetical protein	NA	NA	NA	NA
WP_004554454.1\|2358572_2359886_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_038723403.1\|2360145_2361066_-	hypothetical protein	NA	NA	NA	NA
WP_071897650.1\|2361725_2362220_-	hypothetical protein	NA	NA	NA	NA
WP_052139777.1\|2363294_2363741_-	hypothetical protein	NA	NA	NA	NA
WP_038723406.1\|2364022_2364283_-	hypothetical protein	NA	NA	NA	NA
WP_009951519.1\|2364497_2364665_+	hypothetical protein	A0A0P0ZBS5	Stx2-converting_phage	9.5e-07	50.0
WP_076851597.1\|2365237_2365951_-	hypothetical protein	NA	NA	NA	NA
WP_076882428.1\|2366873_2367167_-	hypothetical protein	NA	NA	NA	NA
WP_004526764.1\|2367507_2367753_-	hypothetical protein	NA	NA	NA	NA
WP_128972818.1\|2367796_2368705_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_004526762.1\|2368662_2368914_-	DUF1153 domain-containing protein	NA	NA	NA	NA
WP_004545145.1\|2369044_2369965_-	hypothetical protein	NA	NA	NA	NA
WP_038723408.1\|2370082_2372926_-	hypothetical protein	NA	NA	NA	NA
WP_038723410.1\|2372922_2373798_-	hypothetical protein	NA	NA	NA	NA
WP_038723411.1\|2373799_2376640_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.8e-21	25.9
WP_004521762.1\|2376652_2376958_-	hypothetical protein	NA	NA	NA	NA
WP_021251390.1\|2376975_2377218_-	hypothetical protein	NA	NA	NA	NA
WP_004521767.1\|2378307_2378799_-	lipoprotein	NA	NA	NA	NA
WP_009973662.1\|2378776_2382112_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_038723412.1\|2382220_2384629_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_009943538.1\|2384625_2385219_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_038723414.1\|2385215_2385773_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_012730392.1\|2385909_2386743_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_038723415.1\|2386745_2389556_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.7e-27	25.0
WP_004521773.1\|2389589_2389817_+	hypothetical protein	NA	NA	NA	NA
WP_009920929.1\|2390076_2390343_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_004521774.1\|2390366_2391782_+	hypothetical protein	NA	NA	NA	NA
WP_004542513.1\|2391809_2393660_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_8

2443602 : 2522377

Burkholderia_virus(91.43%)

tail,integrase,terminase,capsid,portal,holin,lysis,head

attL 2463616:2463664|attR 2522507:2522555

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038723436.1\|2443602_2443848_+\|integrase	tyrosine-type recombinase/integrase	A4PE72	Ralstonia_virus	3.2e-19	73.2
WP_038718123.1\|2448010_2448271_-	hypothetical protein	NA	NA	NA	NA
WP_038718126.1\|2448381_2448600_-	hypothetical protein	NA	NA	NA	NA
WP_128972816.1\|2449309_2449855_-	hypothetical protein	NA	NA	NA	NA
WP_009970413.1\|2449966_2450557_-	recombinase family protein	E5FFF9	Burkholderia_phage	7.5e-22	41.1
WP_009970412.1\|2451120_2451939_+	hypothetical protein	NA	NA	NA	NA
WP_128972815.1\|2452111_2452903_+	hypothetical protein	NA	NA	NA	NA
WP_004521810.1\|2453624_2454455_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_004521811.1\|2455002_2455911_+	aldose 1-epimerase	NA	NA	NA	NA
WP_038723439.1\|2456207_2456909_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	1.4e-11	39.3
WP_004531123.1\|2456986_2457160_-	hypothetical protein	NA	NA	NA	NA
WP_004192280.1\|2457171_2457285_-	hypothetical protein	NA	NA	NA	NA
WP_004193897.1\|2457264_2458890_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.3e-68	35.4
WP_004192567.1\|2459154_2459472_+	DUF2288 domain-containing protein	NA	NA	NA	NA
WP_004531119.1\|2459479_2460871_+	MATE family efflux transporter	NA	NA	NA	NA
WP_004531118.1\|2461132_2461324_-	lipoprotein	NA	NA	NA	NA
WP_004191316.1\|2461491_2461662_+	hypothetical protein	NA	NA	NA	NA
WP_004266561.1\|2461994_2462813_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004550641.1\|2462964_2463423_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
2463616:2463664	attL	NA	NA	NA	NA
WP_038723840.1\|2463861_2464533_-	SOS response-associated peptidase family protein	Q8W6R8	Burkholderia_virus	5.9e-132	96.4
WP_038723440.1\|2464618_2465260_+	hypothetical protein	Q8W6R9	Burkholderia_virus	1.2e-118	99.5
WP_038723441.1\|2465392_2466484_-	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	7.2e-212	99.4
WP_004552924.1\|2466511_2467246_-	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	3.6e-138	100.0
WP_076882068.1\|2467242_2467803_-	PAAR domain-containing protein	A4JX23	Burkholderia_virus	1.8e-102	98.9
WP_038723442.1\|2467984_2468911_-	hypothetical protein	C7BGE2	Burkholderia_phage	3.0e-73	53.9
WP_038723443.1\|2469019_2469808_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	5.5e-153	97.7
WP_038723444.1\|2469950_2470496_-\|lysis	lysis protein	A4JX21	Burkholderia_virus	1.7e-76	87.8
WP_038723445.1\|2470495_2470987_-	lysozyme	Q6JIK8	Burkholderia_virus	2.1e-86	96.9
WP_004552929.1\|2470979_2471192_-\|holin	class II holin gp23	Q8W6S7	Burkholderia_virus	6.6e-29	100.0
WP_038723446.1\|2471234_2471978_-	hypothetical protein	Q8W6S8	Burkholderia_virus	2.1e-101	71.6
WP_080278171.1\|2471977_2472244_-	hypothetical protein	Q8W6S9	Burkholderia_virus	2.4e-36	75.0
WP_038723447.1\|2472282_2475594_-\|tail	phage tail protein	Q6JIL2	Burkholderia_virus	0.0e+00	98.0
WP_004526680.1\|2475590_2476175_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	6.8e-100	99.5
WP_038723448.1\|2476171_2476924_-	C40 family peptidase	Q6JIL4	Burkholderia_virus	8.7e-148	98.4
WP_004549626.1\|2476973_2477657_-\|tail	phage minor tail protein L	Q8W6T3	Burkholderia_virus	3.7e-129	96.0
WP_038723450.1\|2477653_2479042_-\|tail	tail fiber domain-containing protein	Q6JIL6	Burkholderia_virus	7.0e-260	94.4
WP_004548805.1\|2479050_2479389_-\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	8.0e-61	100.0
WP_038723451.1\|2479385_2483450_-\|tail	phage tail tape measure protein	Q6JIL8	Burkholderia_virus	0.0e+00	99.7
WP_004526674.1\|2483463_2483748_-	DUF4035 domain-containing protein	Q6JIL9	Burkholderia_virus	6.8e-45	100.0
WP_004548907.1\|2483747_2484212_-\|tail	tail assembly protein	A4JX08	Burkholderia_virus	2.4e-84	100.0
WP_004549350.1\|2484238_2484694_-	hypothetical protein	A4JX07	Burkholderia_virus	7.5e-78	100.0
WP_015984957.1\|2484755_2485103_-	hypothetical protein	A4JX06	Burkholderia_virus	3.5e-59	100.0
WP_024429290.1\|2485099_2485522_-	HK97 gp10 family phage protein	A4JX05	Burkholderia_virus	1.0e-68	99.3
WP_024429289.1\|2485514_2485841_-\|head	phage head closure protein	A4JX04	Burkholderia_virus	1.8e-49	87.0
WP_038723452.1\|2485840_2486407_-	hypothetical protein	A4JX03	Burkholderia_virus	1.6e-74	71.8
WP_024429287.1\|2486413_2486599_-	hypothetical protein	A4JX02	Burkholderia_virus	6.2e-15	62.3
WP_038723454.1\|2486659_2487967_-\|capsid	phage major capsid protein	A4JX01	Burkholderia_virus	1.3e-194	82.5
WP_038723455.1\|2488068_2489037_-	S49 family peptidase	A4JX00	Burkholderia_virus	5.0e-164	96.9
WP_038723456.1\|2489033_2490293_-\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	2.5e-240	99.5
WP_015984952.1\|2490297_2490483_-	hypothetical protein	A4JWZ8	Burkholderia_virus	2.0e-21	100.0
WP_038723457.1\|2490479_2492195_-\|terminase	terminase large subunit	A4JWZ7	Burkholderia_virus	0.0e+00	99.8
WP_004549538.1\|2492198_2492675_-\|terminase	phage terminase small subunit P27 family	A4JWZ6	Burkholderia_virus	2.1e-86	99.4
WP_004548856.1\|2492826_2493183_-	HNH endonuclease	Q8W6N0	Burkholderia_virus	3.3e-65	100.0
WP_004549735.1\|2493241_2493499_+	type II toxin-antitoxin system RelE/ParE family toxin	Q8W6N1	Burkholderia_virus	2.4e-41	100.0
WP_004548635.1\|2493495_2493882_+	helix-turn-helix transcriptional regulator	Q8W6N2	Burkholderia_virus	1.4e-64	99.2
WP_080278149.1\|2494477_2495461_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_076882155.1\|2495958_2497125_+	hypothetical protein	NA	NA	NA	NA
WP_080278150.1\|2497060_2498815_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_076882153.1\|2498790_2499276_+	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_038723459.1\|2499613_2500261_-	hypothetical protein	Q8W6N4	Burkholderia_virus	3.3e-103	90.7
WP_038723461.1\|2500840_2501266_-	DUF1364 family protein	Q6JIF7	Burkholderia_virus	1.3e-79	99.3
WP_038723462.1\|2501262_2501637_-	hypothetical protein	Q6JIF8	Burkholderia_virus	2.1e-62	98.4
WP_172644498.1\|2501633_2502101_-	DUF1064 domain-containing protein	Q6JIF9	Burkholderia_virus	2.9e-77	91.6
WP_038723465.1\|2502145_2503138_-	hypothetical protein	A4JX55	Burkholderia_virus	3.4e-176	99.1
WP_004526650.1\|2503291_2503552_-	helix-turn-helix domain-containing protein	Q6JIG2	Burkholderia_virus	4.2e-41	100.0
WP_038723466.1\|2503548_2504370_-	hypothetical protein	Q8W6P2	Burkholderia_virus	2.3e-146	99.6
WP_024429365.1\|2504404_2505367_-	phosphoadenosine phosphosulfate reductase family protein	A9YWY5	Burkholderia_phage	3.5e-170	99.3
WP_024429366.1\|2505804_2506119_+	DUF4145 domain-containing protein	A4JX50	Burkholderia_virus	1.6e-50	98.1
WP_038723467.1\|2506265_2506706_-	phage regulatory CII family protein	Q8W6P5	Burkholderia_virus	9.4e-70	90.4
WP_021251775.1\|2506891_2507146_+	hypothetical protein	Q8W6P6	Burkholderia_virus	9.4e-38	98.8
WP_038764272.1\|2507375_2507708_-	hypothetical protein	Q6JIG8	Burkholderia_virus	8.4e-55	96.4
WP_004552953.1\|2507824_2508139_-	helix-turn-helix domain-containing protein	Q6JIG9	Burkholderia_virus	3.0e-54	100.0
WP_004552954.1\|2508382_2508604_+	hypothetical protein	Q6JIH0	Burkholderia_virus	3.3e-31	98.6
WP_038723468.1\|2508600_2508864_-	hypothetical protein	Q6JIH1	Burkholderia_virus	3.2e-41	98.9
WP_004552955.1\|2508947_2510237_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.5e-235	100.0
WP_004526641.1\|2510391_2511285_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.3e-170	99.3
WP_038723469.1\|2511786_2512062_+	hypothetical protein	Q8W6Q1	Burkholderia_virus	2.3e-42	97.8
WP_038723472.1\|2512415_2513030_-	hypothetical protein	NA	NA	NA	NA
WP_172644481.1\|2513110_2513428_+	hypothetical protein	Q6JII2	Burkholderia_virus	2.5e-48	97.1
WP_038723473.1\|2513424_2514237_+	prohibitin family protein	Q8W6Q7	Burkholderia_virus	2.2e-144	98.9
WP_038723475.1\|2514510_2515218_+	hypothetical protein	Q6JII4	Burkholderia_virus	7.2e-120	91.1
WP_038717937.1\|2515231_2515903_+	hypothetical protein	Q6JII5	Burkholderia_virus	7.5e-119	96.4
WP_080124839.1\|2516163_2516382_+	hypothetical protein	Q6JII7	Burkholderia_virus	1.0e-32	98.6
WP_004526632.1\|2517586_2517844_+	hypothetical protein	Q6JIJ0	Burkholderia_virus	1.7e-42	100.0
WP_015973597.1\|2517836_2518079_+	hypothetical protein	Q6JIJ1	Burkholderia_virus	1.9e-40	100.0
WP_038725203.1\|2518068_2518407_+	hypothetical protein	Q6JIJ2	Burkholderia_virus	2.9e-58	98.2
WP_038723477.1\|2518403_2519351_+	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	1.9e-107	62.3
WP_038723479.1\|2519341_2519584_-	hypothetical protein	NA	NA	NA	NA
WP_038723481.1\|2519970_2520240_-	hypothetical protein	NA	NA	NA	NA
WP_038723482.1\|2520491_2520701_-	hypothetical protein	Q6JIJ5	Burkholderia_virus	2.4e-31	91.3
WP_004526625.1\|2521052_2521277_+	DUF4224 domain-containing protein	Q6JIJ7	Burkholderia_virus	2.9e-35	100.0
WP_004526624.1\|2521276_2522377_+\|integrase	tyrosine-type recombinase/integrase	Q6JIJ8	Burkholderia_virus	5.4e-215	100.0
2522507:2522555	attR	NA	NA	NA	NA

DBSCAN-SWA_9

3075710 : 3086674

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196461.1\|3075710_3078011_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1
WP_004194131.1\|3078007_3078322_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|3078854_3079058_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_038723578.1\|3079187_3080804_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_004189626.1\|3080816_3080999_+	hypothetical protein	NA	NA	NA	NA
WP_004189552.1\|3080971_3082231_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189780.1\|3082498_3083077_+	pseudouridine synthase	NA	NA	NA	NA
WP_071810810.1\|3083339_3083558_+	hypothetical protein	NA	NA	NA	NA
WP_004185496.1\|3083749_3084259_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_004197486.1\|3084559_3086674_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7

DBSCAN-SWA_10

3927087 : 3977296

Leptospira_phage(23.08%)

tRNA,portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038802333.1\|3927087_3928208_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_076848512.1\|3928671_3929211_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_041190526.1\|3930074_3930383_-	hypothetical protein	NA	NA	NA	NA
WP_128972475.1\|3930477_3931251_+	hypothetical protein	NA	NA	NA	NA
WP_038723739.1\|3931955_3932960_+	SIR2 family protein	NA	NA	NA	NA
WP_004525845.1\|3933493_3933976_+	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_004523107.1\|3933972_3934257_+	hypothetical protein	NA	NA	NA	NA
WP_038723740.1\|3934330_3935422_-\|portal	phage portal protein	K4NZV0	Burkholderia_phage	6.8e-194	92.6
WP_038723741.1\|3935820_3936285_+	hypothetical protein	NA	NA	NA	NA
WP_038723742.1\|3936422_3937298_-	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	4.8e-73	47.0
WP_038723743.1\|3937308_3938421_-	histone deacetylase	A0A2K9KZC4	Tupanvirus	3.2e-37	30.8
WP_038723744.1\|3938449_3939544_-	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038723745.1\|3939686_3940655_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038723746.1\|3940757_3941327_+	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_004525837.1\|3941919_3942468_+	hypothetical protein	NA	NA	NA	NA
WP_038723747.1\|3942731_3944180_+	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	3.7e-30	33.5
WP_038723748.1\|3944198_3945812_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_038723749.1\|3945970_3946912_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004523120.1\|3946908_3948003_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.0e-19	37.4
WP_004197761.1\|3948404_3948821_+	VOC family protein	NA	NA	NA	NA
WP_004530511.1\|3948968_3949523_-	YaeQ family protein	NA	NA	NA	NA
WP_004525830.1\|3949738_3950086_-	hypothetical protein	NA	NA	NA	NA
WP_004524603.1\|3950571_3951132_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_004524602.1\|3951293_3951464_+	hypothetical protein	NA	NA	NA	NA
WP_004553738.1\|3951810_3951966_-	hypothetical protein	NA	NA	NA	NA
WP_004538579.1\|3952028_3953186_-	DUF4382 domain-containing protein	NA	NA	NA	NA
WP_004535567.1\|3953751_3954486_+	hypothetical protein	NA	NA	NA	NA
WP_004524586.1\|3954677_3956081_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_004198812.1\|3956418_3956838_+	transcriptional regulator	NA	NA	NA	NA
WP_004524584.1\|3956994_3958671_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_009917973.1\|3958679_3958985_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.9e-16	53.6
WP_038723750.1\|3959028_3959496_-	ribonuclease P protein component	NA	NA	NA	NA
WP_004198824.1\|3959512_3959647_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_076882226.1\|3959939_3961694_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_004196275.1\|3961856_3962960_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.7e-46	34.0
WP_004196276.1\|3963148_3965617_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.3e-114	34.4
WP_128972801.1\|3965862_3966363_+	hypothetical protein	NA	NA	NA	NA
WP_038723753.1\|3966531_3967173_+	hypothetical protein	NA	NA	NA	NA
WP_076861393.1\|3967166_3968303_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_076882227.1\|3968605_3969076_-	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	4.4e-41	59.7
WP_038723754.1\|3969076_3970735_-	DUF2357 domain-containing protein	NA	NA	NA	NA
WP_038723755.1\|3970738_3972391_-	hypothetical protein	NA	NA	NA	NA
WP_038723756.1\|3972356_3973865_-	DNA cytosine methyltransferase	M1PSQ0	Streptococcus_phage	1.7e-25	26.1
WP_076861389.1\|3973857_3974079_-	CopG family transcriptional regulator	NA	NA	NA	NA
WP_076861387.1\|3974764_3975145_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038723881.1\|3975224_3975485_-\|transposase	transposase	S5WIU1	Leptospira_phage	1.3e-23	58.5
WP_076883614.1\|3975500_3976025_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-24	38.2
WP_004538383.1\|3976063_3976264_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_038723757.1\|3976276_3977296_+\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP004042.1|WP_004526764.1|2367507_2367753_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP004042.1|WP_004526764.1|2367507_2367753_-|hypothetical-protein

2367507_2367753_-

81 aa aa

2320968-2393660

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP004042_1	Orphan	1.2\|3881424\|19\|NZ_CP004042\|CRISPRCasFinder	3881424-3881442	19	2362201-2362183	2

1. spacer 1.2|3881424|19|NZ_CP004042|CRISPRCasFinder matches to NZ_CP004042 position: 2362201-2362183, mismatch: 2

gttgtgcgttgtgcgttgt	CRISPR spacer
gtagtgcgttatgcgttgt	Protospacer
** *******.********

2. NZ_CP004043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP004043_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004043_1

100041-100147

Orphan

Consensus_repeat	Method
GGCAACGGCAACGGCAACGGCAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP004043_1

>merge|NZ_CP004043|1|100041-100147|CRISPRCasFinder
CGCTACCGCTACCGCCACGGCATCGACATCGACATCGACTCTGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAA

>NZ_CP004043|1|1|100041-100147|CRISPRCasFinder
CGCTACCGCTACCGCCACGGCAT	CGACATCGACATCGACTCT
GGCAACGGCAACGGCAACGGCAA	CGGCAACGGCAACGGCAAC
GGCAACGGCAACGGCAACGGCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004043.1\|WP_004188088.1\|113799_113970_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004187213.1\|91224_91920_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP004043.1\|WP_076882138.1\|96437_99623_-\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP004043.1\|WP_004187391.1\|93692_93848_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004548845.1\|110372_110762_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP004043.1\|WP_004188306.1\|94873_95353_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP004043.1\|WP_004533766.1\|89046_89928_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP004043.1\|WP_004188004.1\|103305_103464_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_041199018.1\|103463_107408_+\|DUF748-domain-containing-protein	unknown	unknown	gnl\|CDD\|377502
NZ_CP004043.1\|WP_041199015.1\|90010_91114_-\|AGE-family-epimerase/isomerase	unknown	unknown	gnl\|CDD\|238153
NZ_CP004043.1\|WP_038770310.1\|101887_103309_+\|DUF1254-domain-containing-protein	unknown	unknown	gnl\|CDD\|227659
NZ_CP004043.1\|WP_041199016.1\|91993_93496_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
NZ_CP004043.1\|WP_004554743.1\|111363_112413_+\|squalene/phytoene-synthase-family-protein	unknown	unknown	gnl\|CDD\|366130
NZ_CP004043.1\|WP_004541513.1\|107519_107741_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004523495.1\|113264_113459_+\|YqaE/Pmp3-family-membrane-protein	unknown	unknown	gnl\|CDD\|376592
NZ_CP004043.1\|WP_004188119.1\|110889_111183_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_041199014.1\|87283_89011_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP004043.1\|WP_172644508.1\|94232_94631_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004533853.1\|108108_109770_-\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|224441
NZ_CP004043.1\|WP_004188671.1\|95555_95999_-\|DUF4087-domain-containing-protein	unknown	unknown	gnl\|CDD\|372559

Protein	Function_ID	Function_description	E-value
NZ_CP004043.1\|WP_004187213.1\|91224_91920_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	5.91881e-51
NZ_CP004043.1\|WP_076882138.1\|96437_99623_-\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP004043.1\|WP_004548845.1\|110372_110762_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	2.53973e-11
NZ_CP004043.1\|WP_004188306.1\|94873_95353_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.76845e-14
NZ_CP004043.1\|WP_038770310.1\|101887_103309_+\|DUF1254-domain-containing-protein	gnl\|CDD\|227659	COG5361, COG5361, Uncharacterized conserved protein [Function unknown].	2.69694e-51
NZ_CP004043.1\|WP_004554743.1\|111363_112413_+\|squalene/phytoene-synthase-family-protein	gnl\|CDD\|366130	pfam00494, SQS_PSY, Squalene/phytoene synthase.	2.12321e-57
NZ_CP004043.1\|WP_041199018.1\|103463_107408_+\|DUF748-domain-containing-protein	gnl\|CDD\|377502	pfam05359, DUF748, Domain of Unknown Function (DUF748).	1.77254e-33
NZ_CP004043.1\|WP_041199015.1\|90010_91114_-\|AGE-family-epimerase/isomerase	gnl\|CDD\|238153	cd00249, AGE, AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid. Catalytic mechanism is believed to be via nucleotide elimination and readdition and is ATP modulated. AGE is structurally and mechanistically distinct from the other four types of epimerases. The AGE domain monomer is composed of an alpha(6)/alpha(6)-barrel, the structure of which is also found in glucoamylase and cellulase. The active form is a homodimer. The alignment also contains subtype III mannose 6-phosphate isomerases.	2.71196e-51
NZ_CP004043.1\|WP_004533766.1\|89046_89928_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	8.68692e-40
NZ_CP004043.1\|WP_041199016.1\|91993_93496_+\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	1.34179e-06
NZ_CP004043.1\|WP_004523495.1\|113264_113459_+\|YqaE/Pmp3-family-membrane-protein	gnl\|CDD\|376592	pfam01679, Pmp3, Proteolipid membrane potential modulator. Pmp3 is an evolutionarily conserved proteolipid in the plasma membrane which, in S. pombe, is transcriptionally regulated by the Spc1 stress MAPK (mitogen-activated protein kinases) pathway. It functions to modulate the membrane potential, particularly to resist high cellular cation concentration. In eukaryotic organisms, stress-activated mitogen-activated protein kinases play crucial roles in transmitting environmental signals that will regulate gene expression for allowing the cell to adapt to cellular stress. Pmp3-like proteins are highly conserved in bacteria, yeast, nematode and plants.	0.00193796
NZ_CP004043.1\|WP_041199014.1\|87283_89011_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.11367e-53
NZ_CP004043.1\|WP_004533853.1\|108108_109770_-\|alkaline-phosphatase-family-protein	gnl\|CDD\|224441	COG1524, COG1524, Uncharacterized proteins of the AP superfamily [General function prediction only].	5.44121e-12
NZ_CP004043.1\|WP_004188671.1\|95555_95999_-\|DUF4087-domain-containing-protein	gnl\|CDD\|372559	pfam13316, DUF4087, Protein of unknown function (DUF4087). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 140 and 280 amino acids in length. There is a conserved RCGW sequence motif.	6.84959e-55

>NZ_CP004043.1|WP_076882138.1|96437_99623_-|heavy-metal-translocating-P-type-ATPase
MTKLFAPAAPITTTLLVEGMHCGGCTSRVEQALAQVPGVTGAVADLAAGTATVAAASAIDTARLVAALDAAGYRATVATAPAATGNADARHGRARDEDDDAAAAPHTAAVTLTIGGMTCGGCARRVEQALAAVRGVADAKVDLATTSAKASVARDVDSQTLVAAVERAGYRANVVRDARAEAAPKPAACPFEDAARSAAPAAAFAVDESSAASPERVATQSFELDIAGMTCASCVGRVEKALAQVPGVARATVNLATEKAAVDADADAHVDTARLIDAVKRAGYRASPVSDPASALAPSPEIAAARTAIELDIAGMTCASCVGRVEKALAQVPGVARATVNLATEKATVDADADAHVDTARLIDAVKRAGYRASPAIAACAPASRVTATADAAAARPASPSADDRKLAEARRERALVIASAVLTTPLALPMFAAPFGVDAALPAWLQLALASIVQFGFGARFYRAAWHALKARAGNMDLLVALGTSAAYGLSIWLMLRDPGHAAHLYFEASAVIVTLVRFGKWLEARAKRQTTDAIRALNALRPDRARIVEHGVERDVPLAQVRVGTVVRVLPGERVPVDGRIEAGVTHVDESLITGESLPVPKGPGERVTAGSINGEGALTVATTAIGAEATLARIIRLVESAQAEKAPIQRLVDRVSAVFVPAIVAIAFATFAGWLVAGAGVETAILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRARIVAFDKTGTLTQGRPTVTAFDAIGIPRGDALALAAAVQRASAHPLARAVVAAFDADADARRSSLAAAHADMPRAVAGRGVEARVDARLLALGSTRWRDELGIAVPDGVARRAAALEAAGNTVSWLMRADAPREALALVAFGDTVKPNARRAIERLAARGIRSALVTGDNRGSATAVAASLGIDEVHAQVLPDDKARVVAQLKATAGDGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAVDISRRTYRKIQQNLFWAFVYNLVGIPLAALGWLNPMIAGAAMAFSSVSVVTNALLLRRWKGDAR
>NZ_CP004043.1|WP_004188671.1|95555_95999_-|DUF4087-domain-containing-protein
MIAFLARRAARRTPTPTTASHSPTSRSRGAGRHLFAALAVALIGLPHAHAEIRCGWLQNPTPGNWWLDDRTGSWTLGTMGGPETEGMDVIPDMAGKQYVETNGSHGYACACLTVVTDKQERRIVKVLKAKQLPLSRCRRDKRLKEPT
>NZ_CP004043.1|WP_004188306.1|94873_95353_+|GNAT-family-N-acetyltransferase
MLQMRPMTQTEFREYRERAARGYARDLIESGQSAPDEADARALACIDTLLPDGLLTDDQVLLTLSESADGSVLGHLWYGVVAEGPHRSLFIYDLEIEPAFRRQGWATRVLQALEDDARELRVSEIGLSVFNHNAAALALYRELGFAAVTTTFVKSIESP
>NZ_CP004043.1|WP_172644508.1|94232_94631_+|hypothetical-protein
MDAGRGRDRGIAWRARNAGAAMPRPAPSVNVADISTNCATEPANFVGRLIAIRSLSRRRVRHRHPAVEADREPQSCRRRAESRRASAANKYSIASMHAPSRTEAHRGGTGPGFGSGLTGPHRMTATAGRFDS
>NZ_CP004043.1|WP_004187391.1|93692_93848_+|hypothetical-protein
MSLIFALLQKIEDLFTSPHLPLDADYSYKARHAEVERVRKSHVSQVGLIRR
>NZ_CP004043.1|WP_041199016.1|91993_93496_+|hypothetical-protein
MRRAAERSMTDFAASPRTRSSRSSPARRRPRAAAASGPGQSRAAARPGRDAAAGDASRDEHTLDLFGTAFEENARTDEAAAGVAVDETAHDAARVQARGFGGLDRPGRGAGAGAGAGAGAGADADADADADARGARAAAHAPEPAGEQADLLSGFGESPAADRQDAQRNADGRVDAEAADGERSRAVKADERLNEGVNQGMNAEASAGEHAAAGSAGPAIIRRDASAPGASEPAAKSGVDEATAARPPRARRASARRADGGKQAAERGARRGRAAEGAISKSAGADGGALGGEAAGGEAAENRAVPADTVRDSSPAPVARRDAAVRGRPAEARALPAAADRAPVNAAQPHPRSANPSPALLPAAAAQAATSAASADSDAQLRPLADRIRALQSETIDLRRAADAQMRRVNRLLLALAVVLLAAIVAWIVQAVQLSRQRDQFAAMQQRIDRLVAAQATQGATIATLSQRQDEVGAQVDRLTSRLSSAAVPAKRAHRTRHMR
>NZ_CP004043.1|WP_004187213.1|91224_91920_+|MgtC/SapB-family-protein
MLNNVELIMRLMLAAALGSVIGIERERLSWAAGLRTHMLVCVGSALIMIVSAFGFADVLGQAHVDLDPSRMAAQVVSGIGFLGAGSILLRGEIVRGLTTAASLWSVAAVGLAVGGGLYAAAIAATIIILVILAGIKPLERRYLSVRQRRHLMLLVERGTLTFDSLHAALGVDSARVKRFIVQQSEDSADSDEVTIALGRVSDVEYESICARLRQLPGVKGFSERKGGLPDD
>NZ_CP004043.1|WP_041199015.1|90010_91114_-|AGE-family-epimerase/isomerase
MSAPVSVSDQAARLRRHFAQIVLPIWRGPGFNPALQLPFEAVAPDTHVPLPVTRYRAMACARQLFIFSQAGDAQHAHALFAALCRHFRDPRHDGWFYSVDAQGAPLDRTKDLYTHAFVVFACAEYFAAFGNRDARELAQRTAALIVDRFAPRPGSALLDSARGEDFAAAAGGPLQNPLMHLTEGWLAGGRAFGDTAFDDALLRTAQAVERTFVDPHTGCVAELPIGCADNRFEPGHQFEWFYLVASAGARLAATGLPDALARAYAFAQRHGVDPDTGGVSAATDERGACVDGTQRIWAQTEYLRALATHGGEPDALARQIARFAERFLHPRGWYECKTAQGEVSRADMPSTTPYHLATAYASLPAGT
>NZ_CP004043.1|WP_004533766.1|89046_89928_+|LysR-family-transcriptional-regulator
MDRLELRHVRAFLCVARHLHFARAADELDIAPPALTRLVQDAERLLGVRLFHRTRRSVALSAAGAAYLGEAQAALAHLARGRERAALAERGEIGRIELGYVSSAAYAGVLQRTVGAFRDAHPRIRVDVREVPMSEVAARLDAGTLDAAYVRPPLPLPDGVSTHTVHRDVFVVAVHGQSPLAARASIRPAALAGERFVVPEQALGTLEVARRGRFEPIVDARPGALVAVLAHVSVSGGVAIVPQALVGCVSLPGVAYRPIEGKPIASEVAVAYRRHEKAPAVRAFVRFVRQAAL
>NZ_CP004043.1|WP_041199014.1|87283_89011_-|MFS-transporter
MNFCGNDLQQPLSLTCRSPLRITVSGMHDAPSRPAPIEPPRHACGSPAASAPARARALAPAAEPGAEPGAEAPSRAWRALATASATCSLIVLDTNVVAVSLPSIARTFHASFADIEWVVSAYMTAFAACLLPAGGLADRAGRKRVLLAGLAVFFVASLGCGLAPSAALLNVARAVKGIGAAMLLTSALAVIANRFSEGRERARAWAIWGMCMGVATAIAPLVGGAIAQWIGWRWIFLLNLPVCIALAAAVRATIDESRDPHAKRIDAPGSVLFGAALALGIWALIDAPSHGWTAPGTLARFAASAALGAAFVAAERWQRRPMIDLALFRTPRFVGALLAMFGYAACAQVMMTFLPLYLQIGFGMSAIDAGLGMLPFALAMIVGPSLGAALSARAPAATVLGCGLALIGIGNFATAALAGASHYGLVALGMMITGCGAGILNGDTQKAIMACVPPERTGMASGISTTTRFSAIVTSVGVLGAVLAEQTHAALAARVAHAPALLGALDPHFMSSLLAGDLAQAICGLPPRTGATLAHIAPGGFASGFSVALCASGAFALAAAVAVRLLVGAQPGRAA
>NZ_CP004043.1|WP_038770310.1|101887_103309_+|DUF1254-domain-containing-protein
MTTNQRESTVSLRRACASLAALALLAACTSTPEAIQRKTGWMRSEVADSYIYAYPLVLMDVAKEAATADGAPVNTLRHAQALPAPGAANPPLASVDMLDSTAWLDVADEPVIVALPDGRGRYLDARALDMWTNVLWSTGPSANPRSGASRARTLAFVGAGWEGTLPEGVTRVDVPARNVWLDVRIQTSGGRDLAAARKLQRAIRVEPLSVYTGDARGARADAGAASAEPASGAAASPVAQVAALDPPAFFSRVARALQDNPPSAADAHAQEILADIGVTAGAPVQWKGDKLIGAENGAAEARERLTALPPNALSANGWSWLGDSVGNYGQDYALRAYAASTQFGAGTRDDETVAVVKTDSAGRPLNGAHRYVIRFAPNALPPARAFWSLAPYTPDGAVPELGRARRSIGERDRLRRNRDGSLEIVVSAAPPGKGYASNWLPAPRADFELALRLYAPKRQAADGTWQPPAVVRK
>NZ_CP004043.1|WP_004188004.1|103305_103464_+|hypothetical-protein
MNVRARRPVSRPGAARADARLPRCVAKRAAPILAKAGRSRPDFLAAVPTAIQ
>NZ_CP004043.1|WP_041199018.1|103463_107408_+|DUF748-domain-containing-protein
MAFNKETVQSNLQKLGVAARSRRAKRAGIGALIVLVAFGLLGFFAAPPLIRHVAEQQLSQQLERPATIARIAFNPYTLRLEADGVRVGERGGQGAFVDIGKLVVRASWTSLARFAPIIDEVRLDQPRFRIVRYDAQRFNFTDLVDKFSKPSPQPSAKPARFSVSNIQVNDGRIEFDDRLLNARHVVDQWTVGIPFIATLPSKTDIFVEPKLRARLDGSPIAIDGKTKPFAQSRESSINLKFDGLDVPRLLSYAPTKLPVDVRSGRLSSNLDVNFAMAGDTPSLRVSGTLDLNDTQVTSRANEPLFAAHAVHVAAAQLEPLRNVLHFDDIRIDRPVVSLARDKAGVLNVMKLAGGEKAGAPPAARAAAPTSAGASAAAAGSSVSAVSPGSPAAARPASGAASQPAAAASSAAAAHAAAEKAPPLDLTIKRFAINDGALNLNDASLATPAAISLQHVATTLADFTLAGKAPARYTLAADVASGGSLKAEGAFSLAARQADTKLAIDALALPAVQPYLAGASSARVLDGVLSTSVNAKADWSKTPLDAQVSDSELGLKSLKIALPNAKTPAVALPDARVKVTKIDLAARTAEIASVDATGLALDVARLQDGRIDLASLAGDGGRAAGAKPAASAARGARPAAPAWRYRIDELNVKDAKANFTDRSTPRPVKLAIAPLALNVRQISEDLSKPLPVRLTATLNRKGSLELSGNVTAQPLKVGLKLNGNRLDAAAFEPYFGSMLNATVASALLNAKGELSVEQAKQSTKASYRGDAALVDVRMLDKATSDPFAGWRSLALANLKASYDDARGTDVDASRVTFSNFYGRVLLDAQGKLNLREVVAKESGPAQSLTRDASGKEPIPLTPQAASQAKAAIAASAVEPASAPVLASAAAASAAAGASAVAASPASGAAVVRAAAPPQHPVRLHFGQLLLQRGRVTYTDNFIKPNYTANLVAINGTIGAFGTDSTAPAPVDVGANLADNGPITIKGTVNPLIEKPSLDLTATAHDIELTNLTPYSAKYAGYPITKGKLNVDLHYKLDNDLLSANNHIFIDQLTFGEHVENDTATKLPVRLAIALLKNSRGEIDVNVPVSGSLSNPEFSIGGLIWRAVLNLIAKAVTSPFTLLAHAFGGDGEALGYVEFEPGRSKLSDASQKKLDTISKMLAEKPSIRLDLIGRVDPDKDLPGLRDAYVERLVRQQKLKDVVGQGESVDPMTVKVDPAEYTKYLTKAYKAADFKKPRNMIGFTKTLPDDDMRKALADHASVDDSSLRALAQARAQAVRQYLEGKVDSSRMFIVAPKLDAKGIEDKGATTRVDFGLK
>NZ_CP004043.1|WP_004541513.1|107519_107741_-|hypothetical-protein
MATLEAFRCVLDDARTPEIIRHHIIDALQYALRNYGQVFTAKEVEWLAAWDDPRIPLAARKELDQREPAAAAR
>NZ_CP004043.1|WP_004533853.1|108108_109770_-|alkaline-phosphatase-family-protein
MKRNSKQFEIGAWLGACALAFAGAASAAAVQDRDHDSRPVDAKRVLLASIDGLHEQDLARCIGANTCPNLALLAKSGVTYTNARTPGLSDSFPGLAALVTGGSPKSAGLFYDVSYDRTLYAPSDATCSGKQGWNVVFDETTGIDAMNGGALTHLDGGGAFNPQAIPHARVNGQCVSVYPHDYVKTNTVFEVVKEHLRGSHTAWADKHAWGYDWVNGPSGKGVDDLARTEINSIDPATGTPYTDIYTHTEKFDDYHVQAIVNQIDGKNSTGTAAAPVPTLFGTNFQTLSVAQKATVASGGGYLDASFTPGPEVANAIAYVDGALGRIVAELRQRGLYDSTVVIVTAKHGQSPTDHTKLVKHGDTLTALLEANGFVDPNGNFGQNNTASGNPNDGTGLVGTGFVQTDDVGLVWLRDPRQLSAAVATLKANLGCNAPGICADGPQAYILYGPSVAERFGDPALGRTPDIVVQPNPGVIYTSSKKKDEEHGGNAPDDSHLGLLVSYAGLRQGRTIDAPVLTTQVAPTILRSLGLEPRLLHAVALEGTRVLPGLGLER
>NZ_CP004043.1|WP_004548845.1|110372_110762_-|VOC-family-protein
MNPPVLRVARPTNDIDTLVRFYTKALGFDVVARFENHEGFDGAIVGRAGYPWQIEFTHQHGVTVARAPTAEHLLVFYLPDRGAWTEAVARMRAYGATPCRPENPYWDREGVTFEDPDGYRIVLQNAQPA
>NZ_CP004043.1|WP_004188119.1|110889_111183_-|hypothetical-protein
MTAMAMKKTDLEKNKALKLTHAMKQTTSARFGKGAEDAAADRRERRRLEQAQGLVPFACKLNIELVARLNERAAAHPDGMTGLLTELLQRGLDETAK
>NZ_CP004043.1|WP_004554743.1|111363_112413_+|squalene/phytoene-synthase-family-protein
MGNSTRAFLLGPLLKGVSRSFYLTLRVLPQGMRDPIGLAYLLARAADTIADTSLIPPAQRLELLLSLRAQINGAPDPHALARIAGEVAGQQAQTDEKTLLESLGPALAVLSQLSAPDRAAVRGVVTTLTEGMEFDLRTFPDESSGRIVALREWPALDRYTYLVAGCVGEFWTKMTCAHLPGLLTEREDTMSERGIRFGKALQMTNVLRDCGRDLRIGRCYLPQAMLDEYGLRAEDLLGPGASLRARPLMHALVRTTLAHFHAGIDYTFAIPRRAPRLRLACFWPIAIGLRTLALLASNDAWLDPARASKVRRGDVYRILAYSLPLAMSNGALRAWLDRLIADVEARLIA
>NZ_CP004043.1|WP_004523495.1|113264_113459_+|YqaE/Pmp3-family-membrane-protein
MRLLLALLLPWLQFFTIGRPFAGIICLILQITLIGWLPAAIWSVYALSQYKTDRKIEEALGRRS
>NZ_CP004043.1|WP_004188088.1|113799_113970_-|hypothetical-protein
MKTSITTTTEPRAVARGARLPGWMWFALLWMGGVAGAVTLGYAFKLFMYATLFAVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP004043_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004043_2

1246733-1246897

Orphan

Consensus_repeat	Method
TCGGCGAGCGCGGCGAGCGCGGCCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP004043_2

>merge|NZ_CP004043|2|1246733-1246897|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGACAGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCGGCGAGCGCGGCCGCGCGATGGGCGCCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGTGAGCGCGGCGAGCGCGGCCGCG

>NZ_CP004043|2|1|1246733-1246897|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGACAGG	CCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGC
CCGCGGCGAGCGCGGCCGCGCGATGGG	CGCCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGTGA
GCGCGGCGAGCGCGGCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004043.1\|WP_004528277.1\|1240091_1240451_+\|lipoprotein	unknown	unknown	gnl\|CDD\|226765
NZ_CP004043.1\|WP_041199058.1\|1242585_1245258_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP004043.1\|WP_004524130.1\|1256771_1257044_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP004043.1\|WP_004198480.1\|1240447_1240675_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_041188241.1\|1252109_1252361_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_041199059.1\|1247531_1249373_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP004043.1\|WP_154220034.1\|1250507_1250930_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004198472.1\|1255869_1256118_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004524117.1\|1241454_1242459_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP004043.1\|WP_024428521.1\|1249369_1250380_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528
NZ_CP004043.1\|WP_004549393.1\|1254002_1255472_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP004043.1\|WP_041199057.1\|1239065_1240052_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NZ_CP004043.1\|WP_004202607.1\|1237506_1237650_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004266248.1\|1238183_1239008_+\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP004043.1\|WP_004184766.1\|1257147_1258542_-\|heavy-metal-sensor-histidine-kinase-IrlS	unknown	unknown	gnl\|CDD\|273593
NZ_CP004043.1\|WP_004524124.1\|1252523_1253783_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173852
NZ_CP004043.1\|WP_004548936.1\|1245476_1246457_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119321
NZ_CP004043.1\|WP_004206353.1\|1251092_1251785_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP004043.1\|WP_004199294.1\|1237665_1238187_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123
NZ_CP004043.1\|WP_004524116.1\|1240948_1241458_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561

Protein	Function_ID	Function_description	E-value
NZ_CP004043.1\|WP_004528277.1\|1240091_1240451_+\|lipoprotein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	2.7211e-31
NZ_CP004043.1\|WP_041199058.1\|1242585_1245258_+\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.20526e-87
NZ_CP004043.1\|WP_004524130.1\|1256771_1257044_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	9.38719e-09
NZ_CP004043.1\|WP_004548936.1\|1245476_1246457_-\|ABC-transporter-permease	gnl\|CDD\|119321	cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to generate the transmembrane pore.	4.49135e-52
NZ_CP004043.1\|WP_041199059.1\|1247531_1249373_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.45019e-174
NZ_CP004043.1\|WP_004524117.1\|1241454_1242459_+\|FecR-family-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	2.1512e-74
NZ_CP004043.1\|WP_024428521.1\|1249369_1250380_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	1.08818e-121
NZ_CP004043.1\|WP_004549393.1\|1254002_1255472_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.06027e-36
NZ_CP004043.1\|WP_041199057.1\|1239065_1240052_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	6.40111e-28
NZ_CP004043.1\|WP_004266248.1\|1238183_1239008_+\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	1.42331e-18
NZ_CP004043.1\|WP_004184766.1\|1257147_1258542_-\|heavy-metal-sensor-histidine-kinase-IrlS	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_CP004043.1\|WP_004524124.1\|1252523_1253783_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173852	cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C. DszC is a flavin reductase dependent enzyme, which catalyzes the first two steps of DBT desulfurization in mesophilic bacteria. DszC converts DBT to DBT-sulfoxide, which is then converted to DBT-sulfone. Bacteria with this enzyme are candidates for the removal of organic sulfur compounds from fossil fuels, which pollute the environment. An equivalent enzyme tdsC, is found in thermophilic bacteria. This alignment also contains a closely related uncharacterized subgroup.	3.81867e-137
NZ_CP004043.1\|WP_004524116.1\|1240948_1241458_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	7.12237e-71
NZ_CP004043.1\|WP_004206353.1\|1251092_1251785_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	8.15398e-14
NZ_CP004043.1\|WP_004199294.1\|1237665_1238187_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	2.21088e-40

>NZ_CP004043.1|WP_004548936.1|1245476_1246457_-|ABC-transporter-permease
MRDATDRLSRLAALGALAAVLAFFAVAAPGFATLANVERVLVNNFALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALGAANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWLGVAAPLWIVAALAGALHVALERSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASALVYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFVANGLLLIGWNFYWQQVASGALVFAVLALGSGVGRERRARDAGQSG
>NZ_CP004043.1|WP_041199058.1|1242585_1245258_+|TonB-dependent-receptor
MDSICNRRPRRAHAGVCADTAHAPAGLPEAAQPAARLGAGRPRDAAAPRCARQATSHTSHTSHTSHASHASHTLHAPCMPQFAPRRVVARVAAAALFSACAAPGVSGAAEPAAATRGYDIPAGPLDAALTRFGREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGTGLVALRQPSGGYTLARLPGPAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGLRSDAPLAEVPQAVAIVAQQVLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGDNRDGSVMRNGMPIVQGRSLNATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLARRHAISALGSTYGGGRNGGELTFDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPSLAWYGRDTQVVLSYEYRRFLMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLAQLAIDHQLAPDWKVHVGYSYNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYGIAYVDGRVTLAGMRHDVQFGVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVSASDSDQSDTLHTASLFFQDSIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKWLPRAGIVYKWNDALSLYGSYTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDMPGGLAGTLAFFDIDKKHVLVSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIASYAYIDAKTTEDPLYAGNRLWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPGDSANSFTLPAYATADAFATYDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDARQVSLLTTLQF
>NZ_CP004043.1|WP_004524117.1|1241454_1242459_+|FecR-family-protein
MSGAKPAGGPPAVPERVARRAVQWWVELGAAPASDATRARLARWRAEHPAHDAAWRHIEAVNGRLGHVASALSARAARAALLPPRSRGRRAALKALAVLLFAGGGAWTGQAYLPWRAWGADVRTALGERRTITLADGTTVVLNTDTAIDIRFDDATRGVRLLRGEIMVTSGRDAARAVPRALVIATAHGDVRPVGTRFSVRERGDATRVDVFDGAVRIAPRRAVGRAPLITAGHGADFTRDALAGPPRVLGASAGAWVDGILVASNLRLADLLAEIDRYRPGRVRCDAAVANLRVSGTYPLDDTDRILDTLRETLPVDVEYLSRYWVTVVAARD
>NZ_CP004043.1|WP_004524116.1|1240948_1241458_+|sigma-70-family-RNA-polymerase-sigma-factor
MPANTLRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTFIRLLARDEPIDAAEPRAFLTTVAQRVLYNHWRRERLERAYLDALAQWPEAVAPSPETRAVLFETLVEVDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQCYFAIAA
>NZ_CP004043.1|WP_004198480.1|1240447_1240675_+|hypothetical-protein
MTGKGGAAANPRAATAIVVAASGSISPASRRTALSTMKTTANATARRRDGGTMKAPKEPIASGGAVLAGSVESPV
>NZ_CP004043.1|WP_004528277.1|1240091_1240451_+|lipoprotein
MIRNVLIALVCAAPVAALAEPPKAAGGMIVDDDGMTLYTFDRDTMPGKSACTGGCTANWPAALADAYDKPGGDLGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQHTGDGFGGMWHVARP
>NZ_CP004043.1|WP_041199057.1|1239065_1240052_+|YceI-family-protein
MDVAGSFASFAATLACALSAWLAPSAGIAQTAWPPDAPRVAGASGPPRTPGLARTPAAVTDAPGAATAGALAASPPAATRYRLDPRHSGVTFRVDNFWHAHLTMRFARMRAELSDVGDDRLASRVDVTVDAASLGANVPFVAALVKGSAMLDVARYPEIRFVGTRFERTGATTGVLTGELTIRAMTRPITLAVRFDAGRQLEPDTGARAEREGDESGESGESNPAERRAGQGRRAAELRDGRPRDAGPGVADSRDAMRHETDSGSAHRGAEPPERIARAAPDAARALAFVADGHFSRTAFGLSRWLPAVGDDVRLRIRAEFVRARADR
>NZ_CP004043.1|WP_004266248.1|1238183_1239008_+|anti-sigma-factor
MSDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDPRAAGIAAHYRAQRAALRALFADPVAPRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGWLGGALAPRFAPSAALQWVAPAAAQRAFARDADLAYALYAPDARHPVEIAVGRDGAPLAWLSARVGRRIAAPSLREYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREAAVRPWRDGGRHTFYWVSERTAYALSGQLDEGRLRTIAADVCSELGGHPQRWR
>NZ_CP004043.1|WP_004199294.1|1237665_1238187_+|sigma-70-family-RNA-polymerase-sigma-factor
MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRAFRPDSNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRMLYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPPLSLTAARHHR
>NZ_CP004043.1|WP_004202607.1|1237506_1237650_+|hypothetical-protein
MLSAACALLALMLAAGCASPGDMSPSDHAAPMGGYGRGGGSGGGGGY
>NZ_CP004043.1|WP_041199059.1|1247531_1249373_-|sugar-ABC-transporter-ATP-binding-protein
MKAALTTAAASAAAAPDAAGAPLALDVRRVVKRFGGVAALRGASLAVTRGTVHGLIGQNGAGKSTLVKLLAGLHAPDEGEITVGGVPFASGGSGSRASAGAARRHSTGIGFIHQERLLPATFTVAEALFFPHPPTLGGRASRLARLLPLDVKRMRRDCRAVLHTQFGLDLAPDRLIGELSVAEQQIVQITRALLGRHEILVFDEPSAALVSSEVDRLLRTIERLRANGHTILYVSHYLDEIARVCDRVSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPAAAAPSAATARADARAAARADARADARVSARADAWGDDPHRAPAGADPARLGARAAPGAIALEARDLALPGRFGPLSLAVRRGEIVGLTGGLGSGGKDVIRALFGLARGVRGSIAVDGRPARVRRPHDAVAHGIALVPENRAAHGVALTLPVRENVVLADLSSVSRFGLVHGRREADVARALIRRLDIRPARPDLPARFLSGGNQQKVALAKWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDALARAGAAVLLFSSDLTELLDVTDRVYVMARGEIVAQCASAETTTRDVLAWATLARDARPGGGAGAHDAAARTGTPGAAAAASSAAKVAT
>NZ_CP004043.1|WP_024428521.1|1249369_1250380_-|sugar-ABC-transporter-substrate-binding-protein
MLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITAAGTDHYWDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIAQIQTLIAQQPDAIIEQLGTASVLEPWLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLVFNGFYGVPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKGTISAIWAAWDIPQVGATQAVDAAGRREIRTYAVDGSPEAVALVRNPTSSAAAVVAQQPALIGRTAVRNVARYLAGDRSLPAYTFVPSVLVTKDDAGVARPALGQTPAAAGLARR
>NZ_CP004043.1|WP_154220034.1|1250507_1250930_-|sugar-ABC-transporter-substrate-binding-protein
MQPFAKPPSKRAAPPPRRIMRRGGLSYGFSSMPARNFALAERFREDFVSFDAARAAAFSDWPAISRFRFNGASSGLFSIALKFICDCPIPIETTRRRSRVPADIGIDAREAAGPASARAGRVRFPPRIFACAARAFAAIP
>NZ_CP004043.1|WP_004206353.1|1251092_1251785_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MATTRRHATATALAAAARPCAAPHADSFLGILIEVFARVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPLALFFSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRGIVSRGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSEDAAYRAYRRSVRYRVIPGLF
>NZ_CP004043.1|WP_041188241.1|1252109_1252361_-|hypothetical-protein
MFSTLSHVLPRVVLLGEPLANAPFVDGEITRPFRDGFWLLPYSTLCLPLVASDTVIVEPDRPGSAGALAGRQLDAGRQSPSPL
>NZ_CP004043.1|WP_004524124.1|1252523_1253783_-|acyl-CoA-dehydrogenase-family-protein
MSHAPADPTRSTGADYASLAARFRPIFARIAEGAIERDRTRALPHEPIRWLKEAGFGALRVPVHAGGAGASVPQLVQLLIELAAADSNLPQALRGHFAFVEDWLNAPPDAARRAWFDRFASGQLVGNAWTEVGDVALGEVRTKVAKRDGGWVVNGEKYYSTGAIFADWIDVYAQRTDDGGPVIAAVAARQDGVILGDDWDGFGQATTGSGTTRFVDAHVDEANVIDFARRFKYQTAFYQLFHLATLAGIGRAVERDASALVRGRRRVYSHGNAPRVSDDAQILQVVGEISAWAYAAEAIALRAAQPSQRAYEARGGGDAAAEHDANVAAEIESAQGQLVVSELVLRAATHLFDALGASATRATNALDRHWRNARTVASHNPLVYKARIVGDRAVNGTEPPYVWQIGAGPGGPREPEQAA
>NZ_CP004043.1|WP_004549393.1|1254002_1255472_-|MFS-transporter
MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGVFLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVFMADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKASRLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAVPALAIIAVRGRYMNESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLVASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYRLPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYPALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAAIRFEPTARDVDVDIDAGPRAQGDRARVRAAA
>NZ_CP004043.1|WP_004198472.1|1255869_1256118_-|hypothetical-protein
MKAPIIAIAFGIALAACAPLRQDSRPGEAGPPIAAPNRGGGNTPPSGARRAANEVVDYAGRPCVNQTLYVKTHPCIFPRLQR
>NZ_CP004043.1|WP_004524130.1|1256771_1257044_+|DUF4148-domain-containing-protein
MNTKTTIVWATAAALTALALSPAAFAQGKTRDEVRQELIRAQHEGVVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTVAR
>NZ_CP004043.1|WP_004184766.1|1257147_1258542_-|heavy-metal-sensor-histidine-kinase-IrlS
MIRRLLPRTLRARLTALIILSTAATLALSGVALYSALHNRLVGMSSYEMSATLAAMRTHLANVANVDDIPRKSDLWIDQLHGHQNLDLAIYDTDGRLRFATRGFVAPRPALGAPQTRVPASAAPAGATFSYLADDAPLRGGNPRTARIVVQYDGKNDHALLRAYAYTVVVIEVLAVVLTAALAYGIAMLGLSPLRRLVARAEQMSSSRLAQPLPELDTSGELKEMEHAFNAMLKRLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQVALSKPRTADEYRDVIESSIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLDAAAQAERVAGYYEPMAEDAEVSIVVRGKAEVRADALLYHRALSNLISNALNHAPRGSTITIECAQAADAATISVSDTGRGIEAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTCGVDSEPHVRTTFWLKFPAHAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP004043_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004043_3

2440734-2440826

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP004043_3

>merge|NZ_CP004043|3|2440734-2440826|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP004043|3|2|2440734-2440826|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004043.1\|WP_004524980.1\|2447020_2448424_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP004043.1\|WP_041199129.1\|2448420_2449599_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922
NZ_CP004043.1\|WP_014920160.1\|2430720_2432556_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP004043.1\|WP_004188221.1\|2442770_2443226_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057
NZ_CP004043.1\|WP_004524993.1\|2429446_2430571_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP004043.1\|WP_004524989.1\|2435047_2435557_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_038795224.1\|2437446_2438295_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP004043.1\|WP_004188438.1\|2442282_2442774_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP004043.1\|WP_172644522.1\|2450316_2451738_-\|1-phosphofructokinase-family-hexose-kinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP004043.1\|WP_004524995.1\|2425098_2426172_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP004043.1\|WP_004201694.1\|2441981_2442290_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP004043.1\|WP_041188001.1\|2438291_2440298_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP004043.1\|WP_041188003.1\|2443215_2444856_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183615
NZ_CP004043.1\|WP_004524990.1\|2432941_2434507_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP004043.1\|WP_038766143.1\|2436194_2437220_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP004043.1\|WP_041199128.1\|2445216_2447010_+\|polyhydroxyalkanoic-acid-synthase	unknown	unknown	gnl\|CDD\|213656
NZ_CP004043.1\|WP_038750602.1\|2435614_2436130_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_041187999.1\|2426168_2429444_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP004043.1\|WP_041188002.1\|2441289_2441985_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP004043.1\|WP_004187193.1\|2441044_2441293_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067

Protein	Function_ID	Function_description	E-value
NZ_CP004043.1\|WP_004524980.1\|2447020_2448424_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP004043.1\|WP_041199129.1\|2448420_2449599_+\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0
NZ_CP004043.1\|WP_014920160.1\|2430720_2432556_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	3.95125e-132
NZ_CP004043.1\|WP_004188221.1\|2442770_2443226_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63
NZ_CP004043.1\|WP_004524993.1\|2429446_2430571_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	3.93708e-26
NZ_CP004043.1\|WP_038795224.1\|2437446_2438295_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	6.45514e-34
NZ_CP004043.1\|WP_004188438.1\|2442282_2442774_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	7.77353e-17
NZ_CP004043.1\|WP_172644522.1\|2450316_2451738_-\|1-phosphofructokinase-family-hexose-kinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	4.19996e-109
NZ_CP004043.1\|WP_004201694.1\|2441981_2442290_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	3.23546e-10
NZ_CP004043.1\|WP_041188001.1\|2438291_2440298_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP004043.1\|WP_004524990.1\|2432941_2434507_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79
NZ_CP004043.1\|WP_038766143.1\|2436194_2437220_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	5.03185e-180
NZ_CP004043.1\|WP_004524995.1\|2425098_2426172_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	1.83012e-39
NZ_CP004043.1\|WP_041199128.1\|2445216_2447010_+\|polyhydroxyalkanoic-acid-synthase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	3.42332e-178
NZ_CP004043.1\|WP_041188003.1\|2443215_2444856_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|183615	PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional.	0
NZ_CP004043.1\|WP_041187999.1\|2426168_2429444_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.08826e-92
NZ_CP004043.1\|WP_041188002.1\|2441289_2441985_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	3.90235e-120
NZ_CP004043.1\|WP_004187193.1\|2441044_2441293_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37

>NZ_CP004043.1|WP_041188001.1|2438291_2440298_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREISREVSREVSREASHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPPPDARGDAARTAPSPQGGADANVNADANVNADANVDAEAEARHKR
>NZ_CP004043.1|WP_038795224.1|2437446_2438295_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGDTAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAVRLEATERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP004043.1|WP_038766143.1|2436194_2437220_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVSVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP004043.1|WP_038750602.1|2435614_2436130_-|hypothetical-protein
MRRAMRGAGRASPSRARRYENVSKEPNTHREAGAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDTHPGDVTPVHVSRPVQFAVPAHEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPSPVGDDMQDLIH
>NZ_CP004043.1|WP_004524989.1|2435047_2435557_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP004043.1|WP_004524990.1|2432941_2434507_-|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP004043.1|WP_014920160.1|2430720_2432556_+|response-regulator
MHVEVFAQHSSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLEAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRAKTAAARVQR
>NZ_CP004043.1|WP_004524993.1|2429446_2430571_+|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFALDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP004043.1|WP_041187999.1|2426168_2429444_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQDAQEAQGGAGERPGAGERAAGESVAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSDVGSDVGSDVGSDVGSEVASEAGLAAGAERGSERGIAHGAERAREPAADITADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPAEPPHRAFSTQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAACVPVILGATILLLKKQER
>NZ_CP004043.1|WP_004524995.1|2425098_2426172_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MIQVTRKQIVAAAAVVVVALGAYYGWTLLRHQGPGDGFASGNGRIEATEIDVATKLPGRIDAILVDEGDFVKAGQPLANMQIQVLRAQYDEATAQRQRALNTAAGVQSQVAQRKSDKAAAQAMVVLRESELDAAERRLARSQTLSREGASSLQELDDDRARARSAQAAVSAAAAQVAAAQAAIEATEAQLVAAHSAVTAADATVARVQADIDDSQLASPRDGRVQYRVAQPGEVLPAGGKVLNLVDLSDVYMTFFLPETVVGRVALGADARIILDAAPNYVIPATVSFVSSTAQFTPKTVETANERQKLMFRVKARIDRELLQKHLKLVKTGLPGVAWVRVDPSKPWPAQLMVKVPQ
>NZ_CP004043.1|WP_004187193.1|2441044_2441293_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP004043.1|WP_041188002.1|2441289_2441985_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLAMFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP004043.1|WP_004201694.1|2441981_2442290_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFAAGACHFVSLGWNSRLFVAGRAGVALALQFARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP004043.1|WP_004188438.1|2442282_2442774_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREARDDAARGDARHAGAGAAPDDPRGAARRDPSPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP004043.1|WP_004188221.1|2442770_2443226_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP004043.1|WP_041188003.1|2443215_2444856_-|F0F1-ATP-synthase-subunit-beta
MADPQATNGTGAACAERDASDVGDVSDVGDARDEGAGRVVAVRGAVVDVAFDGGALPALNEALTIPVDGAAPILAEVHAHLSDAAVRALALGPTGGLRRGAAVCATGGPIRVPVGDAVLGRLLSVTGAPGDDGAALAADVERRPIHRGAPPLAEQKSANALFATGIKVIDLLAPLAQGGKAAMFGGAGVGKTVLVMELIHAMVERYRGISVFAGIGERSREGHEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDFTDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRRVIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIADTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAAASVAGPGTTSGTTSGATSGTTSDPASGSAEPQGARHGR
>NZ_CP004043.1|WP_041199128.1|2445216_2447010_+|polyhydroxyalkanoic-acid-synthase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAGAWHLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASITLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP004043.1|WP_004524980.1|2447020_2448424_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGARLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP004043.1|WP_041199129.1|2448420_2449599_+|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGETHTVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPLAPLHQPQSVRLIRALRHVRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGQLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLAEPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA
>NZ_CP004043.1|WP_172644522.1|2450316_2451738_-|1-phosphofructokinase-family-hexose-kinase
MCAALARRARCSILAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASSKQQAASSKQQAASSKQQAASSKQQAASSKQQAASSKQQAASSSRPAPVLMVRRRIERKHCGACPPRSTREPRTRASRCVVFPSRIPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYLAGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGTALGTKEDIARIYRELPGTIDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP004043_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004043_4

2887002-2887087

Orphan

Consensus_repeat	Method
CGGAATGCCCGATCATCGGGATGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP004043_4

>merge|NZ_CP004043|4|2887002-2887087|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGC

>NZ_CP004043|4|3|2887002-2887087|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGC	CTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGC
CGGAATACCCGATCATCGGGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004043.1\|WP_009950937.1\|2897602_2898256_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP004043.1\|WP_004529498.1\|2898323_2898758_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP004043.1\|WP_041199143.1\|2896371_2896713_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_038757807.1\|2887664_2888930_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP004043.1\|WP_014920251.1\|2880636_2881227_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004043.1\|WP_004532536.1\|2873996_2875040_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP004043.1\|WP_004523282.1\|2889138_2890980_+\|ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|180772
NZ_CP004043.1\|WP_041188047.1\|2894425_2896243_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP004043.1\|WP_041188048.1\|2893397_2894429_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP004043.1\|WP_004523291.1\|2879685_2880621_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP004043.1\|WP_004523292.1\|2875045_2876278_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	unknown	unknown	gnl\|CDD\|223997
NZ_CP004043.1\|WP_161934870.1\|2899164_2900295_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP004043.1\|WP_038755684.1\|2883474_2885748_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP004043.1\|WP_004530663.1\|2896709_2897159_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP004043.1\|WP_041199142.1\|2891054_2892866_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP004043.1\|WP_004536946.1\|2881286_2883185_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP004043.1\|WP_004200700.1\|2878272_2879388_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP004043.1\|WP_041199141.1\|2872543_2873995_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
NZ_CP004043.1\|WP_004187469.1\|2885880_2886276_-\|TraR/DksA-C4-type-zinc-finger-protein	unknown	unknown	gnl\|CDD\|224648
NZ_CP004043.1\|WP_004196898.1\|2877530_2877971_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863

Protein	Function_ID	Function_description	E-value
NZ_CP004043.1\|WP_004529498.1\|2898323_2898758_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	9.00264e-33
NZ_CP004043.1\|WP_009950937.1\|2897602_2898256_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	2.70873e-19
NZ_CP004043.1\|WP_038757807.1\|2887664_2888930_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	1.60535e-112
NZ_CP004043.1\|WP_004532536.1\|2873996_2875040_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
NZ_CP004043.1\|WP_004523282.1\|2889138_2890980_+\|ribonucleotide-reductase	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0
NZ_CP004043.1\|WP_041188047.1\|2894425_2896243_+\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	2.56217e-107
NZ_CP004043.1\|WP_041188048.1\|2893397_2894429_+\|nitroreductase-family-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	1.80028e-29
NZ_CP004043.1\|WP_004523291.1\|2879685_2880621_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.07132e-61
NZ_CP004043.1\|WP_004523292.1\|2875045_2876278_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	gnl\|CDD\|223997	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion].	5.32689e-143
NZ_CP004043.1\|WP_161934870.1\|2899164_2900295_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	7.06608e-55
NZ_CP004043.1\|WP_038755684.1\|2883474_2885748_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	5.08385e-57
NZ_CP004043.1\|WP_004530663.1\|2896709_2897159_-\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.14402e-50
NZ_CP004043.1\|WP_041199142.1\|2891054_2892866_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	1.63717e-74
NZ_CP004043.1\|WP_004536946.1\|2881286_2883185_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	4.48837e-35
NZ_CP004043.1\|WP_004200700.1\|2878272_2879388_-\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.16274e-11
NZ_CP004043.1\|WP_041199141.1\|2872543_2873995_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	7.09255e-133
NZ_CP004043.1\|WP_004187469.1\|2885880_2886276_-\|TraR/DksA-C4-type-zinc-finger-protein	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14
NZ_CP004043.1\|WP_004196898.1\|2877530_2877971_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	3.1145e-25

>NZ_CP004043.1|WP_004187469.1|2885880_2886276_-|TraR/DksA-C4-type-zinc-finger-protein
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP004043.1|WP_038755684.1|2883474_2885748_-|FAD-dependent-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPNVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKTKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
>NZ_CP004043.1|WP_004536946.1|2881286_2883185_+|GMC-family-oxidoreductase
MLGATRSTLWGSRERPRIAAARAPGAVASRMREEARECAGPRGAGRAPHRATAAGGKTGRRTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETPVAA
>NZ_CP004043.1|WP_014920251.1|2880636_2881227_+|hypothetical-protein
MCRARGIGRQARGNATAPSPIAAAAIGARPRSAPRGPRISDAGRLAAARSAFAMHQERRKRNADRHGTHQYDADSRAAPREAPRFEHEPKKQRDAAQHEVDRDRAAREIRERIEHKARPDVRRAERPISQDVAQTPIGAAGAISPSTAHSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP004043.1|WP_004523291.1|2879685_2880621_+|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVVLTHRAIIGCDEHAPA
>NZ_CP004043.1|WP_004200700.1|2878272_2879388_-|SRPBCC-family-protein
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRVERESAYSLTLLKRRLEAARDA
>NZ_CP004043.1|WP_004196898.1|2877530_2877971_+|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPAKIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP004043.1|WP_004523292.1|2875045_2876278_-|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha
MSQYGPLRLHVPEPTGRPGCKTDFSYLRLSPAGKVRKPPIDVAPADTSDLAYGLVRVLDEHGRAVGPWAPDLDPDILRKGIRAMLKTRIFDARMQIAQRQKKISFYMQCLGEEAIAVAHTLALERGDMCFPTYRQQGILMVREYPLVDMMCQLMSNERDPLKGRQLPVMYSTRDAGFFSISGNLATQFIQAVGWAMASAIKGDTRIASAWIGDGATAEADFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGATFAGRGVGCGIASLRVDGNDFLAVYAASRWAAERARRNLGPTLIEWVTYRAGPHSTSDDPTKYRPGDDWTNFPLGDPLERLKRHMIGIGVWSEQDHEDTKAALEAEVLAAQKEAERYGTLADEHVPNVASIFEDVYKEMPAHLRRQRQQLGV
>NZ_CP004043.1|WP_004532536.1|2873996_2875040_-|alpha-ketoacid-dehydrogenase-subunit-beta
MTTASREGPAASPMTMIQALRSAMDVMLERDGNVVVFGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPINEGGIVGAAVGMGAYGLRPVCEIQFADYFYPASDQIVSEAARLRYRSAAEFIAPLTIRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLISAIENDDPVIFLEPKRLYNGPFDGHHERPVTPWSKHPASLVPDGYYTVPLDSAAIVRAGGDVTVLTYGTTVHVSLAAAEETGIDAEVIDLRSLWPLDLDTIVESVRRTGRCVVVHEATRTCGFGAELIALVQEHCFHWLEAPVERVTGWDTPYPHAQEWAYFPGPNRVGDALRRAMEN
>NZ_CP004043.1|WP_041199141.1|2872543_2873995_-|2-oxo-acid-dehydrogenase-subunit-E2
MGVHVIKMPDIGEGIAEVELGLWHVKVGDRVKEDQAIADVMTDKASVEIPSPVTGVVVALGGKEGDVLAVGSELVRLEVEGDGNHKAEPDGGARAAAAQPERVADTAHAHAGAAAKSARGEHGAGHGRDDARAASSGTSSGASHTQHAEREARGHRESSEYREDRSASRGASQTDVERGPASPPPARRPGERPLASPAVRKRAWDLGVELRYVHGTGEAGRILHEDLDAYLQGRGAAAQRARGGQAAYVERHDEEVVPVIGLRRKIAQRMQDAKRRIPHFSYVEEIDVTELEALRAELNRKYGDTRGRLTVLPLLARAMVIALREFPQINARYDDEAGVVTRHGAVHLGIATQSKAGLMVPVVRHAEARDPWSIAAEVARLADAARAGRAERDELSGSTITITSLGALGGIASTPVINSPEVGIVGVNRIVERPMFRGGAVVARKLMNLSSSFDHRVIDGMDAAEFIQAVRALLEQPALLFVE
>NZ_CP004043.1|WP_038757807.1|2887664_2888930_+|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGARPAGWPTWGPMARAADAVPAPPPFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPPEAGAFGLDDYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRTAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPQRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGPRWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP004043.1|WP_004523282.1|2889138_2890980_+|ribonucleotide-reductase
MRTINKRTRTIAHADSFVRMIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDEARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHTAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPGLVFVDAIDAADPLRGRERIGATSPCGAQPLPPYGSAMLGAIDLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRAGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP004043.1|WP_041199142.1|2891054_2892866_+|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRPPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAVRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACDAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLERALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDRSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP004043.1|WP_041188048.1|2893397_2894429_+|nitroreductase-family-protein
METSPLKTTTPETIPPFDPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGFAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAKLIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDFATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP004043.1|WP_041188047.1|2894425_2896243_+|STAS-domain-containing-protein
MTERERAARGRNDARRGGGDSGGNDEAWRRWLPGIATLRTYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLSTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLVAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVEGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEAGAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARH
>NZ_CP004043.1|WP_041199143.1|2896371_2896713_-|hypothetical-protein
MTDAVVSSRLVSSRLAPCCVYIDIQGEGDVDVDAEGNGNGNIDVIDSKRCEPSGVEPVERAVRRPRYRAQSGCLSGIHRNGIVMLDPMPPTNRFDRLRASAVIVDRTKPRRSP
>NZ_CP004043.1|WP_004530663.1|2896709_2897159_-|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKDVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP004043.1|WP_009950937.1|2897602_2898256_+|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDIYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLTEALSLNEDELPILAQTVGKPAAHP
>NZ_CP004043.1|WP_004529498.1|2898323_2898758_-|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP004043.1|WP_161934870.1|2899164_2900295_-|porin
MMNAKSIAAAALAVAQAGFAHAQSSVTLYGALDAGVLWQNTSAASFSPTAPNTGAVVRFKDGGVYSSLWGIKGTEDLGGGYRVHFRLQGAFDGGTGKFGLSDAPGAVAAFNQIATLGVSGPFGTFNAGRQIVPMIYAMADTDVRAARFFGSVLTAWLGLNTAAGWPGNSTNAPIGALYDSDALVYQSPAFGGASLALEYAPGGVPGGVQRGARASIVLKYASNALNLAAVYYNGHDTNPAPGASATGLDNNRFVYVGAQYKLKDVAVSASYGNGRNPARGDRVNLDMFAFGLGYRVSPFFRVSSGVYYLKDRNRSANRSTSIVLGADYELSKHTTLYAQGGRVDNRGTMAQMLAYGQPVAPGLATTAAMLGMRHSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	94663-94681	0	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	100130-100148	0	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2539256-2539274	0	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2539262-2539280	0	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2539268-2539286	0	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	1383877-1383895	1	0.947
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2039121-2039139	1	0.947
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2039151-2039169	1	0.947
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2045981-2045999	1	0.947
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2893045-2893063	1	0.947
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	1033824-1033842	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	1177196-1177214	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	1383871-1383889	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2045969-2045987	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004043.1	2540227-2540245	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004042.1	1634855-1634873	0	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004042.1	1047820-1047838	1	0.947
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004042.1	794127-794145	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004042.1	2794907-2794925	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004042.1	3089277-3089295	2	0.895
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP004042.1	3301858-3301876	2	0.895

1. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 94663-94681, mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

2. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 100130-100148, mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

3. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2539256-2539274, mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

4. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2539262-2539280, mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

5. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2539268-2539286, mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

6. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 1383877-1383895, mismatch: 1, identity: 0.947

cggcaacggcaacggcaac	CRISPR spacer
cggcaacgacaacggcaac	Protospacer
********.**********

7. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2039121-2039139, mismatch: 1, identity: 0.947

cggcaacggcaacggcaac	CRISPR spacer
cggcaacagcaacggcaac	Protospacer
*******.***********

8. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2039151-2039169, mismatch: 1, identity: 0.947

cggcaacggcaacggcaac	CRISPR spacer
cggcaacagcaacggcaac	Protospacer
*******.***********

9. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2045981-2045999, mismatch: 1, identity: 0.947

cggcaacggcaacggcaac	CRISPR spacer
cggcaacagcaacggcaac	Protospacer
*******.***********

10. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2893045-2893063, mismatch: 1, identity: 0.947

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcgacggcaac	Protospacer
**********.********

11. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 1033824-1033842, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggctacggcatcggcaac	Protospacer
**** ****** *******

12. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 1177196-1177214, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcgacggcgac	Protospacer
**********.*****.**

13. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 1383871-1383889, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cgacaacggcaacgacaac	Protospacer
**.***********.****

14. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2045969-2045987, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggcaacagcaacagcaac	Protospacer
*******.*****.*****

15. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2540227-2540245, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggcaacagcaccggcaac	Protospacer
*******.*** *******

16. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 1634855-1634873, mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

17. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 1047820-1047838, mismatch: 1, identity: 0.947

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcagcggcaac	Protospacer
***********.*******

18. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 794127-794145, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggcatcgtcaacggcaac	Protospacer
***** ** **********

19. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 2794907-2794925, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggcaacgggagcggcaac	Protospacer
********* *.*******

20. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 3089277-3089295, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cggcagcggcagcggcaac	Protospacer
*****.*****.*******

21. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to position: 3301858-3301876, mismatch: 2, identity: 0.895

cggcaacggcaacggcaac	CRISPR spacer
cgggagcggcaacggcaac	Protospacer
*** *.*************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP018472	Xanthomonas perforans strain LH3 plasmid pLH3.1, complete sequence	9949-9967	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	MN175388	Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence	43158-43176	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	MN175388	Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence	43164-43182	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	MN175388	Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence	43170-43188	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	MN175388	Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence	43176-43194	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	355-373	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	361-379	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	367-385	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	373-391	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	379-397	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	385-403	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	391-409	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	397-415	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	403-421	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	409-427	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	225028-225046	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	225034-225052	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	901378-901396	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	173922-173940	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1919963-1919981	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1919969-1919987	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87130-87148	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87136-87154	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87142-87160	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87148-87166	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87154-87172	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87160-87178	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87166-87184	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87172-87190	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87178-87196	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87184-87202	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87190-87208	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP019064	Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence	181013-181031	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62753-62771	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62759-62777	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62765-62783	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62771-62789	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62777-62795	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62783-62801	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	380471-380489	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	380477-380495	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	380483-380501	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	380489-380507	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	114171-114189	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	114177-114195	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	114183-114201	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP017962	Synechococcus sp. NIES-970 plasmid plasmid3 DNA, complete sequence	22581-22599	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	CP027480	Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence	42063-42081	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	CP027480	Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence	42069-42087	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	CP027480	Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence	42075-42093	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	472400-472418	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	232707-232725	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1919963-1919981	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1919969-1919987	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_LR594663	Variovorax sp. RA8 plasmid 2	247215-247233	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_LR594663	Variovorax sp. RA8 plasmid 2	247221-247239	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_CP018726	Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.1, complete sequence	83380-83398	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP019635	Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence	45084-45102	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP019635	Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence	45090-45108	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP019635	Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence	45096-45114	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP019635	Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence	45102-45120	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_AP019635	Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence	45108-45126	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_MF190369	Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence	26179-26197	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_MF190369	Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence	26185-26203	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_MF190369	Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence	26191-26209	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NZ_MF190369	Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence	26197-26215	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	NC_048022	Eggerthella phage PMBT5, complete genome	27813-27831	1.0
NZ_CP004043_1	1.2\|100106\|19\|NZ_CP004043\|CRISPRCasFinder	100106-100124	19	MN693916	Marine virus AFVG_250M613, complete genome	2154-2172	1.0

1. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP018472 (Xanthomonas perforans strain LH3 plasmid pLH3.1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

2. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to MN175388 (Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

3. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to MN175388 (Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

4. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to MN175388 (Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

5. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to MN175388 (Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

6. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

7. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

8. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

9. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

10. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

11. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

12. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

13. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

14. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

15. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

16. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

17. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

18. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

19. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

20. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

21. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

22. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

23. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

24. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

25. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

26. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

27. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

28. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

29. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

30. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

31. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

32. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

33. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP019064 (Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

34. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

35. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

36. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

37. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

38. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

39. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

40. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

41. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

42. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

43. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

44. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

45. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

46. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

47. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP017962 (Synechococcus sp. NIES-970 plasmid plasmid3 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

48. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to CP027480 (Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

49. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to CP027480 (Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

50. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to CP027480 (Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

51. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

52. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

53. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

54. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

55. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

56. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

57. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_CP018726 (Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

58. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP019635 (Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

59. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP019635 (Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

60. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP019635 (Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

61. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP019635 (Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

62. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_AP019635 (Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

63. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_MF190369 (Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

64. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_MF190369 (Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

65. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_MF190369 (Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

66. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NZ_MF190369 (Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

67. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to NC_048022 (Eggerthella phage PMBT5, complete genome) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

68. spacer 1.2|100106|19|NZ_CP004043|CRISPRCasFinder matches to MN693916 (Marine virus AFVG_250M613, complete genome) position: , mismatch: 0, identity: 1.0

cggcaacggcaacggcaac	CRISPR spacer
cggcaacggcaacggcaac	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

324639 : 331633

Burkholderia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102812295.1\|324639_325760_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.1e-49	40.0
WP_004537646.1\|328267_328417_-	bacteriophage protein Gp44	Q8W6Q6	Burkholderia_virus	3.3e-19	100.0
WP_004542548.1\|328672_329254_+	hypothetical protein	A9YX38	Burkholderia_phage	2.2e-21	100.0
WP_161788725.1\|329484_329784_-	hypothetical protein	Q6JIH9	Burkholderia_virus	2.3e-35	100.0
WP_029248167.1\|329750_329972_-	hypothetical protein	NA	NA	NA	NA
WP_009975384.1\|330248_330524_-	hypothetical protein	Q6JIH4	Burkholderia_virus	2.6e-41	95.6
WP_009939402.1\|331191_331365_+	BrnT family toxin	NA	NA	NA	NA
WP_004525420.1\|331348_331633_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	1.4e-10	50.0

DBSCAN-SWA_2

484229 : 555765

Vibrio_phage(25.0%)

plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525541.1\|484229_484997_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_038757552.1\|485035_486037_-	HpnL family protein	NA	NA	NA	NA
WP_004525542.1\|486033_486807_-	hypothetical protein	NA	NA	NA	NA
WP_004188272.1\|486803_487493_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_004188420.1\|487857_489372_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_038729852.1\|491091_492030_+	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_004202234.1\|492063_492612_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190846.1\|492614_494120_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530039.1\|494263_494791_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004190879.1\|494870_495302_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_004196180.1\|495315_497178_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190851.1\|497174_498164_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_041188165.1\|498166_501037_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	1.8e-60	27.2
WP_004525548.1\|501027_503319_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004190563.1\|503484_505773_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004547074.1\|505776_507993_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004525550.1\|507992_509063_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004525551.1\|509065_509782_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004190606.1\|509824_510214_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004202226.1\|510219_510813_+	type VI secretion lipoprotein TssJ	NA	NA	NA	NA
WP_004525552.1\|510809_512171_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004525553.1\|512253_513912_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004525554.1\|513908_517412_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190863.1\|517470_517830_+	hypothetical protein	NA	NA	NA	NA
WP_004190471.1\|517852_518278_+	hypothetical protein	NA	NA	NA	NA
WP_004536812.1\|518598_518874_+	hypothetical protein	NA	NA	NA	NA
WP_004524288.1\|519424_520324_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_172644504.1\|520365_520668_-	hypothetical protein	NA	NA	NA	NA
WP_011205424.1\|520557_521877_+	glycosyltransferase	NA	NA	NA	NA
WP_004524286.1\|521873_523460_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_038776723.1\|523712_524708_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_004532079.1\|524833_525016_+	hypothetical protein	NA	NA	NA	NA
WP_041188166.1\|525012_526596_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004186853.1\|527112_528366_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_038756008.1\|528878_530543_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	5.4e-57	31.6
WP_041188167.1\|530675_532160_-	glycoside hydrolase family 68 protein	NA	NA	NA	NA
WP_004523134.1\|532445_533462_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004523135.1\|533919_535119_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_004198247.1\|535296_536322_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_161630907.1\|536335_536620_+	hypothetical protein	NA	NA	NA	NA
WP_004545861.1\|536755_538030_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	5.3e-105	54.1
WP_004186989.1\|538102_539074_+	membrane dipeptidase	NA	NA	NA	NA
WP_004186987.1\|539224_539758_+	4-vinyl reductase	NA	NA	NA	NA
WP_004186960.1\|539818_541882_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_041188168.1\|541884_543810_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_004202150.1\|543814_544987_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004530055.1\|544983_545769_+	drug:proton antiporter	NA	NA	NA	NA
WP_004523139.1\|545793_547062_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_038769379.1\|547082_548228_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004523141.1\|548337_549201_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004523142.1\|549381_551037_+	APC family permease	NA	NA	NA	NA
WP_004186920.1\|551123_551999_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_004554841.1\|552142_553015_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_041188363.1\|553177_554731_+\|holin	choline-sulfatase	NA	NA	NA	NA
WP_041188169.1\|554727_555765_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_3

2620446 : 2658524

Ralstonia_phage(25.0%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524833.1\|2620446_2620854_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	3.2e-11	36.5
WP_009927042.1\|2621286_2623320_-	hypothetical protein	NA	NA	NA	NA
WP_031313668.1\|2623560_2625732_-	alpha-galactosidase	NA	NA	NA	NA
WP_038750722.1\|2625736_2626588_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004524828.1\|2626588_2627512_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_004524827.1\|2627573_2628815_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004524825.1\|2628850_2630095_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_038784494.1\|2630137_2630776_-	hypothetical protein	NA	NA	NA	NA
WP_029670706.1\|2632547_2633702_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004524822.1\|2635044_2635785_+	hypothetical protein	NA	NA	NA	NA
WP_009960547.1\|2636213_2636369_+	recombinase family protein	A0A0C4UR34	Shigella_phage	2.0e-06	67.6
WP_161630900.1\|2636334_2636841_+	recombinase family protein	A0JC18	Ralstonia_phage	1.3e-17	51.7
WP_004557924.1\|2639127_2639694_-	suppressor of fused domain protein	NA	NA	NA	NA
WP_172644509.1\|2639695_2640178_-	hypothetical protein	NA	NA	NA	NA
WP_102804350.1\|2640442_2641566_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.5e-15	28.8
WP_102607710.1\|2642820_2644001_-\|transposase	IS3-like element ISBps1 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.2e-60	42.9
WP_076847189.1\|2644627_2645779_+	hypothetical protein	NA	NA	NA	NA
WP_071811398.1\|2645789_2646077_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038758212.1\|2649027_2649738_-	hypothetical protein	NA	NA	NA	NA
WP_038758213.1\|2649753_2651958_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-46	29.9
WP_004539258.1\|2651954_2654621_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.4e-78	30.7
WP_102812242.1\|2654633_2656091_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_038728075.1\|2656087_2657959_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004196148.1\|2657963_2658524_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP004042

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

2. NZ_CP004043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection