CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP007155	Kutzneria albida DSM 43870 chromosome, complete genome	20 crisprs	cas3,DinG,DEDDh,WYL,csa3,cas4,casR,RT	1	6	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007155_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_1

29361-29636

Orphan

Consensus_repeat	Method
GTACCCGCCGCCCTGCTG	CRT

4 spacers

The CRISPR arrays of NZ_CP007155_1

>merge|NZ_CP007155|1|29361-29636|CRT
GTAGCCGCCGCCCTGCTGGCCGTACTGGTCGTAGCCGCCGCCCTGCTGCGGGTAGCCCTGGTCGTAGCCGCCCTGCTGCGGGTACCCGCCGCCCTGTTGGGGGTAGCCCTGGTCGTACCCACCTTGCTGGGGGTAGCCCTGGTCGTACCCGCCGCCCTGCTGCTGCGGGTAACCCTGGTCATAACCGCCCTGCTGGGGGTACCCGCCGCCCTGCTGCCCGTACTGGTCGTACCCGCCCTGCTGGGGGTAGCCCTGGTCGTACCCGCCGCCCTGCTG

>NZ_CP007155|1|1|29361-29636|CRT
GTAGCCGCCGCCCTGCTG	GCCGTACTGGTCGTAGCCGCCGCCCTGCTGCGGGTAGCCCTGGTCGTAGCCGCCCTGCTGCGG
GTACCCGCCGCCCTGTTG	GGGGTAGCCCTGGTCGTACCCACCTTGCTGGGGGTAGCCCTGGTC
GTACCCGCCGCCCTGCTG	CTGCGGGTAACCCTGGTCATAACCGCCCTGCTGGGG
GTACCCGCCGCCCTGCTG	CCCGTACTGGTCGTACCCGCCCTGCTGGGGGTAGCCCTGGTC
GTACCCGCCGCCCTGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025353693.1\|27040_28471_-\|protein-phosphatase-2C-domain-containing-protein	unknown	unknown	gnl\|CDD\|223704
NZ_CP007155.1\|WP_025353694.1\|28467_28929_-\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|224630
NZ_CP007155.1\|WP_081789786.1\|18629_19661_+\|class-E-sortase	unknown	unknown	gnl\|CDD\|320679
NZ_CP007155.1\|WP_025353703.1\|38555_39830_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP007155.1\|WP_025353704.1\|40068_40434_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025353696.1\|30509_31595_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025353702.1\|37242_38556_+\|beta-glucosidase	unknown	unknown	gnl\|CDD\|274539
NZ_CP007155.1\|WP_025353686.1\|18216_18483_-\|cell-division-protein-CrgA	unknown	unknown	gnl\|CDD\|377706
NZ_CP007155.1\|WP_025353692.1\|25589_27041_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP007155.1\|WP_025353690.1\|22669_24103_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP007155.1\|WP_081789787.1\|36411_36966_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380058
NZ_CP007155.1\|WP_169743522.1\|19662_19818_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025353698.1\|32885_33545_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187554
NZ_CP007155.1\|WP_025353689.1\|20534_22535_-\|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP007155.1\|WP_025353688.1\|19836_20481_+\|aminodeoxychorismate/anthranilate-synthase-component-II	unknown	unknown	gnl\|CDD\|181107
NZ_CP007155.1\|WP_025353691.1\|24105_25593_-\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|223839
NZ_CP007155.1\|WP_025353700.1\|35197_36403_+\|amino-acid-deaminase/aldolase	unknown	unknown	gnl\|CDD\|143488
NZ_CP007155.1\|WP_025353697.1\|32234_32870_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_042221460.1\|40446_40665_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025353699.1\|33765_35109_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|130740

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025353693.1\|27040_28471_-\|protein-phosphatase-2C-domain-containing-protein	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	7.01456e-77
NZ_CP007155.1\|WP_025353694.1\|28467_28929_-\|FHA-domain-containing-protein	gnl\|CDD\|224630	COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms].	4.13312e-26
NZ_CP007155.1\|WP_081789786.1\|18629_19661_+\|class-E-sortase	gnl\|CDD\|320679	cd05830, Sortase_E, Sortase domain found in the class E family of sortases. Class E sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Actinobacteria). Genes encoding class A and E sortases are never found in the same organism, and similar to class A sortases, the genes encoding class E sortases are not positioned adjacent to genes encoding potential protein substrates, suggesting a housekeeping sortase function of class E sortases in some high G + C Gram-positive bacteria. Similar to class A sortase, class E sortases are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They recognize an LAXTG sorting signal, instead of the canonical LPXTG motif processed by class A sortases. The prototypical class E sortase from Corynebacterium diphtheria (named Cd-SrtF) is a non-polymerization sortase that is not required for pilus polymerization, and proceeds to complete the assembly process by anchoring the polymer to the cell wall peptidoglycan. Moreover, in Streptomyces coelicolor, one or both of Staphylococcus aureus SrtA homologs may function as class E sortase responsible for the cell wall anchoring of the long chaplin proteins (ChpA-C) containing an LAXTG sorting signal, which presumably mediate aerial hyphae formation. The family also includes some class E sortase homologs from Gram-negative and Archaebacterial species, but the functions of these enzymes are unknown.	3.20467e-49
NZ_CP007155.1\|WP_025353703.1\|38555_39830_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.61972e-24
NZ_CP007155.1\|WP_025353702.1\|37242_38556_+\|beta-glucosidase	gnl\|CDD\|274539	TIGR03356, BGL, beta-galactosidase.	0
NZ_CP007155.1\|WP_025353686.1\|18216_18483_-\|cell-division-protein-CrgA	gnl\|CDD\|377706	pfam06781, CrgA, Cell division protein CrgA. CrgA is a trans-membrane (TM) protein, first described in Streptomyces as being required for sporulation through the coordination of several aspects of reproductive growth. In Mtb (Mycobacterium tuberculosis ) CrgA is a central component of the divisome, and consists of 93 residues with two predicted TM helices (TM1: residues 29-51; and TM2: residues 66-88). CrgA facilitates the recruitment of the proteins essential for peptidoglycan synthesis to the divisome and also stabilizes the divisome. Reduced production of CrgA results in elongated cells and reduced growth rate, and loss of CrgA impairs peptidoglycan synthesis. CrgA has homologs in other actinomycetes.	7.17149e-43
NZ_CP007155.1\|WP_025353698.1\|32885_33545_+\|NAD(P)H-binding-protein	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.31821e-54
NZ_CP007155.1\|WP_025353690.1\|22669_24103_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	9.72318e-114
NZ_CP007155.1\|WP_081789787.1\|36411_36966_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380058	pfam17928, TetR_C_22, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present the TetR Transcriptional Repressor present in sco1712 proteins from Streptomyces coelicolo which act as a regulator of antibiotic production.	8.56782e-29
NZ_CP007155.1\|WP_025353692.1\|25589_27041_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	7.33374e-83
NZ_CP007155.1\|WP_025353689.1\|20534_22535_-\|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.85475e-132
NZ_CP007155.1\|WP_025353688.1\|19836_20481_+\|aminodeoxychorismate/anthranilate-synthase-component-II	gnl\|CDD\|181107	PRK07765, PRK07765, aminodeoxychorismate/anthranilate synthase component II.	1.36206e-135
NZ_CP007155.1\|WP_025353691.1\|24105_25593_-\|penicillin-binding-protein-2	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	4.41721e-85
NZ_CP007155.1\|WP_025353700.1\|35197_36403_+\|amino-acid-deaminase/aldolase	gnl\|CDD\|143488	cd06813, PLPDE_III_DSD_D-TA_like_2, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 2. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible members of this family also form dimers in solution.	0
NZ_CP007155.1\|WP_025353699.1\|33765_35109_-\|FAD-binding-protein	gnl\|CDD\|130740	TIGR01679, bact_FAD_ox, FAD-linked oxidoreductase. This model represents a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae.	5.31481e-115

>NZ_CP007155.1|WP_025353694.1|28467_28929_-|FHA-domain-containing-protein
MPELVLQLTRAGFLALLWLFVLAALRVVRSDLYAASGLRAAVPGVFRKGTKQPAKGKTARQLVVTQGALAGTRISLDGRPILVGRADDSTLVLDDDFASTRHARLSLRGSDWYVEDLGSTNGTYLDRAKVTAPLRVPLGAPIRIGKTVIELRT
>NZ_CP007155.1|WP_025353693.1|27040_28471_-|protein-phosphatase-2C-domain-containing-protein
MTLVLRYAARSDRGLVRSNNQDSVYAGPRLLALADGMGGHAAGEVASKVVVAALAPLDDDEPGDDLLDQLRGAVLDGNGAIAELVAHDPDLDGMGTTLTAVLFSGNRLGLVHVGDSRAYLLRNGSFTQITHDDTFVQSLIDEGRITEEEANVHPQRSLLLRALTGHEVEPSLAVREARANDRYLLCSDGLCSYVSHETLTEAIKIPDPQACADRMIELALKAGGPDNVTVIIADVVDVDFGDDAPIVGGAAGDGSSEQPPPDSPASRAGAITAARTPPPQPLAVQPPEPDPKARTRKRVRLAVWIVVVLAVLGIGAAGTAWWVLSQYYVGATEDNKVVIFQGVKGGPVLGVALHRVAESSCLDAAQQNCQALTLDDLQESAREDVRKGVIADKQGLEGARDTVKRLWHNALLAPCSATPVPTSAGQPTSTTSATSTTVPPSSATATGAAATSTHATTESSAPGEPQVPGRNCRKVG
>NZ_CP007155.1|WP_025353692.1|25589_27041_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MSLPPGVLGAATTHMNVSGQPSATPTRRGTELAMLGFVAGLVALALVVISENQTQSLNPNLLLYVGGYAVLCAGAHFAVRKFAPYADPLILPCAALLNGLSIAMLYRLDPVLALRAFNNGDSYSNAAPKQLIWTAVSLVVMTLTLWLVKDHRTLARYGYTFGLAGLFLLVLPGVLPCSISCAGGAKLWIILGPVSIQPGEFAKVLIIVFVAAFLVSKRDLFTIAGRKVLGLELPRLRDTGPLLIAWAVAIVVLMIEKELGASLMFFGTVLVMVYLATERSAWIWIGVVLFIGGATVAYKLFTHVQTRVTNWVDPFADAQNDGFQMVQSLFSLGSGGVAGSGWGAGHPELVPVIQSDFIVAAFGEELGFIGLAAMLLVYMLLAMRGLRSGLAVRDTFGKLLAGGLAFLLLWQVFVVVGGISKLIPQTGLTAPFLSAGGSSLIASYIMVALLLRISDAARRPQATRPKPQAPIAEANTVLVERPS
>NZ_CP007155.1|WP_025353691.1|24105_25593_-|penicillin-binding-protein-2
MNKPLRRVGLAMMVMVLLLLANLTYVQVIKADTYASDPSNRRSLLEEYSRQRGQIVSSTGTILANSVETKDSQRFLRQYPNGAMYAPITGYYSSLYGASGIESAEDDVLNGSSPKLFVRRLSDLITGRDPRGGNVKVTIDPKAQAAAYNAMTAKGYTGSVVAIKPSTGEILAMVSTPSYDPNPLSSHSSTDQSKLMDQLNKDQNQSGMNRAIREKLPPGSTFKLVVGAAALSNGTADATTPSLPADASITLPGTSTPLANFANQACPESSNNQVSMTVAMKYSCNTAFSTLAGKVGKDNLIAQAAKFGIGQTDLSIPLSVVPSTVGSIPDQAALYQTGIGQRDVALTPLQDAVVAATIANGGVRMQPQLVKDILAPDMSSISSFSPEEAPGGPAVSKDVANQLRDMMIQSEQHTGGEGKVAGRVIASKTGTAEHGTTPKQTPPHAWYVAFTPADNQQIAVCVVVENGGDRGLAATGGSVAAGIGRATINAYLSGG
>NZ_CP007155.1|WP_025353690.1|22669_24103_-|serine/threonine-protein-kinase
MLTSGQLLADRYRLVRRIAVGGMGEVWEATDSRLDRAVAIKVLKPELSGDAEFLHRFRTEARTTASLNHPGIAAVHDYGETASVPDGPQDTAYLVMELVEGDPLAALIARNGRLRADWTLDILHQAGTALQAAHERGYVHRDVKPGNILVTPNGKVKITDFGIAKAADAAPVTRSGMVMGTAHYIAPEQAVGQEAEPASDVYSLAVVGYECLVGHRPFLSENAVTVAMMHIREIAPPLPPDVPPGTRALIEATLVKDPRQRYRDGGEFAAAVGAVRAGLPLPTPSGLAVAAPMHVQGQPGGPPSYPQSATPMGSIPVVPQQGPPAGAPMSPGTGTFLLGPPPQNRPNRVGLWVLLAVLVAVLVALLAAWGVHAWLGSPGGTAPGSGSTGQHPTAGVMGSDRDVPQAVTVDEAAYRGTTAAAAEERLRQQGLSPEVRTATGGQPTDPQRCWVSGVTPNGLVAARSTVAVLCSERGPGG
>NZ_CP007155.1|WP_025353689.1|20534_22535_-|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase
MSTPRLLSNRYELGDTLGYGGMSEVHKGRDVRLGRDVAVKVLRADLARDPQFQERFRREAQNAAALNHPAIVAVYDTGETRTEYGPLPYIVMEYVDGRTLRDIVKTQGPLSGKRAMEVMADVCAALDFSHRHGIIHRDVKPANVMITKTGAVKVMDFGIARAVHDGQAAVTQTAAVIGTAQYLSPEQARGEAVDARSDVYAAGCVLFELMTGQPPFTGDSPVAVAYQHVREEPPAPSSVNPQVTPALDSIVLKAMAKGPANRYQSAAEMRADLVRVLSGQRPSAPAVMTAEDRTSIMGNGSARTQVVGRHRPAPAEEESSYDPYDAEAEEAEERRRRRKKALTIGGVVVACIAVLALAAWLTTQLLGGGGGSTANSLPDVTKMKQTVATSTLHDAGWTNVVSETVACSTPVNGGQAACGTDDIGKVIKQDPAAGSATDKGAKITLTIGAAPQAKPVPDVSGKSQADATKILNEAGFNVNPNTGTEATDNPALVGNVSSTNPAAGTSATPSTQITLLLGKAPESQTVPDVRNQTYEAASANLTQAGFKVSKQTISSTQPAGIVVKQNPDGGSKQKPNTTITLFVSQGDQFTMINIAGKTKSEAQQALQALGWKGNFSTTEVNTTDPTQVGKISDFDPSVGSSVSQNSSINIRVYKFGLGTTTSSSNN
>NZ_CP007155.1|WP_025353688.1|19836_20481_+|aminodeoxychorismate/anthranilate-synthase-component-II
MRVLVVDNYDSFVYNLVQYLAQLGAECVVRRNDAVELAEVDGVDGVLISPGPSTPERAGASTEVIRHCAERGVPVLGVCLGHQAIGVVFGATVDRAPELLHGKTSLVRHTGTGVLAGLPNPFVATRYHSLTVLPETIPAELEVTGRTESGVVMGMRHRELPIEGVQFHPESVLTDGGHRMLANWLATCGHPVPEERVAELEEGMRRLAAAASVG
>NZ_CP007155.1|WP_169743522.1|19662_19818_+|hypothetical-protein
MYGWIWRHLPGPVALKVVEALLLVAGIVALLMLVVFPWIEPKLPFNQVTTG
>NZ_CP007155.1|WP_081789786.1|18629_19661_+|class-E-sortase
MPPPRGGRPAGWRPRPGPDQPTEFIPRIDVIEHDNGADQPTSELYTHRSAAEDDTAFVDDIPYYEEDEEDEAPPPPKETGRKVVRTIGELFITAGMVILLFVVYEVYWTDLISAGKQNQATSSLDTQWKDTVGDPGNQRGTHYDLTEGQGFAKIYIPALGPDYHFTLVEGTTDADLDIGPGHYKGTALPGEPGNFAVAGHRVGKGAPFNDLDLVSSCDAIVVETKTDWFVYRMMPKAEERASWDTSGKGTQPRCKGVKIGGAYSGVVGQETVLPSQGDVIAPVPHQPEAKLQADKIVKLMTLTTCTPKFSASHRLILHAVLTNSYHKDPAHPDVTPTELKETD
>NZ_CP007155.1|WP_025353686.1|18216_18483_-|cell-division-protein-CrgA
MPKSKVRKKTVYTPPTDRRTPVKAKLAGPSHPLYVAAMLGIMLLGLAWLVVYYLVPTGIPFMEPLAAWNFAIGFALMIIGLLMTMKWR
>NZ_CP007155.1|WP_025353696.1|30509_31595_-|hypothetical-protein
MPNRTSLIRRLAELRSSYTGETDSSVLPAISQGGQLLDPDERAQLLSTLAHNWVTRALGENSLPPLPARIRQAVLPDATTRDQRELESGILAAAGRAVNYLHLRRPADLLRPARVFRMVRSLPGDLVLHIEPPALAPLMLELMPRITADDVLGLPGLRARLHRRHVELYLVDTDPPATVLISNVSYRQWLAAMAFVESAAPVSGGVRWLGNDVQPLTPQEAEVLASRHRAPGPAHLTSALLRRALVFGDALWFSSWANGCATAKVEWPLGPSLPQVASKLIHPVFGLPGDIFRIHHPNEDYLAITDEAGPRCADHPLSGAACLVLRPTHGPDSGFAEHVLTTGWHEAAAPWDEWAATLTPK
>NZ_CP007155.1|WP_025353697.1|32234_32870_+|hypothetical-protein
MSRPAGNTAAGNTAAVHKNANALPTRAVPAIELPAPADQLAAQAVERLGWKGVVLPQLTLLGRKVVVVAELLPDAHAERLCFGCGPVVDRTTVATWVWPELAGRVPPPAIRIVGVVAVAKHWRTGLASAVPFALHGDAAVVLPSSVALTDDYLTNCLPRARRYGVSVVTADPDGSVSMDLAGPQEHLPAEQTAVSRWVNEVVYEQVLATAS
>NZ_CP007155.1|WP_025353698.1|32885_33545_+|NAD(P)H-binding-protein
MRVVIAGGHGKIALELERLLAARADAPVGLVRNPDHTEDLHAAGAEAVVCDLERAGADELAGHLKGADAVVFAAGAGPGSGADRKDTVDRAAAVLLAEAAELAGVRRYLLVSSMGVDRAPAPGTDEIWAAYLRAKLAAEQEVSARDLDWTVLRPGGLTDDAPTGQVHLAPPSVPRATVTRADVAAVLAALLDEPRTAGQVLELVNGEVPISSAVRSLLN
>NZ_CP007155.1|WP_025353699.1|33765_35109_-|FAD-binding-protein
MVGRIPTGTRSARPAPWQNWAGTERCHPVHVARPGSVEGIAEAVRNAARDGFTVRPRGSGHSFTGVAATDGVAMDLGEWSGLVSAEGSTGLVTVRSGTPLHQLNSELDRLGLAMANLGDIDTQTVSGAISTGTHGTGARLGGLATQVRGLELVLADGSMVSCSPGERPELFSAARVGLGALGVISTVTLQCVPSFVLHAREYPGRLDEILERFDELTESEDHVEFHWFPHGDRVLVKRNTRLPAGTAPEPMSRARRFYEYELMENGAFGLVCRLGRAIPSTVPALNRMVANLVSERSYSDVSHRVFTTPRRVRFVESEYAVPRESLHEVLREFRASMPTLKHPVIVPVEVRVAAADDIPLSTAYGRDTAYIAIHQYLGMPYRDYFDRFESIVGAVGGRPHWGKMHTLRAEDLAERYPRFEDFRKVRAAVDPDGVFRNAYLDRVLGQP
>NZ_CP007155.1|WP_025353700.1|35197_36403_+|amino-acid-deaminase/aldolase
MSPQQQRVRYDAATEGIDPPLAIVDLDAFDHNATELVRRAAGRPIRVASKSVRCRTLLERVLELPGYAGVMAYSLDEARWLVAEGVSQDVLVGYPTVDRAALQKLAVDEAARAAVTIMVDSVRHLDLVDAALGGGHPDIRVCLELDASWRPLRGSRAVHVGPLRSPVHTPADALALAKQVLARPGFTLVGIMAYEGQIAGIGDAPPGKPLRAAAVRWMQRHSASELAGRRAEAVAAVSALTPLEFVNGGGTGSLERTAEESAVTELAAGSGLLGPTLFDTYQGFQPRPAALFALPVVRRPGPHSATLFAGGYLASGPIGPDRVPTPYLPTGLKLTALEGAGEVQTPVVGKAVAQLGVGDRVWLRHAKAGELAERFREFHLVRGYQVERTAPTYRGEGHAFG
>NZ_CP007155.1|WP_081789787.1|36411_36966_-|TetR-family-transcriptional-regulator
MLEACAALIEEVGYDGVTTTLIAERAGVAVGSLYQFFPDKRAVVQALTLRNLERFMAVVVQRFESTELDHWWDAVDSMFDVYVEMHRTVPAFSRLHFGDVVDTRLLDEGKDNNTVIAEGLAAIIAQRFDRSMDELALPVAVAIEAADGVLKFAFRRNDSGDQKVVDEAKSMIKGYLSTRLGDPE
>NZ_CP007155.1|WP_025353702.1|37242_38556_+|beta-glucosidase
MTEPALPSFPDGFLWGVSTSAYQVEGAVSEGGRGRSTWDTFCATPDRVYSGHTGEVACDHYHRYPEDIALMSQLGVDAYRFSIAWPRIQPEGTGPANAEGLGFYDRLVDALCEAGIAPAATLYHWDTPQPVEDAGGWLSRDTAKHFADYAALVGERLADRVAMWIPLNEPMVTTVYGYGIGQYAPGQFLLLDSVPTAHHQNLAHGLAVQALRAAGARQIGTANNHGPIWSATDSAADRAAADYASDLLNWLFADPVLAGSYPEQLHPLLPTGFAEDLPTIAAPLDLYGVNYYEPTQVSAPSEGNPLPFDLGAVEGYPMTTNGSPVVPDGFRQFLLELRDRHGSALPPVYITENGCSYDGVDDQQRIEFLDGHLRALHAAMQQGVDVRGYFVWSLLDNFEWSKGYQPRFGLVDVDYTTQCRTPKSSFHWYRALIGGTR
>NZ_CP007155.1|WP_025353703.1|38555_39830_+|MFS-transporter
MAQAAELDGGPFDDGDRALTEPVTKVRGGWTTLLFLANLGLWLGIYAPIQVLLPEQAELLAHSDKEAVFSLVTGIGAVVALFANPVIGALSDRTCSRLGRRHPWTLLGAALGAVGLLVLAAAPNVPVMVLGWSLVQAGLNGMLASLTAALPDRVPVDQRAEIGGFIGISQMLGTVAGAALVSVVITGISPGYAACAVLVVLGALAFVLCTPDAVLPRRLRPGGRFREVVANLWISPRRHPDFGWGWGTHFMVNFGNALGTLYLLYFLADAVHYPDPTTGLLILMALYGVALIIGALVAGRMSDSSGRRKPYVVASSLVMALAAAVLVVSQSWPAALVAAPLLGVGFGVYWAVALAVLTQVLPAASNRAKDLGVINVANSLPLVIAPVVAGLVLGTTGGYPALFALSAVATLVGGFMVTRIRAVT
>NZ_CP007155.1|WP_025353704.1|40068_40434_-|hypothetical-protein
MDEILGQVLRNAVWERLDMLSELANQADAPSLLSVARSELPRLTDGWRALLAAHEPDERGNCPECSTRWRQQKSPCSVWRAAYEHLVAGGLAARPARHMLSHQEQPAPVQRGAHRTALAAH
>NZ_CP007155.1|WP_042221460.1|40446_40665_-|hypothetical-protein
MVERAATPSVGTRRAWRIHCSDVVNRERCLTVVVDKGKVVLVGPPGETAVLSAGQLGQLRTALREAADQAER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_2

643216-643324

Orphan

Consensus_repeat	Method
GACATCTCGGCCCCGCAGAACGTGCCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_2

>merge|NZ_CP007155|2|643216-643324|CRISPRCasFinder
GACATCTCGGCCCCGCAGAACGTGCCGAGCGGCCCGTACCCCACCGGCGGCTACGTGGTTCCCGGCCAGGCCCCGGTACCGGACATCTCCGCCCCGCAGAACGTGCCGA

>NZ_CP007155|2|1|643216-643324|CRISPRCasFinder
GACATCTCGGCCCCGCAGAACGTGCCGA	GCGGCCCGTACCCCACCGGCGGCTACGTGGTTCCCGGCCAGGCCCCGGTACCG
GACATCTCCGCCCCGCAGAACGTGCCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_042220167.1\|645872_646295_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133388
NZ_CP007155.1\|WP_042220170.1\|652227_653544_+\|citrate-synthase	unknown	unknown	gnl\|CDD\|180164
NZ_CP007155.1\|WP_025354268.1\|648791_649925_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173847
NZ_CP007155.1\|WP_081789168.1\|636874_637666_+\|urease-accessory-protein-UreG	unknown	unknown	gnl\|CDD\|349776
NZ_CP007155.1\|WP_025354264.1\|644970_645876_+\|aldose-1-epimerase-family-protein	unknown	unknown	gnl\|CDD\|185699
NZ_CP007155.1\|WP_025354255.1\|634588_636310_+\|urease-subunit-alpha	unknown	unknown	gnl\|CDD\|237304
NZ_CP007155.1\|WP_025354267.1\|647434_648649_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|238634
NZ_CP007155.1\|WP_025354266.1\|646321_647395_+\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NZ_CP007155.1\|WP_035970132.1\|641215_642106_-\|arginase-family-protein	unknown	unknown	gnl\|CDD\|212523
NZ_CP007155.1\|WP_081789169.1\|639349_640654_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|236700
NZ_CP007155.1\|WP_025354261.1\|642247_643129_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213235
NZ_CP007155.1\|WP_025354258.1\|637662_638424_+\|urease-accessory-protein-UreD	unknown	unknown	gnl\|CDD\|376611
NZ_CP007155.1\|WP_025354270.1\|650714_651656_+\|carbohydrate-kinase	unknown	unknown	gnl\|CDD\|238572
NZ_CP007155.1\|WP_025354253.1\|633972_634275_+\|urease-subunit-gamma	unknown	unknown	gnl\|CDD\|183913
NZ_CP007155.1\|WP_025354259.1\|638632_639292_+\|pyridoxamine-5'-phosphate-oxidase	unknown	unknown	gnl\|CDD\|273138
NZ_CP007155.1\|WP_025354269.1\|650052_650646_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP007155.1\|WP_025354263.1\|644235_644874_-\|DUF3558-family-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025354254.1\|634286_634592_+\|urease-subunit-beta	unknown	unknown	gnl\|CDD\|376370
NZ_CP007155.1\|WP_025354272.1\|654189_654636_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025354256.1\|636315_636984_+\|urease-accessory-protein-UreF	unknown	unknown	gnl\|CDD\|223900

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_042220167.1\|645872_646295_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133388	cd01282, HTH_MerR-like_sg3, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	4.2994e-35
NZ_CP007155.1\|WP_042220170.1\|652227_653544_+\|citrate-synthase	gnl\|CDD\|180164	PRK05614, gltA, citrate synthase.	0
NZ_CP007155.1\|WP_025354268.1\|648791_649925_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	1.86638e-169
NZ_CP007155.1\|WP_081789168.1\|636874_637666_+\|urease-accessory-protein-UreG	gnl\|CDD\|349776	cd05540, UreG, urease accessory protein UreG. UreG is one of the four accessory proteins of urease. Urease is an enzyme which catalyzes the decomposition of urea to form ammonia and carbon dioxide. Bacterial urease is a trimer of three subunits which are encoded by genes ureA, ureB, and ureC. Up to four accessory proteins (ureD, ureE, ureF, and ureG) are required for urease catalytical function. UreG may play an important role in nickel incorporation of the urease metallocenter. UreG is a member of the Fer4_NifH superfamily which contains an ATP-binding domain. Proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.	7.94052e-107
NZ_CP007155.1\|WP_025354264.1\|644970_645876_+\|aldose-1-epimerase-family-protein	gnl\|CDD\|185699	cd09022, Aldose_epim_Ec_YihR, Aldose 1-epimerase, similar to Escherichia coli YihR. Proteins similar to Escherichia coli YihR are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.	1.1465e-127
NZ_CP007155.1\|WP_025354255.1\|634588_636310_+\|urease-subunit-alpha	gnl\|CDD\|237304	PRK13206, ureC, urease subunit alpha; Reviewed.	0
NZ_CP007155.1\|WP_025354267.1\|647434_648649_+\|amidohydrolase	gnl\|CDD\|238634	cd01309, Met_dep_hydrolase_C, Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	5.45439e-146
NZ_CP007155.1\|WP_025354266.1\|646321_647395_+\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	3.30332e-171
NZ_CP007155.1\|WP_035970132.1\|641215_642106_-\|arginase-family-protein	gnl\|CDD\|212523	cd09999, Arginase-like_1, Arginase-like amidino hydrolase family. This family includes arginase, also known as arginase-like amidino hydrolase family, as well as arginase-like proteins and are found in bacteria, archaea and eykaryotes, but does not include metazoan arginases. Arginase is a binuclear Mn-dependent metalloenzyme and catalyzes hydrolysis of L-arginine to L-ornithine and urea (Arg, EC 3.5.3.1), the reaction being the fifth and final step in the urea cycle, providing the path for the disposal of nitrogenous compounds. Arginase controls cellular levels of arginine and ornithine which are involved in protein biosynthesis, and in production of creatine, polyamines, proline and nitric acid.	1.11873e-63
NZ_CP007155.1\|WP_081789169.1\|639349_640654_+\|MFS-transporter	gnl\|CDD\|236700	PRK10489, PRK10489, enterobactin transporter EntS.	4.49232e-57
NZ_CP007155.1\|WP_025354261.1\|642247_643129_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213235	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter. The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.	7.07931e-87
NZ_CP007155.1\|WP_025354258.1\|637662_638424_+\|urease-accessory-protein-UreD	gnl\|CDD\|376611	pfam01774, UreD, UreD urease accessory protein. UreD is a urease accessory protein. Urease pfam00449 hydrolyzes urea into ammonia and carbamic acid. UreD is involved in activation of the urease enzyme via the UreD-UreF-UreG-urease complex and is required for urease nickel metallocenter assembly. See also UreF pfam01730, UreG pfam01495.	4.67542e-24
NZ_CP007155.1\|WP_025354270.1\|650714_651656_+\|carbohydrate-kinase	gnl\|CDD\|238572	cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.	1.25943e-82
NZ_CP007155.1\|WP_025354253.1\|633972_634275_+\|urease-subunit-gamma	gnl\|CDD\|183913	PRK13241, ureA, urease subunit gamma; Provisional.	1.1579e-63
NZ_CP007155.1\|WP_025354259.1\|638632_639292_+\|pyridoxamine-5'-phosphate-oxidase	gnl\|CDD\|273138	TIGR00558, Pyridoxine/pyridoxamine_5'-phosphate_oxidase, pyridoxamine-phosphate oxidase. This model is similar to Pyridox_oxidase from Pfam but is designed to find only true pyridoxamine-phosphate oxidase and to ignore the related protein PhzG involved in phenazine biosynthesis. This protein from E. coli was characterized as a homodimer with two FMN per dimer. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine].	4.83152e-105
NZ_CP007155.1\|WP_025354269.1\|650052_650646_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.84567e-05
NZ_CP007155.1\|WP_025354254.1\|634286_634592_+\|urease-subunit-beta	gnl\|CDD\|376370	pfam00699, Urease_beta, Urease beta subunit. This subunit is known as alpha in Heliobacter.	3.06942e-59
NZ_CP007155.1\|WP_025354256.1\|636315_636984_+\|urease-accessory-protein-UreF	gnl\|CDD\|223900	COG0830, UreF, Urease accessory protein UreF [Posttranslational modification, protein turnover, chaperones].	3.57465e-28

>NZ_CP007155.1|WP_025354261.1|642247_643129_+|ATP-binding-cassette-domain-containing-protein
MLSVRGLTKVYAGRPVVDQVGFDLQPGTVTAFLGPNGAGKSTTLRMICGLTPPTAGGALVGGRPFTAWPNPCYAVGALLDASATHPGRTGRGQLQMAVNLTGLPARRVDEVLDMVGMTQYANRKIGTYSLGMRQRIALAHALLADPPLLLLDEPINGLDPDGIRAIRALMKMHAARGGSVLVSSHLLSEVDQTADRVLVINAGRIVADGPVSMLTAPTHRCLVRAKDMAKLAEVLSWQEIAVQPQPTGFLLADATVDRVSEVTFAAGIPLLGLREEERNLEEMYFQLTEGVHQ
>NZ_CP007155.1|WP_035970132.1|641215_642106_-|arginase-family-protein
MAITVLDAPTNLGLRPPAPGFEPGCAKAPAALRGAGLLGRLAAHDAGELTAPRYDVSGWQPGDGVRQAAAINAYSQQLAQRLDKLLDHTFPLVLGGDCSILLGTGRALRHRAERENRRYGLAFLDGHSDFRHPGNSTAIGSAAGEDLALATGRGQADVACRLFEDADVVVLGIREEDEDRAELSGLGIAHRTAAGIREAGAAESAEWARRRLDELDGFWVHLDVDILDPSVMPAVDAPDPGGLEHAELAELLTGLTVAPGCMGVEVTVFDPDLDPHGQYAAALVDTLARGLAPRVA
>NZ_CP007155.1|WP_081789169.1|639349_640654_+|MFS-transporter
MVTAETSDPAAPTAEPARSRGGLLAKVVLDTRPLRIPAYRRLWLSTVVTAIGSQLTAVAVPKQVYDLTKSSAYVGLAGAVALVPLLVFGLWGGAIADAVDRRKLLIVTNVGICVTSVLLWVQAAVGLGSVSVVLALLGLQQVFFAVNMPTRSASIARLVPAELLPSAGALGSTVMQFGAVIGPMLAGVLIPVLGLSTLYLIDAVALTAALWSVWMLPSLPPLGGASRKVGLRAVVDGFRYIATQSVLLASFLADIVAMVFGMPRALFPEMAEQTFHDPAGGGNALGWLFAAIPIGALVCGLLSGWLSRVGRHGVAVAASVCVWGLAVAGFGMSTSLWAAVGFLALAGAADMVSMVFRGAILQSAATDEMRGRMQGVFTVVVAGGPRLADVLHGTVGAALTPAAAVTGGGVAVVVIIVIAVLALPAFWRYRAPVG
>NZ_CP007155.1|WP_025354259.1|638632_639292_+|pyridoxamine-5'-phosphate-oxidase
MPDAQSNVALPAMRVSYEQGSLEEKLLAATWHEQLALWLDEAIRAGAPEPNAMVLATADTQGRPSSRTVLAKGLDERGLVFYTNYTSNKSHDLIATRYASATFPWLVMQRQATVRGTVEKVSAAETAAYWNSRPRGSQLGAWASPQSRVVNDRTVLESALANIQRQFADAERVPVPPHWGGWRIRPESVEFWQGRQDRMHDRLCYRLGRDGWTVNRLAP
>NZ_CP007155.1|WP_025354258.1|637662_638424_+|urease-accessory-protein-UreD
MKASARLVVEADPAGRTTVRELASASPLTLLPQRGRVRRAGEPAVVHLVSSATAPLGGDDLHLSVLVGPGAALRLSGVAASLALPGHRGEPSRYTVHIEVAEGGAVQYLPEPTVITARAWHSARLTVNLAATARVRCREVLVLGRSGERAGRFTGESHVLRDGTALLRQRIEIGDEELFRSAAYLAGRRVLATETVVWGADPENALSSDWWSLQPMARGGSLATALAEDAVAAEQGLRAALTGHPGLAAQAPD
>NZ_CP007155.1|WP_081789168.1|636874_637666_+|urease-accessory-protein-UreG
MPCPPGNCPRRARPRSTCSPSPTNGSTARRCVSLSADHDHPVNFDPTSTGHDPHHAHDIADRAFRIGIGGPVGSGKTALVAALCRALGGELELAVVTNDIYTTEDADFLRRAGVLDPERVEAVQTGCCPHTAIRDDISANLDAVERLEQRFRGLKLVIIESGGDNLTATFSRGLVDRQVFVVDVAGGDKVPRKGGPGVTTADLLVINKIDLAELVGADMAVMVSDAHRMRGHRLPVITQSLTATPEAPEVSDWVRKQLAGQHG
>NZ_CP007155.1|WP_025354256.1|636315_636984_+|urease-accessory-protein-UreF
MCTAALVLADSRFPGGGHAHSGGIEEVAARGMLRDERDLRSFLVGRLRSAGLVAAVFAAAATDLTRDWTELDVEFDARTPSPAQRAASRAQGRSTLRAGRAAWPSPALDKLVAEVPAPHHAVTVGALIGAAGGTPAEAAHCAGYLAVSGPASAAVRLLGLDPFAVNAVVAGLAPELAAVTELAERGHALPAGELPAPSSPALDLFAESHERIHRQEVRLFVS
>NZ_CP007155.1|WP_025354255.1|634588_636310_+|urease-subunit-alpha
MNSIDRHRYAELFGPTTGDRIRLADTNLLIEVTEDRCLGPQGAGDEVVFGGGKVIRESMGQSTATRAEGAPDVVITGAVVLDHWGVVKADVGIRDGRVVGIGKAGNPDTMDGVDPGLVIGPSTEVIAGNGRILTAGGIDCHVHFICPQLVDQALATGLTTLIGGGTGPAEGSKATTVTPGSWNLARMLQSMDFQPVNILLLGKGNTVSEPGLWEQLRGGAGGFKLHEDWGTTPAVIDAALRVADASGVQVAIHTDTLNEAGFVESTVDAIAGRSINAYHTEGAGGGHAPDIIKVVGEPNVLPSSTNPTRPHTVNTLDEHLDMLVVCHHLNPSVPEDLAFAESRIRPTTIAAEDLLHDLGAISMISSDSQAMGRIGEVVIRTWQTAHVMKARRGALPGDGAADNLRARRYVAKYTINPAIAHGIDHEVGSVEVGKLADLVLWEPKFFGVRPHLVLKGGFVAWAAMGDANASIPTPQPVLARPMFGAAPRVAAASSVHFVARAAIEDGLVDRLGLSTPLLPVADTRRRGKADMLLNDALPEVRVDPDSFAVHVDGELVEPAPVTELPLAQRYFLF
>NZ_CP007155.1|WP_025354254.1|634286_634592_+|urease-subunit-beta
MYPGELIPGEQPVPLNPGRPRITLLVVNRADRPVQVGSHYHFAAVNPGLDFDRDAAWGHRLDIPAGTSVRFEPGVERTVDLVPLGGRRVVPGLRKEWAGEL
>NZ_CP007155.1|WP_025354253.1|633972_634275_+|urease-subunit-gamma
MHLTPHERDKLLVHVAADLARRRLARGVLLNYPEAVALITDHVLEGARDGEPVSALMASGRQVLSREQVLDGVPEMIDSVQVEATFPDGTKLVTVHDPIV
>NZ_CP007155.1|WP_025354263.1|644235_644874_-|DUF3558-family-protein
MRKRDLLVVGLAAAALTGCGAPGQPAAEPGKAATLSEDVIPYDTTVFMTNRNPVLPADGGCGPVTRDFLVQIGMTLDKYEKPSTDSSGKTCSIYTRDAQLQVASAHKPFGDYWRSRASETSDPAATSSLGGFRRFILQGTYYAVEYPDKYNETYRSSPRKCNLAIDTGAPVPLTLTYTGTETTEFRQTCASAEKYATALLSKLDPGGGSRVG
>NZ_CP007155.1|WP_025354264.1|644970_645876_+|aldose-1-epimerase-family-protein
MSGPTGAQFEITYGTARAVVTGIGAGLRVFEVAGQPYVETFAESEAPPMGSGNVLAPWPNRVAGGRWRFDGAEQQLELTEPARGNASHGLVRKVPWQVITHTGSLISLGVEVGVQPGWPVPLRVTISYALDAHGLTVTHGVHNIGDRAVPFGIGTHPYVRAGASATDDCTLRLAATTSLPLDPESMVPCGPQVGLSRTEVDFRRPRSLRGERLDHAFGGCVPGADGLVRHRLTGPKTAVELWADPDFRWVQVYTPDEFPGRGRAVAIEPMTCPPDALNSGIDLITLAPGDAWSGRWGLIPR
>NZ_CP007155.1|WP_042220167.1|645872_646295_-|MerR-family-transcriptional-regulator
MSEAKPCAAGHTREGAVRIGELATRTGVSVRSLRYYEEQRLLTSTRSPSGQRHYTVEEVERVAFIQRLYAAGLSSSTILQLLPCVDSPSEENSDAALERMAQERDRLSAHIDDLLCTLDALDHLMAANRAHKATLRTARH
>NZ_CP007155.1|WP_025354266.1|646321_647395_+|alkene-reductase
MTSLFDSYRLGDLTLPNRVVMAPMTRVRATAEGLATPSMATYYAQRATAGLIVTEGVQPNVVGQSNPGTPGLHTEEQVAAWRPVTAAVHANGGRVFAQLMHGGRVSHPDTTGLQPVGPSAVPAVGDVFTPTGPQPVPVPRALDLAEVPEQAQSYAQAARRAVDAGFDGVELHGANGYLISQFLSSNANLRTDRYGGSVPNRIRFAVEAVSATVEAVGGARTGIRLSPGANFWGVEETEVLELYTELLSELARLDLAYVHLEATTGDETLLALRHVWPGTLVMNPVYPMGAKVTGRSDADRWLELGADLISFGRAFIANPDLVERLRTGLPIAPFDEATYYQGGDAGYLTYPAYQHTA
>NZ_CP007155.1|WP_025354267.1|647434_648649_+|amidohydrolase
MTLAITGGYVVPVEGDPIDGGTVLISEGRIIAVGPDADVDVPEDAEVVDAAGSWVLPGFVESHGHLGVCEEAEGWAGEDTNEMTDPNGARLRALDAINPADLAFADALSGGVTTVVIKPGSGNPIGGQTVAVKCWGRTVDEMLLREPVSVKSALGENPKRVYGNKDKTPSTRQGVAAIIRDAFTKAQDYKAKREHAAAENKPFDRDPTLEVLVRVLDGELPWCQHTHRADDIATAMRLAEEFGYRLVINHGTEAHLLADLIAERGHPVIIGPLFTSRSKVELRHRSLRNPGILARAGVDLAIMTDHPVVPIHFLVHQATLAVKEGLDSETALKAITSNPARIMGLDDRVGALKPGLDADIVLWSDDPLNVMSRALRVWIGGREVYTYDEHTGEGVTANPYHRDR
>NZ_CP007155.1|WP_025354268.1|648791_649925_-|acyl-CoA-dehydrogenase-family-protein
MPAERMLPTTEAEDLLSLVREICQQELAPHASNWEAESRFPREAFRVLGKSGLLGLPYPERWGGGEQPYEVYLQVLEEIAASWLTVAEGMSVHVMSCYALATFGTEQQRESWLPDMIGGELLGAYALSEPQAGSDPAGMTTRAVREGEDYVVNGTKAWITHAGVADFYTMMTKTGEDEVSCLLVPGNSEGLSAAPRERTMGLTSSPVAQLRLEGLRVPVGRRIGEEGSGLRIALSALDSGRLGIAACAVGLAQAALDEAVRYAKERKQFGKPIIQFQGMEFLLADMAAAVESARATYLEAARRRDRGLPFSRQASIAKLVATDAAMKVTTDAVQVLGGAGYTRDFPVERYMREAKVLQIFEGTNQIQRMVIARQLAR
>NZ_CP007155.1|WP_025354269.1|650052_650646_+|TetR/AcrR-family-transcriptional-regulator
MLSERSVRRPPTARQAELLDRLEELFLAEGFATFTLDELAARLRCSKSTLYALAPSKEQLSVQVVGHFFKKATARIEQRIADLPDVRERIGGYLTAAADELRPATREFIADIAAFPPARATYELNARAAAARIRELIAEGVRLGEFQDVHVALVSEMVGLTIENIHLGTIAKRTGLSDAEAFAALSRFLLSGLAPKR
>NZ_CP007155.1|WP_025354270.1|650714_651656_+|carbohydrate-kinase
MIVVAGEGLVDLVPSGTGDGALLPRLGGGPYNVAIAAGRLGVPVSFLSRISTDAFGDALVERLTESGVGLGLVQRGPEPTTLAVVTLAADGSARYGFYVEGTADRLVADPGPLPAEAAALSFGTLSMVLEPGASAYESVLRRESARGLLTALDPNVRPVLIPDAEAYRKRFQTWLPHVGLLKVSVEDARWLAGLDEDADVLPHLRAWQQAGPAAIVLTRGGEGLAALTGQGELVEVPPVRVTVADTIGAGDTVQGAVLAWLHQHGALSARAVRELNAEQWRAALAYAGAAAAITVSRAGAEPPYAAELVRGEA
>NZ_CP007155.1|WP_042220170.1|652227_653544_+|citrate-synthase
MPDATTAPNSSPRTVALRHEGGEHEMQVSVPTEGAPGIDLGKLLAKTGMVTLDPGFVNTASCSSSITYIDGDAGILRYRGYPIEQLAERSNFIEVSYLLIYGELPTQAQVEDFSQKISRHTLLHEDLKRFFDGFPRDAHPMPVLSSAVSALSTFYQDSLNPFDDHQVEMSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNSLGLVENFLRMTFGFPAEPYDLDPDLVRALDLLFILHADHEQNCSTSTVRLVGSSEANLFASISAGINALFGPLHGGANSAVLEMLEKIRQEGGDVEAFVRKVKNKEDGVRLMGFGHRVYKNYDPRAAIIKKTADEILGKLGGDDQLLDIAKKLEETALADDYFVERKLYPNVDFYTGLIYRAMGFPTRMFTVLFALGRLPGWIAHWREMMKDPATKIGRPRQLYVGPASRDFVAIDER
>NZ_CP007155.1|WP_025354272.1|654189_654636_-|hypothetical-protein
MVALSNRRTRYTASPIGLVLGLFGTLVSAAFTYLITVRNGSFYLDPHSTVERFTDLARIGGFPVPQWPLVVLAPALPVLALIAVPLCSLSAARSVGPRLMTRPRLACTAAFTAVTLLGLLTTPFGPALTPWLGPALISVALAYPHRED

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_3

1468157-1468259

Orphan

Consensus_repeat	Method
GCCGCACCTCGCTGACGCTCGGCGC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP007155_3

>merge|NZ_CP007155|3|1468157-1468259|CRISPRCasFinder
GCCGCACCTCGCTGACGCTCGGCGCAGCGCTGCGCGCCGGCCCTGCGTTGAATGGTTCGCTCGCTAGCTCGCTCACGAGCCGCACCTCGCTGACGCTCGGCGC

>NZ_CP007155|3|2|1468157-1468259|CRISPRCasFinder
GCCGCACCTCGCTGACGCTCGGCGC	AGCGCTGCGCGCCGGCCCTGCGTTGAATGGTTCGCTCGCTAGCTCGCTCACGA
GCCGCACCTCGCTGACGCTCGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_042220276.1\|1459406_1460429_+\|right-handed-parallel-beta-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|275079
NZ_CP007155.1\|WP_025354980.1\|1473543_1477113_-\|discoidin-domain-containing-protein	unknown	unknown	gnl\|CDD\|271156
NZ_CP007155.1\|WP_025354983.1\|1480695_1481307_-\|oligoribonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235429
NZ_CP007155.1\|WP_025354982.1\|1479414_1480284_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293813
NZ_CP007155.1\|WP_025354977.1\|1470753_1471299_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP007155.1\|WP_025354974.1\|1464998_1466009_-\|S1-family-peptidase	unknown	unknown	gnl\|CDD\|367281
NZ_CP007155.1\|WP_025354969.1\|1460683_1461556_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP007155.1\|WP_025354971.1\|1462333_1463269_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270225
NZ_CP007155.1\|WP_025354972.1\|1463468_1464686_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP007155.1\|WP_025354984.1\|1481414_1482941_+\|DUF853-family-protein	unknown	unknown	gnl\|CDD\|283518
NZ_CP007155.1\|WP_025354975.1\|1466520_1468155_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP007155.1\|WP_030111641.1\|1458647_1459094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025354979.1\|1472247_1473252_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP007155.1\|WP_025354973.1\|1464678_1464963_+\|transposase	unknown	unknown	gnl\|CDD\|366690
NZ_CP007155.1\|WP_169743553.1\|1482990_1483488_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378968
NZ_CP007155.1\|WP_025354981.1\|1477284_1479279_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226482
NZ_CP007155.1\|WP_025354978.1\|1471373_1472135_-\|serine-protease	unknown	unknown	gnl\|CDD\|238113
NZ_CP007155.1\|WP_158510723.1\|1466196_1466358_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187632
NZ_CP007155.1\|WP_025354970.1\|1461564_1462317_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP007155.1\|WP_042221779.1\|1468309_1470661_-\|HAD-IC-family-P-type-ATPase	unknown	unknown	gnl\|CDD\|319795

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_042220276.1\|1459406_1460429_+\|right-handed-parallel-beta-helix-repeat-containing-protein	gnl\|CDD\|275079	TIGR04247, nitrous_oxide_maturation_protein_NosD, nitrous oxide reductase family maturation protein NosD. Members of this family include NosD, a repetitive periplasmic protein required for the maturation of the copper-containing enzyme nitrous-oxide reductase. NosD appears to be part of a complex with NosF (an ABC transporter family ATP-binding protein) and NosY (a six-helix transmembrane protein in the ABC-2 permease family). However, NosDFY-like complexes appear to occur also in species whose copper requiring enzymes are something other than nitrous-oxide reductase.	8.65569e-09
NZ_CP007155.1\|WP_025354980.1\|1473543_1477113_-\|discoidin-domain-containing-protein	gnl\|CDD\|271156	cd14490, CBM6-CBM35-CBM36_like_1, uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.	5.17958e-57
NZ_CP007155.1\|WP_025354983.1\|1480695_1481307_-\|oligoribonuclease	gnl\|CDD\|235429	PRK05359, PRK05359, oligoribonuclease; Provisional.	1.41675e-120
NZ_CP007155.1\|WP_025354982.1\|1479414_1480284_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293813	cd07727, YmaE-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis YmaE and related proteins; MBL-fold metallo hydrolase domain. Includes the uncharacterized Bacillus subtilis YmaE and Nostoc all1228 proteins.Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry. .	1.90195e-67
NZ_CP007155.1\|WP_025354977.1\|1470753_1471299_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	5.45351e-26
NZ_CP007155.1\|WP_025354974.1\|1464998_1466009_-\|S1-family-peptidase	gnl\|CDD\|367281	pfam02983, Pro_Al_protease, Alpha-lytic protease prodomain.	2.90009e-06
NZ_CP007155.1\|WP_025354969.1\|1460683_1461556_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.8689e-68
NZ_CP007155.1\|WP_025354971.1\|1462333_1463269_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270225	cd01004, PBP2_MidA_like, Mimosine binding domain of ABC-type transporter MidA and similar proteins; the type 2 periplasmic binding protein fold. This subgroup includes the periplasmic binding component of ABC transporter involved in uptake of mimosine MidA and its similar proteins. This periplasmic binding domain belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.85303e-73
NZ_CP007155.1\|WP_025354972.1\|1463468_1464686_+\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	4.05898e-44
NZ_CP007155.1\|WP_025354975.1\|1466520_1468155_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	1.32547e-140
NZ_CP007155.1\|WP_025354981.1\|1477284_1479279_-\|AAA-family-ATPase	gnl\|CDD\|226482	COG3973, COG3973, Superfamily I DNA and RNA helicases [General function prediction only].	5.59316e-68
NZ_CP007155.1\|WP_025354979.1\|1472247_1473252_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.39788e-29
NZ_CP007155.1\|WP_025354973.1\|1464678_1464963_+\|transposase	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	2.4375e-08
NZ_CP007155.1\|WP_169743553.1\|1482990_1483488_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|378968	pfam12840, HTH_20, Helix-turn-helix domain. This domain represents a DNA-binding Helix-turn-helix domain found in transcriptional regulatory proteins.	2.90406e-08
NZ_CP007155.1\|WP_025354984.1\|1481414_1482941_+\|DUF853-family-protein	gnl\|CDD\|283518	pfam05872, DUF853, Bacterial protein of unknown function (DUF853). This family consists of several bacterial proteins of unknown function. BMEI1370 is thought to be an ATPase.	0
NZ_CP007155.1\|WP_025354978.1\|1471373_1472135_-\|serine-protease	gnl\|CDD\|238113	cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.	1.49713e-52
NZ_CP007155.1\|WP_158510723.1\|1466196_1466358_-\|hypothetical-protein	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	0.00108356
NZ_CP007155.1\|WP_025354970.1\|1461564_1462317_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	5.92418e-145
NZ_CP007155.1\|WP_042221779.1\|1468309_1470661_-\|HAD-IC-family-P-type-ATPase	gnl\|CDD\|319795	cd02609, P-type_ATPase, uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7. This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.	0

>NZ_CP007155.1|WP_025354975.1|1466520_1468155_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSATLVAKDLAAGHGDRVLFSGLDLVVAPGDVIGLVGANGAGKSTLLRTLGGLIPAEQGSVRLTPPTATVGHLPQETERRPGESVRDFLGRRTGVTEAQRRMDAEAEALGEGKPGAEDAYAVSLERWLALGGADLDERVDEVVAELGLAVRLDQPMSSLSGGQAARVGMASLLLSRYDVFLLDEPTNDLDLDGLERLEKFVTGLRAGTVLVSHDREFLARTVTSVVELDLAQQQVNTYGGGYAAYLEEREVARRHAREQYEEFADTKAALEARARTQRSWMEKGVKNARRKATDNDKIGRKFRSEATEKQAAKARQTERLLERLEVVEEPRKEWQLRMEIAAAPRSGSVVATLRGAVVRRGDFTLGPVDLQVDWADRIAITGANGSGKSTLLGALLGRIPLASGSSALGHGVVVGEVDQARALFFGTDTLLDSFRPAVPDMAPAEVRTLLAKFGLAAAHVLRPADTLSPGERTRAALALLQARGVNLLVLDEPTNHLDLPAIEQLESALADYPGTLLLVTHDRRMLEAVHTTRHIEVDGGRVRG
>NZ_CP007155.1|WP_158510723.1|1466196_1466358_-|hypothetical-protein
MTESVTRAGETLRGSVEGTPLDQVERLYRLNTIGALRVPVGDSAVRTLAGHQN
>NZ_CP007155.1|WP_025354974.1|1464998_1466009_-|S1-family-peptidase
MISKKALVGVAALAVSTLGVPAANAAQPGTAEFAQAQSTAITQAEQVSDALGTSTGGYYLDGTTAVVTVLDSAAAKAVQSHGLVARTVKHSLATLNSAKASLDAITDVPQTAWGVDPVSNQVVVTIYDAASKASRDKVTAAAQRLGDTARIEHQTGRLELHIADGDAIRNSQGRCSLGFNVKQGSTPYLLTAGHCTNLGGTWSGGDVTGAKIVHSDCPGADSGLLTRPNGTGPGRINTGQAITSAGKPTVGQRMQKQGSTTGGGSGQITSVDQTVNFDVGVLRHEFGTTAHTDHGDSGGPAYSGSVGLGTLSGGNTTVSYFYPLQLELQSYGLTLA
>NZ_CP007155.1|WP_025354973.1|1464678_1464963_+|transposase
MANSYPPEFRWKVLALVASGRPVVKVAAEFGISDQTIYNWRRQHLADSGQLPSVASSTRPELAAALDQITELEAELANRRRAAQLLAMSPPRSA
>NZ_CP007155.1|WP_025354972.1|1463468_1464686_+|ROK-family-protein
MTQLRVAQKGTKRSLRARNDVLVLQSVAAGGGEIARADIVRETGLPSATVSAIVGNLIDRRLVRESGHGDSRGGKPRVLLELDREHHRFVGVHVGRGRVTASLLTLSGRPEQTVRLPHLVGDDTLTVTANAVRRLADSFDGQLSGIGVAVPGIVSGDGVIREAINYGWRMVPLGEELSERCGDTPVHVVNDANAVALSEVALSRQWAVTVVLLWIGTGVGAGIVLDGRLYEGPEFRSGEIGHIDAGVSTRCRCGLVGCLETVASMPGLLGDASEQVVAAYLGGADDADSRALDERIRRGARELARLASMFAASLDITEFVVGGPIVASPIGPPLLRATNEVLELRAMPGFPVVSLRFSTLGSHSVVVGAAAHAMRQEFGVMLTMPGETTEQHPNRPPMPEVHRHG
>NZ_CP007155.1|WP_025354971.1|1462333_1463269_+|ABC-transporter-substrate-binding-protein
MSRKLIVVLALLLTACGTATSETTPASTTSGINLGPDQKRVSTGKVDRIAAEVPEPIRARGTLEVVADAGTVPPLSFYATDDHTPIGVEEDIASLVADVLGLKPHYTVVSWENIFVGLDSGKYDAGFSNITVTEARKEKYDFATYRLDNVSFEARKGSGWQVNGPADVAGRSIAVSSGTNQEKLLLDWNAQNTAKGLKPVDVKYFQKATDYYLALQSGRIDAYFGPNPSTAYHAATSGQTELIGTVSGAGTALQGKIAATTKKDNGLIRALHEALSEVIANGSYAQVLRRWGLSNEAVTGSELNPPGLPRT
>NZ_CP007155.1|WP_025354970.1|1461564_1462317_+|amino-acid-ABC-transporter-ATP-binding-protein
MVEITGVHKRFGANEVLRGITLRVAAGEVAVVLGPSGSGKSTLLRSINHLEKLDRGTVSIDGELIGYRQRGGKLHELTEREVLRQRGAIGFVFQNFNLFPHLTVLANLTEAPLAARTRNRAQAEAKARALLERVGLADKESAYPRQLSGGQQQRVAIARALALDPKVVLFDEPTSALDPELVGEVLDVMKDLARGGTTMIVVTHEIGFAREVADTVVFLDEGRVVEQGPPAQVIDQPEHDRTRAFLAKVL
>NZ_CP007155.1|WP_025354969.1|1460683_1461556_+|amino-acid-ABC-transporter-permease
MSVSARPVHLSAQPEAADLPVVPARHPWRWVGVAVVLVLLAQFVHGLVTNPGWDWPTFAEFFTSGTILRAVGVTLQLTLYGTVLGFAAGIVLALMRLSHSPFLRTVSWAYVWAFRSIPLIVQLIFWFNVSYLYPKLGFGVPFGPVLVTVNTLDLFSPMGAAVIGLALHQAAYAAEIIRSGVLSVDPGQREAAAALGIPRLRQFRRIVLPQAMRSILPTAANEVISLFKGTSIVSVVAISELFYQVQVIYGRNARVVALLMVATVWYIVLTSALSVVQHFVERHYAKGSSR
>NZ_CP007155.1|WP_042220276.1|1459406_1460429_+|right-handed-parallel-beta-helix-repeat-containing-protein
MTVHWRTSVLAAIGALALAALGVSGAHAAGTTYQVGTAAQLRTALSAAKPGDTIKLADGDYADQFLATTSGTAGAPITLTGGPRAVLSDPLFNPGDTDCPSGQTGYGLWLQGASYWNLSGFTVANSKKGIVLDGAQHVTIDSVTVHDIGYEGVHFRKGSAYGVIKNSTVYNTGTEQPGYGEGVYLGSANSNWACFGVGGGPDPGNYIQVLNNRIGPNVAAEGVDIKEGTHDGVVSGNVLDGTGERNQNSGDSTIDVKGDRYTISGNTVSHPYTDGFQVHNVYQSYGCGNTFSDNKFTLGSAPGYGINVTDQSRCKSTAPNLVRASNTSTGGKGLTNIPLS
>NZ_CP007155.1|WP_030111641.1|1458647_1459094_-|hypothetical-protein
MTDQSEESAGELAAKLARLIAVRYPDEATRPGFAKLAQQIAEHSGTKISSTYLWELATGKKRNLTQGTLGTLARFFGVPPEYFLNEEVAARVDSQLELAAALRNNRVRSIALRAEGLSDETLDSILTMLSQARKIEKLPPLEEPGEAP
>NZ_CP007155.1|WP_042221779.1|1468309_1470661_-|HAD-IC-family-P-type-ATPase
MARAETQDTLSPGLTSAEVAERIARGEVNRTSKDGGRTFGQILRANLLTRFNAIVGALFVLVMIFGAPQDGLFGLVILVNSLIGIVQELRAKQVLGRLAVLGQEPVRVRRDGAETAIAPTDVVLGEVVLLGTGDRIPVDGVLDEATALEVDESLLTGESDPVVKVVGDTVKSGSFVVSGGGAFTATAVGDGSYAAQLVQEASRFSMAKSELQTGINKFLGYITWLILPVGVLLAISQLNAADSFAKAVVGSVAGVVPMIPEGLVLMTSIAFTVGVLRLGRRRTMVQELPAVEVLARVDVLCLDKTGTLTDATMDLKELRVLSGDEQGARDAVGALIAAEPRPNPTMQAIARGVPGDPGWTVTDSVAFSSARKWSGASFAGQGSWVMGAADVLLSTEDAHRAGADELASQGLRVLVLGKVGDLNDFEHAEAVALVVLAQRIRPEAEQTLRYFAEQGVAIKVISGDNAASVGAVAAGLGIPGAQDPVDARTLPTDRAELAEVMETHSVFGRVSPQQKREFVAALQSKGHVVAMTGDGVNDVLALKDADLGVAMGSGSGATRSVAKVVLMDDSFASLPHVVAEGRRVLNNVERVANLFLTKTFYSVALALLIGVAGLPFPFLPRHVTLIGALTIGIPGFLLALAPNTERARPGFVPRVLRFAVPAGLACAAATFGSYWLAYNNPGSDLTANQSTATLALFLTSLWALALVARPWTWLRAGLVLLMVAGFALVTAVPWSRDQFQLNFANPGDDLVALGIAVGMAALLTLVLWLERWLGRRSQVASRV
>NZ_CP007155.1|WP_025354977.1|1470753_1471299_+|GNAT-family-N-acetyltransferase
MLSFADKPTLTGELVTLRPVEVHDAVHLAGIEPETLRLTGSHRTHDLPALERWYATRAEHTDRLDLAIVERATGEVAGEVVLNNLDLDNHSCSFRILLVGARFYGRGLGSEATRLVLGHAFEVVGVHRVELEVYSFNPRARRVYEKAGFVHEGIKRHALLWLGEWVDAEIMSVLAEEWAAR
>NZ_CP007155.1|WP_025354978.1|1471373_1472135_-|serine-protease
MRLRKIGTLLAVLAGLVVSTQTATAAPTIIGGTTATENYPFVASLQVPGQFDHYCGASLISAQWLVTAGHCAQQDASAYAVRIGSNDRTSGGTYARITEVVVHPDFDNSRLNNDIALLHLDRAASQALVQIGSTPQPGSTVRLLGWGAENPNGQGSPRRLKQVELGVLDSERCSWWGDMTGKLCFDGKRNASACHGDSGGPAIVKSGSGWALVGATSGGQDPCGTSENIYTDVSAYSSWIGQVTGGAVRVDRH
>NZ_CP007155.1|WP_025354979.1|1472247_1473252_-|LysR-family-transcriptional-regulator
MNGLELRHLRTMCAIAESNSVTKAAAALGLTQPALTAQLHRIEKFLGGQLFERTAAGTRPTALGREVVALAGQILTDLDQLVQVAKGPRQPDGQALLTVGTEPVLFLGELVTQLKALTGGKDVQARVETHAAPLLEMLAGDRIHFAVIFGFDGLDAAELRGIELRELLVEPQFVMIAEDHPLAAHESIELAELAGFDWVTPPPETDSLRHALDSACRAAGFSPRRTHYATEVSTARALVLSGAVAPAAPASRSADGIAIRQLRGDPFTTTMYVATKADGPFAHYRREFFTSAARAYRTSVDRNPYYAKWWADNPKAHADLDAALVLGELGHNSG
>NZ_CP007155.1|WP_025354980.1|1473543_1477113_-|discoidin-domain-containing-protein
MTTRRLLPRLAALLLTTTVVTLTAVGLSAPASGARNLAQGGTVTASSSTSPYAAANAGDGNQASYWESTNNVFPQWIQVDLGATVPVDHLVLKLPATWEARTQTFAVRASANGEDFTDVLPSAQHVFDPANGNTVGLQFGAVTTRFVRLAITANTGWPAGQLSEFEVYGPSGGVDTTPPSAPTNLAYTEPASGQIKLTWNAASDNVGVTGYDVYANNTLRTSVAGSALTYTDTQPAGTAVSYFVRARDAAGNQSANSNAVTRQGSGGGNGKNLAVGKPITASSHAQTFVETNANDDSVTTYWESTGFPGTLSVNLGANADISSVVVKLNPDPAWGKRTQSLQVLGRDQNSQAFTSLAGQATYTFDPASSNLVTIPVTATAAEVQLRIDANSGAPGGQVAEFQVIGTPSANPDLTVTDTSWTPAAPVENTPVTVSATVRNAGTLPSGASDVNFYLGTTKVGTGQVGALAAGASAQVSADIGTRDAGSYQLTAKVDESNRVIEQNESNNNYTSPSALVVTPVASSDLIASSVSWTPDNPSAGNQVAFSVGIRNQGSVASAAGSHGITLTLLDANGGTVRTLTGAYTGTIAPGATAGPVNLGGWAAVNGRYTVKVVLDNDTNELPVKQGNNTSTKSLFVGRGANMPYDMYEAEDGVLGGGAQVIGPNRTIGDLAGEASGRKAVTLNSTGSYMEFTTRASTNTLVTRFSIPDGTDATLNVYVDGKFLKPISLTSKYAWLYGSESGPSNSPGAGAPRHVYDEANLLLGTTVPQGSKIRLQKDAANNGTFAIDFINLEQAGAQANPDPARYVVPTGFGHQDVQNALDKARQDSNAVGVYLPPGDYDTAQKFQVYGKAIKVVGAGPWFTRFRAPSTQDNTDVGFRADATANGSTFAGFAYFGNYTSRIDGPGKVFDFANVANMTIDNIWVEHMVCLYWGANTDYVSISNSRIRDTFADGVNMTNGSTNNHVFNNDARATGDDSFALFSAIDAGGADEKDNLYENLSSTLTWRAAGVAVYGGYANTFRNIYIADTLAYSGITISSLDFGYPMNGFGADPPTQLQNISLVRAGGHFWGGQTFPAIWAFSASKVFQGIRVSDVDIVDPTYSGIMFQTNYVGGQPQFPIKDTTFTNVSISGAQRSGDAFDAKSGFGLWANEMPEANQGPAVGSVTFTNLKLSNNYQNVRNTTSTFTINGA
>NZ_CP007155.1|WP_025354981.1|1477284_1479279_-|AAA-family-ATPase
MSSHAEEELRAEQQYLVHAHACLRSSRAQLLELAERARARPGDEEAVAWLEWRAEQLRDENKSPLFFGRIDGPEPRPCYIGRRHVSDEQDEPVVIDWRTPMAARFYRASPGQPMEVTRRRRFGFAADGALTSFDDEPLTENSVSAGLSELVIAEIERTHVGPMRDIVATIQPDQDEIVRTELASTLIVQGGPGTGKTAVGLHRAAYLLFEHTKLRRSGVLVVGPNDLFVRYISRVLPALGESQVVHLSVDELVAAKRKPVPEAAEVAALKGDARMAQVLAAALWAGVRLPTEDTVVRESSPYVRIHPETVRELSEDLVAQRVPVARARAHLIERITAHVRRELETRGHAPSDADMRRIARAKSVRELAASVWPTVNPAQVLVDLFSDADLLGRAAEGVLTAEEQRLLLWPSAPASVGRAKWSLADRFLLDELASLVEPPTRFGHVVIDEAQDLSPLQLRAIMRRCVDSATLLGDMAQRTTPWAAGSWRAVAEHLGVPSRVLQLTTSYRVPRDIVRVANSLLPEISPELPPTVSGRHVPGALEVQASEDTADSLVELLRAAEQHPDSVGVVLADDRFTAVRRRLAAAGITAGLPHEDEAEHKFSLVPASLAKGLEFDHVVVLEPELITAAGQDGLRLLYIALTRAISRLTILHTGELPAALAAAR
>NZ_CP007155.1|WP_025354982.1|1479414_1480284_-|MBL-fold-metallo-hydrolase
MQSGWFVDERCTNCDVARQLAPSLIGEVAGRSEVLRQPRDEAEERTLHAAAYACPTRSIRRHARGLDPELDPYPLPLTEGAYLCGHNSTRTAGANSYLLRRPGGNLMIDTPRWSESLAQRYERFGPVTEVLLTHRDHAAHGRRYADRFGARLWIHEGDLEAAPDADEVLTGIEPIEVAEGVVAHPLPGHTEGSVLYVADERSCFSGDSLYWSRTTADVEIAESVTWYSVEALAASLERSVDGLRFEWLFPGHGDRRHLPAAEMSRRLRGLTERVRAMRPQPIDFTAVRW
>NZ_CP007155.1|WP_025354983.1|1480695_1481307_-|oligoribonuclease
MTDRLVWIDCEMTGLDLGKDALIEIAALVTDAELNVLGEGVDVVIHADDAALDGMPDVVRQMHANSGLTEEVRQSPITLEQAEQLVLDYIRQYVPDPRTAPLAGNSIATDRGFIARDMPALDAHLHYRMVDVSSIKELCRRWYPRIYYAQPGKGLAHRALADIRESIRELAYYRGTAFVPQPGPSSEQAQAVAAELLRADGIG
>NZ_CP007155.1|WP_025354984.1|1481414_1482941_+|DUF853-family-protein
MSAFEEITAGYATEGGALELGAAVVDGRAEATARVRLPLATLNRHGLVAGATGTGKTKTLQLMAEQLSAAGVPVVMADMKGDLSGLSAPGAGGDKVAKRAQETGDDWAAAGFPVQFLSLGTGGSSVPIRATITSFGPILLSKVLGLNDTQESTLGLIFHWADSRSLPLLDTKDLRAVIQHLTSDEGKEDLKGLGGVSSATAGVILRSLLNLESQGGDTFFGEPELDPADLMRSEEGRGVISLLELAELQGKPALFSTFLMWLLAALFHELPEEGDLDKPKLVFFFDEAHLLFADASKAFLEQIVQTVKLIRSKGVGVFFCTQLPTDIPNAVLSQLGARVQHALRAFTPDDQKALAQTVKTYPTTPHYDLSKALTSLGIGEAVVTVLSEQGAPTPVAWTRLRPPRSLMASIGADAIKQAAGASPLAAKYAETIDRESAYEKLLAKVTPPAQQEPESAPEPEQPRKQDRDEPGLFGQVLGSPAVKSFLRSAGSALGREITRGLFGTGKRR
>NZ_CP007155.1|WP_169743553.1|1482990_1483488_+|winged-helix-turn-helix-transcriptional-regulator
MSGHPVRAALLALLAERGTLTSTEAARELGESSGLCSFHLRQLAKHGYLEEVAGARGRVRPWRLRERAAVAAEQFDRLARELEDEGFRRWQQGRANAPEQWRQDEAFSAVLHLSPDQLPQVAAEIRAVLARYASPRPGTGPVAGVVRLFPLLPVPLPLENEKPCP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_4

1545341-1545445

Orphan

Consensus_repeat	Method
ATGGTTCGCTCGCAAGCTCGCTCACGT	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of NZ_CP007155_4

>merge|NZ_CP007155|4|1545341-1545445|CRISPRCasFinder
ATGGTTCGCTCGCAAGCTCGCTCACGTGCCGCACCTCGCTGGCGCTCGGTGCAGCGCTTCGCGCAGGCCCGGTGCCCGATGGTTCGCTCGCAAGCTCGCTCACGT

>NZ_CP007155|4|3|1545341-1545445|CRISPRCasFinder
ATGGTTCGCTCGCAAGCTCGCTCACGT	GCCGCACCTCGCTGGCGCTCGGTGCAGCGCTTCGCGCAGGCCCGGTGCCCG
ATGGTTCGCTCGCAAGCTCGCTCACGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025355049.1\|1547553_1548372_-\|cobalt-precorrin-4/precorrin-4-C(11)-methyltransferase	unknown	unknown	gnl\|CDD\|381168
NZ_CP007155.1\|WP_042220282.1\|1548683_1549229_+\|precorrin-8X-methylmutase	unknown	unknown	gnl\|CDD\|376825
NZ_CP007155.1\|WP_025355043.1\|1541779_1542811_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235095
NZ_CP007155.1\|WP_025355036.1\|1534113_1535466_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237941
NZ_CP007155.1\|WP_030108414.1\|1551046_1552138_-\|winged-helix-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377630
NZ_CP007155.1\|WP_025355041.1\|1539563_1540367_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|252734
NZ_CP007155.1\|WP_025355038.1\|1536015_1536366_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025355037.1\|1535485_1536019_-\|DUF3558-domain-containing-protein	unknown	unknown	gnl\|CDD\|378803
NZ_CP007155.1\|WP_081789234.1\|1554770_1555592_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274310
NZ_CP007155.1\|WP_025355053.1\|1552163_1554098_-\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NZ_CP007155.1\|WP_025355039.1\|1536483_1538562_-\|GGDEF-and-EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP007155.1\|WP_025355048.1\|1546813_1547557_-\|precorrin-3B-C(17)-methyltransferase	unknown	unknown	gnl\|CDD\|381173
NZ_CP007155.1\|WP_158510724.1\|1542814_1544515_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213192
NZ_CP007155.1\|WP_025355050.1\|1549315_1550068_+\|SIS-domain-containing-protein	unknown	unknown	gnl\|CDD\|179510
NZ_CP007155.1\|WP_025355047.1\|1546091_1546817_-\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|381169
NZ_CP007155.1\|WP_042220284.1\|1554317_1554608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025355045.1\|1544511_1545288_-\|cobalt-ECF-transporter-T-component-CbiQ	unknown	unknown	gnl\|CDD\|274139
NZ_CP007155.1\|WP_025355051.1\|1550034_1551030_-\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP007155.1\|WP_148309382.1\|1540531_1541638_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|239217
NZ_CP007155.1\|WP_025355040.1\|1538716_1539526_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|252734

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025355049.1\|1547553_1548372_-\|cobalt-precorrin-4/precorrin-4-C(11)-methyltransferase	gnl\|CDD\|381168	cd11641, Precorrin-4_C11-MT, Precorrin-4 C11-methyltransferase (CbiF/CobM). Precorrin-4 C11-methyltransferase participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways in bacteria. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. In the aerobic pathway, CobM catalyzes the methylation of precorrin-4 at C-11 to yield precorrin-5. In the anaerobic pathway, CibF catalyzes the methylation of cobalt-precorrin-4 to cobalt-precorrin-5. Both CibF and CobM, which are homologous, are included in this model. There are about 30 enzymes involved in vitamin B12 synthetic pathway. The enzymes involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Most of the enzymes are shared in both pathways and several of these enzymes are pathway-specific.	1.94224e-104
NZ_CP007155.1\|WP_042220282.1\|1548683_1549229_+\|precorrin-8X-methylmutase	gnl\|CDD\|376825	pfam02570, CbiC, Precorrin-8X methylmutase. This is a family Precorrin-8X methylmutases also known as Precorrin isomerase, CbiC/CobH, EC:5.4.1.2. This enzyme catalyzes the reaction: Precorrin-8X <=> hydrogenobyrinate. This enzyme is part of the Cobalamin (vitamin B12) biosynthetic pathway and catalyzes a methyl rearrangement.	1.85532e-51
NZ_CP007155.1\|WP_025355043.1\|1541779_1542811_-\|hypothetical-protein	gnl\|CDD\|235095	PRK02983, lysS, bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX.	0.000498722
NZ_CP007155.1\|WP_025355036.1\|1534113_1535466_-\|hypothetical-protein	gnl\|CDD\|237941	PRK15315, PRK15315, outer membrane protein RatA; Provisional.	0.00699212
NZ_CP007155.1\|WP_030108414.1\|1551046_1552138_-\|winged-helix-DNA-binding-domain-containing-protein	gnl\|CDD\|377630	pfam06224, HTH_42, Winged helix DNA-binding domain. This family contains two copies of a winged helix domain.	5.43429e-24
NZ_CP007155.1\|WP_025355041.1\|1539563_1540367_-\|SAM-dependent-methyltransferase	gnl\|CDD\|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	7.57348e-84
NZ_CP007155.1\|WP_025355037.1\|1535485_1536019_-\|DUF3558-domain-containing-protein	gnl\|CDD\|378803	pfam12079, DUF3558, Protein of unknown function (DUF3558). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 177 to 195 amino acids in length.	1.06061e-07
NZ_CP007155.1\|WP_081789234.1\|1554770_1555592_+\|hypothetical-protein	gnl\|CDD\|274310	TIGR02811, formate_dehydrogenase_accessory_protein_FdhX, formate dehydrogenase region TAT target. Members of this uncharacterized protein family are all small, extending 70 or fewer residues from their respective likely start codons. All have the twin-arginine-dependent tranport (TAT) signal sequence at the N-terminus and a conserved 20-residue C-terminal region that includes the motif Y-[HRK]-X-[TS]-X-H-[IV]-X-X-[YF]-Y. The TAT signal sequence suggests a bound cofactor. All members are encoded near genes for subunits of formate dehydrogenase, and may themselves be a subunit or accessory protein. [Unknown function, General].	0.00444885
NZ_CP007155.1\|WP_025355053.1\|1552163_1554098_-\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	3.13682e-36
NZ_CP007155.1\|WP_025355039.1\|1536483_1538562_-\|GGDEF-and-EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	2.88186e-51
NZ_CP007155.1\|WP_025355048.1\|1546813_1547557_-\|precorrin-3B-C(17)-methyltransferase	gnl\|CDD\|381173	cd11646, Precorrin_3B_C17_MT, Precorrin-3B C(17)-methyltransferase (also named CobJ or CbiH). Precorrin-3B C(17)-methyltransferase participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. This model includes CobJ of the aerobic pathway and CbiH of the anaerobic pathway, both as stand-alone enzymes and when CobJ or CbiH form part of bifunctional enzymes, such as in Mycobacterium tuberculosis CobIJ where CobJ fuses with a precorrin-2 C(20)-methyltransferase domain, or Bacillus megaterium CbiH60, where CbiH is fused to a nitrite and sulfite reductase-like domain. In the aerobic pathway, once CobG has generated precorrin-3b, CobJ catalyzes the methylation of precorrin-3b at C-17 to form precorrin-4 (the extruded methylated C-20 fragment is left attached as an acyl group at C-1). In the corresponding anaerobic pathway, CbiH carries out this ring contraction, using cobalt-precorrin-3b as a substrate to generate a tetramethylated delta-lactone.	4.66678e-119
NZ_CP007155.1\|WP_158510724.1\|1542814_1544515_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213192	cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system. Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	2.30306e-93
NZ_CP007155.1\|WP_025355050.1\|1549315_1550068_+\|SIS-domain-containing-protein	gnl\|CDD\|179510	PRK02947, PRK02947, sugar isomerase domain-containing protein.	1.33172e-98
NZ_CP007155.1\|WP_025355047.1\|1546091_1546817_-\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|381169	cd11642, SUMT, Uroporphyrin-III C-methyltransferase (also known as S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT). SUMT is an enzyme of the cobalamin and siroheme biosynthetic pathway. It catalyzes the first of three steps leading to the formation of siroheme from uroporphyrinogen III; it transfers two methyl groups from S-adenosyl-L-methionine to the C-2 and C-7 atoms of uroporphyrinogen III to yield precorrin-2 via the intermediate formation of precorrin-1. Precorrin-2 is also a precursor for the biosynthesis of vitamin B12, coenzyme F430, siroheme and heme d1. This family includes proteins in which the SUMT domain is fused to other functional domains, such as to a uroporphyrinogen-III synthase domain to form bifunctional uroporphyrinogen-III methylase/uroporphyrinogen-III synthase, or to a dual function dehydrogenase-chelatase domain, as in the case of the multifunctional S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase/dehydrogenase/ferrochelatase CysG, which catalyzes all three steps that transform uroporphyrinogen III into siroheme.	7.13876e-89
NZ_CP007155.1\|WP_025355045.1\|1544511_1545288_-\|cobalt-ECF-transporter-T-component-CbiQ	gnl\|CDD\|274139	TIGR02454, Uncharacterized_protein_MJ1089, cobalt ECF transporter T component CbiQ. This model represents the CbiQ component of the cobalt-specific ECF-type. CbiQ is now recognized as the T component of energy-coupling factor (ECF)-type transporters. The S component confers specificity (CbiM-N for cobalt systems), which CbiO is the ABC-family ATPase. In general, proteins found by this model reside next to the other putative subunits of the complex, identified as CbiN, CbiO, or CbiM. Note that the designation of cobalt transporter has been spread excessively among ECF system transporters with many other specificities. [Transport and binding proteins, Cations and iron carrying compounds].	1.48249e-31
NZ_CP007155.1\|WP_025355051.1\|1550034_1551030_-\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	5.63928e-51
NZ_CP007155.1\|WP_148309382.1\|1540531_1541638_-\|NUDIX-domain-containing-protein	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	6.96335e-13
NZ_CP007155.1\|WP_025355040.1\|1538716_1539526_-\|SAM-dependent-methyltransferase	gnl\|CDD\|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	7.21447e-92

>NZ_CP007155.1|WP_025355045.1|1544511_1545288_-|cobalt-ECF-transporter-T-component-CbiQ
MSGAAHNPGADLLIPADTPLHRAAPQCKVAATALCVLFVACTPKQVFWPYLGYAAVLALAAAIAQVPATTLLRRLVVEIPFVFFVVLLPLLATGPTVELLGVHLSVDGLESAASIVLKASFGLLATGVLAATTPLAEIITGLERLRVPRVFTAVASFMVRYVEVLNTELARLRTARACRGGDPRWLWQARDTAACVGALFVRAFERGERVYLAMASRGYNGALPTVLTGSAAGARAWTVALAVPLVYGALALTGWVTR
>NZ_CP007155.1|WP_158510724.1|1542814_1544515_-|ATP-binding-cassette-domain-containing-protein
MTAPALVLLGHGSRDADGVEEYWALAEVVRASAPDLVIGCGFVELAEPGVDEAIDKVVAAGASEVVVVPLVLLAAGHLKNDGPASMARARLRHPGVRFRLARDLGIEPTVLSVAEERIRAAAGDTDPETLGVALIGRGSSDPDACSDLWKVGRLLADNRGLGMIEPGFAGVARPNVAEAMERCRRLGATTIVVSPFFLFTGLLVPRIMAQAAQWAQEHPEITVRGGEHLGPDPRLARLVLERYREALHGDVRMNCDLCTYRVQLPGYEDKVGLPISLTPHGDEPARGKRRPRRAIRTPAPAPAPELQVRRGRFLPSAAASAEVPAIEVRGLSFDYPDGTAALSNVDLTVRRGERIALLGPNGAGKTSLVLQLNGVLTAKSGEVLISGTAVGPRTLKQVRRKVGVVFQDPDDQLFTPTVGRDVAFGPAHLGLSGAELDERVAEALSYVGLTEVADRPPHRLSLGQRRRAAVATVLAMHPEILVLDEPSSNLDPAARREFADLVKRLGMTTLLVTHDLPYALELCQRAVVLDHGQVVADGPIREILADTGFMSAHRLELPAGFNPLGG
>NZ_CP007155.1|WP_025355043.1|1541779_1542811_-|hypothetical-protein
MSRLLALVALLMLALAPQAAAHDTGHTPADRVGDLRSEMIPSQLPPGVEVRVLENGQALWLRNPTRIDLVVLDTDGAQRYQVGPDGVAVNSALPPEETPAGDISEDHSRQAADPAATAPQWQRQSTEPVVQWHNHFAHWGDAQLPAAAVSDPDHEHLIRAWQVGLEYDGRHYEIRGELRWIPGPSPVAWVFIALALAIGTWLLAFARRERLLVLPTAVLVVSSAWHGAAMLAGRNAEDGRTVLTHDYLPAIAAGLLGVVAVVLLATDRRNGRWFAALAAIGSGAVALLRDSAVWWSSTSVVALPIDLDRVLVSVTAGVSIGLVAALLTTPAPQSTRSEPSSIS
>NZ_CP007155.1|WP_148309382.1|1540531_1541638_-|NUDIX-domain-containing-protein
MTTASGHLKRWAVEQPWLFAIGSALAWQLVFVAAESALAAAGLPGQLRLALAALLAAGVPLGVAAACGWWRESGLVGGRPDARWLLALPVLALCLVSGGAGGTGAAALAVGLSAELVSRGTGQFTLRRFGPWRGTLGVVLIFECADLLVRSWDGRASGQVLTDLAFGFALTALRWHVGSVWPLALLHALHAALAPAASWWQLGVTVALLAFGVWLLARVPVVHTNVRPTVRVVCLDMHGRVLLLGRQDPADGTRAWDLPGGGIGPEESPLAAARRELHQETGLPESCVLDRYVLAQRDSYWNGTRYCGEERFYLARSACGPAPVIGDQEPRELALIRDQRWVCPAAASQLPGRVQMTALREIARKLDQ
>NZ_CP007155.1|WP_025355041.1|1539563_1540367_-|SAM-dependent-methyltransferase
MLDHHSWAPHHVDQERPNAARIYDYLLGGACHSAVDRVLAQQLLDAMPQARHVARANRAFLRRSVRYMAERGVRQFIDIGAGAPTAGSVHETARRFGPGSRVVYVDQEPIVVASTRLVVDGQVGAEVVHADFRQPYTVLTAPAVRELDFSRPIGLLLCAVLHYVPDSAGPAALLARYRDALPPGSQLALSHATAEGVSGGIHEVARIYAANAVPLTLRTKSEIGQIIAGFEPVEPGVVYVPHWRPESPEDLVDSPEVAVYGLVADLG
>NZ_CP007155.1|WP_025355040.1|1538716_1539526_-|SAM-dependent-methyltransferase
MLDRPSWAPKYIDLEKPSAARIYDYLLGGACNSAADRTVAKEIMSVLPEARRIAQDNRAFLRRTVTYLVSQGVRQFIDIGSGVPTAGNVHEIAQRADRECRVVYVDHDPIAIAHGELLLRDNDRSCAFLADFRSPDSVLRSPKTTKLIDFGQPVALLMFLLLHFVPDQEHPAALIARYRQALAPGSYLALSHPTLEGVTEGVFTATDIVRSSVDEVYPRDAAQVLRLAEGFEPVPPGLVFTQQWRPDGPPEARPPDGPEVVYGLVARKS
>NZ_CP007155.1|WP_025355039.1|1536483_1538562_-|GGDEF-and-EAL-domain-containing-protein
MTGAVEDQLRTFAQQWAAAIIDTSYVPMSRREIEDFLYDQAEALWRTLRGDPFGPEPAAAVGAALVGAHFTAPEALGRTLQLLGSWLIRPDGDTDRVLRVLGTLSSGYSEALRERTFDEQEVIKQAMWMATDVAQRRLQESEARFLAVFDSAAMGLSIGDFDANILESNQALQNLLGYTREELGRLTGPDIVHPDDIPDLLMRYDRLYRGEFASFRVRQRLLTKEGEVLWANVTISAIRNAEGVPTYQVAMVEDATELYFANQAMATLGMHDPLTGLPTRTAFMAKLDSLLGKVDHPSRVALCVFGMDGFGAITDGLGPEIGDEVLLKIGTKLKYHAEDNGMLAARLGGDEFALLVPESEGTRTVTPVVDQALRLISEPVTVLGHRLSVHASAGIVERAVGSELPSQLLRDATMALHWAKQGGKAQWELFDEQRCEQDRSDLQLTLTLPIALDNEEFVLQYQPVYTLSGDRLLFVEAQLRWEHPEFGTLRPAEFLPMAERTGVVVRLAEWTLWQVCQQARAWQDRFGERAPVVSLRLPTRQARDPDFLPNVLRVLTETGLHARLLQLEFGSDALSTESDAHADDVEVLAEHGVRFAVDGFDGRDPGFVNSMPLHVLKSGKLIVEPAMGERDPIRATVASNLVSLAHQMDLTVIAENVSTVDDVRWLKEIGADGGQGPALGEPRTAQDFESLI
>NZ_CP007155.1|WP_025355038.1|1536015_1536366_-|hypothetical-protein
MAQQGFGDIISGGFAVHPELAQQLKNVITKSIDQLDSQHGKVWEVQQRPPLGTSPAGLTVSGHDYEVLAGPQSFRDYLTGLQRELSALLPALDKAMAAYRAAEEQGTQNLNRAGGR
>NZ_CP007155.1|WP_025355037.1|1535485_1536019_-|DUF3558-domain-containing-protein
MSRKLVALCAGIAVTAASASGCSQVVPGAAEAATPGRTAPPPAGQDKARELTGIDPCGLLTAQESAQFGSSTHERQDYGGAHICQWSFPGSHALDLGLDDQRGVKQLIVGEGRPSTITVGRHQARQIAANFGDGNCVVSLAITDSSRVDVVANANVDTAKACDLALRTAKIVEPKVP
>NZ_CP007155.1|WP_025355036.1|1534113_1535466_-|hypothetical-protein
MDEDSRYAEAVEADFDADAQLPRWGGEESPLAPGLQRRVDAALRAQAYLARRRAERERDLAMRTPVSMPGTNYASYEHEDLKAMVTENMDPTQVHHFGQVCNEVGVVLTDLHGELAKAVAASANYWQGEAADRARAAITRLADSALENGHAAKYVSDKFAMQGEAAELAKNAMPEVVQYSNADALRELLRADPFEIGSTVAAIEQRFTAKQNARLEAARVMSTMEASLGDSVRAMPLFRAPEPAVQGTGVVDHSGTTPVVPQPQPVQPKVTVTTSGTTEPPSKSVPDRLSEPTPSQFPVTTTDTQGSEVPVPPGTAGLPGTTAPSSAGSTGLPTTIGLPGTAGLPGSGTGLPGATGLRGGSTGRPGSTVGRPGGTGLPGSVTGRPGATARPGAATGPGGAAGRDGLLPPVDKSKREQDGEHRQAQFLKQEHDEFWFDGVPSTAPPVIGED
>NZ_CP007155.1|WP_025355047.1|1546091_1546817_-|uroporphyrinogen-III-C-methyltransferase
MTVHLVGAGPGDPGLLTCRAAELLGSAEVVVYDRPSMADILALAGTGDKRCVGKSGSRPAWPQAEVNQLLVDLGRAGREVVRLKAGDPFVVSRGGEEALALAGAGVPFEVVPGISAAIAAPALAGIPVMVRQIATTLTVVAGNEDPEYRQRIDWSAVAAVGGTVVVLTGRSALRGIAEELLAAGMAADTPVTAVSAASRAHQRRVTGTLAALPDPRMRPPVTFVIGAVAALDLLEGSDAHP
>NZ_CP007155.1|WP_025355048.1|1546813_1547557_-|precorrin-3B-C(17)-methyltransferase
MTGLLTVVGLGPGAAEHRTPAAAQAVREAEVVLGYSAYIDACADLLGAGQTVLRGRMTEESRRAEQAVALAAAGHRVALVSSGDAGVYGMATLALSTAAELPVARRPEVRVLPGVTAALASSALVGAPLAHDFACLTLSSLLTPWEEVERRLRAVAAADLALALYNPRSAGRTWQLDRAREVLLEHRGPGTQVALVTDAARPEQHVRLTTLGELDSSVVGMTTTVLVGASATRRLGDWLVTPRAAGA
>NZ_CP007155.1|WP_025355049.1|1547553_1548372_-|cobalt-precorrin-4/precorrin-4-C(11)-methyltransferase
MISFVGAGPGAADLMTFRGAARLARAEVVVWASSLIPAEVLEHANPSAERHDSAGMTLEDVLAVYARHPEAAIVRLHSGDTSVYGAIGEQIAWCRSTGREYEIVPGVGSLSAAAAAIGRELTAPGVAQSIVQTRLAGGRTAASMPAGESVAAFAGHRTTMAVYLSAQRPAQLQAELLAEGRGYAPGTPAVVVAKASWPDERVITTTVGGLAEDLAASGIRTAALVLVGDALGEIEPQRTRLYDPRYSHGCRRRSTEGSTEGRAIPVEKRRLP
>NZ_CP007155.1|WP_042220282.1|1548683_1549229_+|precorrin-8X-methylmutase
MARVRHPIEQESYRILRSRVDTSGLPVLSRAVVERLVHTTADPSWAGDLLVDERALESGRRALTSGVPLITDVRMVAAGVTSRPAHIAAETEGGIGALAGQYAQGAVFALGQDFAAVNELAGLCASGALRPALVIALPAGFVGAVEAKRALRESGVPALTNRGERGGAALATAAVNALLYA
>NZ_CP007155.1|WP_025355050.1|1549315_1550068_+|SIS-domain-containing-protein
MAVNQDGFLAAAHEVIDRLVRTQREPIAAAAGLVAQCVLGGGVVHAFGTGHSQGLVMEIAGRAGGLIPTNKLSLRDVVTYGDTPAGALDKYVERDPAIAHRIYELAPVQDGDLFVIASNSGGNGSTVEMASLVKRRGHGLIAFTSLDHATAVASRHPSGKHLHDLADVVIDNCGPMGDTLLPLPTGGAVCAISSITAAMAAQMMLADAAALILAAGQTPPVYLSANVPEGDAHNRELEQRYEGRIRRDPS
>NZ_CP007155.1|WP_025355051.1|1550034_1551030_-|YafY-family-transcriptional-regulator
MRASRLLSTLLLLQTRGRMTAQELADELEVSVRTVYRDVESLSAAGVPVYADRGPTGGYQLLDGYRTRLTGLTSDEADSLFLAGMPGPAAELGLGTVVATAELKLLAALPAELRSRASRIRERFHLDAPGWLREADQAPHLAEIAEAVWNQRVLELRYRRWAKPREVTRRVRPLGVVLKAGTWYLVALADEDLRTYRVSNVLAVQTLDERFDRPADFDLPGYWQEWAEQFEARMRGQQAVIRVSPEAMGWLRALLGTFAADAVRASAGEPGPDGWVRAVLPIESVRHAHVELLKFGGMVEVLEPAELRELMVRTAGELAALYEGSRRILPS
>NZ_CP007155.1|WP_030108414.1|1551046_1552138_-|winged-helix-DNA-binding-domain-containing-protein
MTTEVSREQVLWYRTRQQGLLRESEHPEVLELGLQDSPAGVARLALAARTTGEADLSGFDLAWTLRGAPYFHRPGELARLAAELWPWSEADAQARLLWPRSRTSTGGLTPLATYRLLAESLRSIVVGPMTKGAASAALTKLVPPEQTRWCPGCKSQHVYEQPFRLAALPAGLGIEPGESPLTLVHAHNAKGVPEQSAGAERLMRAYLRFLGPATPTEVAKWLDTSAAEVRGRWPQGLAEVRVDGRKCWLPSDRLDDLVSAQPPELVRLLPTSDPFLQARDRAVVLPHKEQQKTLWTILGSPGAVLVDGEVLGVWRAKLGRKDRLDVTITQFGELDPPAREAARAEAERVAGVRGVPSVSVSFS
>NZ_CP007155.1|WP_025355053.1|1552163_1554098_-|glycosyltransferase-family-39-protein
MTAKWSRIALGLVLLAAALLYGWALGADGNWGNPYYAAAVRAMAQSPTNFVFGALDPQGVVTVDKPPLALWPQVISTWVFGYQPWAVLLPQVVEGVAAVFLLHRTVRHWMGEHAGLIAAAALALTPITVAIDRDNNPDTLLVLFLVAAAYAFTRALGAEHRTRWLVLAGVFIGCGFTTKMLQAWVVLPAFALAYLLGVRAVWWRKLLDLFGALVAVAVSSLWWVLLVQFWPGRKPFIGSSGTGSVWDLVIGYNGIGRVLGQSSPGGGKSAEFTSLMSIVLFGGVPGPLRLFNPLLGGQISWLLPLALLAVLAVAVVRGTASRAERAGWWLWGGWLLVGALVLSFSVGTFHAYYTTMLAPAIAALTGGGLVRFWQWYRRPSGVLWLVLPLAVALTAGWAWLLVARDPTWHGELRYLVGALGVVSVGWLVLGRFRLGGGRVAAVLGLVTVLLAPGVWCVATAIGPSQALMGASNPTAGPFVVPPYFVQQYGEQAVPSIRATLQGLSGNAATEVHLSNAETEVLDYAATHSRTPITLAVEGGAVTAGDYLVAADETVVVLGGFEGVDPAPDATGLSGWVRSGRVRFVLTSTATEPGKIDVRDLSTVFAALGGPTEAARIEWVHRNCVRVPWIVEQGRGLYDCDPDSR
>NZ_CP007155.1|WP_042220284.1|1554317_1554608_-|hypothetical-protein
MNLADSSLETVMTLLLIRFGVIAAGIAVLVVIGFTVLVVLKRKGKLSQARKYIEPVARSVAQSRGNPRRPSQGVLRRTAARAVTNYLEREDDHGKR
>NZ_CP007155.1|WP_081789234.1|1554770_1555592_+|hypothetical-protein
MAELRSARVNSPLINRRDLVRGIMLGAAATGLAAALPLGAAASPSANWVLRWSPDPKRDGLNAFEGVEDDRAHSHPGVKHIYVEDDHWRFDMHTRDRDSSPDRQRNEVKGLRQAGTALKILENETWRITYQAFWPTALTATTSFSHIFQIKVPDVGSPLVTMTLRQKDRPTIEVITATDDGSFTHHPPVDYAPLQNKWIDVEWEFKAADSGGYLRWALRDGDRTVVDYRTGAVDLWRGKNYLRPKWGIYRSINSAGLRDCYQLTRNYRGYQLV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_5

2005222-2005332

Orphan

Consensus_repeat	Method
CGTCCTGAACGGCACCTTCCTGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_5

>merge|NZ_CP007155|5|2005222-2005332|CRISPRCasFinder
CGTCCTGAACGGCACCTTCCTGACATCGGCGGCGCTGCCCGGCCCAGGGTGGACCCGTCAGGAAGGTGCCCTTTGGGACGTCCAACGTCCTCAACGGCACCTTCCTGACAT

>NZ_CP007155|5|4|2005222-2005332|CRISPRCasFinder
CGTCCTGAACGGCACCTTCCTGACAT	CGGCGGCGCTGCCCGGCCCAGGGTGGACCCGTCAGGAAGGTGCCCTTTGGGACGTCCAA
CGTCCTCAACGGCACCTTCCTGACAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025355394.1\|1995812_1996391_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007155.1\|WP_025355398.1\|1999870_2000482_+\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377290
NZ_CP007155.1\|WP_025355409.1\|2009677_2010064_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_035971902.1\|2000478_2001090_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007155.1\|WP_025355396.1\|1997441_1998818_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP007155.1\|WP_025355410.1\|2010139_2011339_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225306
NZ_CP007155.1\|WP_025355397.1\|1998834_1999866_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP007155.1\|WP_025355413.1\|2014147_2014783_+\|nicotinamide-mononucleotide-transporter	unknown	unknown	gnl\|CDD\|377432
NZ_CP007155.1\|WP_025355412.1\|2013296_2014076_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377524
NZ_CP007155.1\|WP_025355403.1\|2004533_2005145_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025355414.1\|2014683_2015643_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200563
NZ_CP007155.1\|WP_148309409.1\|2011443_2012991_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|312032
NZ_CP007155.1\|WP_025355402.1\|2003995_2004499_+\|DUF3145-domain-containing-protein	unknown	unknown	gnl\|CDD\|378644
NZ_CP007155.1\|WP_025355401.1\|2002398_2003727_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_081789260.1\|2008590_2009532_-\|ACP-S-malonyltransferase	unknown	unknown	gnl\|CDD\|223408
NZ_CP007155.1\|WP_025355406.1\|2007311_2007551_-\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|179197
NZ_CP007155.1\|WP_025355407.1\|2007607_2008594_-\|ketoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|236475
NZ_CP007155.1\|WP_025355400.1\|2001230_2002409_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|367570
NZ_CP007155.1\|WP_025355405.1\|2006082_2007315_-\|beta-ketoacyl-ACP-synthase-II	unknown	unknown	gnl\|CDD\|274452
NZ_CP007155.1\|WP_030111012.1\|1996448_1997204_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235546

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025355394.1\|1995812_1996391_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.9495e-10
NZ_CP007155.1\|WP_025355398.1\|1999870_2000482_+\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	6.59183e-37
NZ_CP007155.1\|WP_025355413.1\|2014147_2014783_+\|nicotinamide-mononucleotide-transporter	gnl\|CDD\|377432	pfam04973, NMN_transporter, Nicotinamide mononucleotide transporter. Members of this family are integral membrane proteins that are involved in transport of nicotinamide mononucleotide.	1.60903e-39
NZ_CP007155.1\|WP_035971902.1\|2000478_2001090_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	9.28731e-07
NZ_CP007155.1\|WP_025355396.1\|1997441_1998818_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	1.43394e-109
NZ_CP007155.1\|WP_025355410.1\|2010139_2011339_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225306	COG2508, COG2508, Regulator of polyketide synthase expression [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism].	1.57528e-21
NZ_CP007155.1\|WP_025355397.1\|1998834_1999866_+\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	6.53896e-90
NZ_CP007155.1\|WP_025355412.1\|2013296_2014076_+\|hypothetical-protein	gnl\|CDD\|377524	pfam05552, TM_helix, Conserved TM helix. This alignment represents a conserved transmembrane helix as well as some flanking sequence. It is often found in association with pfam00924.	9.56598e-08
NZ_CP007155.1\|WP_025355414.1\|2014683_2015643_-\|polysaccharide-deacetylase	gnl\|CDD\|200563	cd10938, CE4_HpPgdA_like, Catalytic domain of Helicobacter pylori peptidoglycan deacetylase (HpPgdA) and similar proteins. This family is represented by a peptidoglycan deacetylase (HP0310, HpPgdA) from the gram-negative pathogen Helicobacter pylori. HpPgdA has the ability to bind a metal ion at the active site and is responsible for a peptidoglycan modification that counteracts the host immune response. It functions as a homotetramer. The monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of polysaccharide deacetylase (DCA)-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. In contrast to typical NodB-like DCAs, HpPgdA does not exhibit a solvent-accessible polysaccharide binding groove, suggesting that the enzyme binds a small molecule at the active site.	8.88322e-110
NZ_CP007155.1\|WP_148309409.1\|2011443_2012991_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|312032	pfam08386, Abhydrolase_4, TAP-like protein. This is a family of putative bacterial peptidases and hydrolases that bear similarity to a tripeptidyl aminopeptidase isolated from Streptomyces lividans. A member of this family is thought to be involved in the C-terminal processing of propionicin F, a bacteriocidin characterized from Propionibacterium freudenreichii.	2.94913e-10
NZ_CP007155.1\|WP_025355402.1\|2003995_2004499_+\|DUF3145-domain-containing-protein	gnl\|CDD\|378644	pfam11343, DUF3145, Protein of unknown function (DUF3145). This family of proteins with unknown function appear to be restricted to Actinobacteria.	2.00246e-90
NZ_CP007155.1\|WP_025355407.1\|2007607_2008594_-\|ketoacyl-ACP-synthase-III	gnl\|CDD\|236475	PRK09352, PRK09352, beta-ketoacyl-ACP synthase 3.	3.26774e-142
NZ_CP007155.1\|WP_081789260.1\|2008590_2009532_-\|ACP-S-malonyltransferase	gnl\|CDD\|223408	COG0331, FabD, (acyl-carrier-protein) S-malonyltransferase [Lipid metabolism].	8.04205e-82
NZ_CP007155.1\|WP_025355406.1\|2007311_2007551_-\|acyl-carrier-protein	gnl\|CDD\|179197	PRK00982, acpP, acyl carrier protein; Provisional.	4.30775e-25
NZ_CP007155.1\|WP_025355400.1\|2001230_2002409_+\|alpha/beta-hydrolase	gnl\|CDD\|367570	pfam03583, LIP, Secretory lipase. These lipases are expressed and secreted during the infection cycle of these pathogens. In particular, C. albicans has a large number of different lipases, possibly reflecting broad lipolytic activity, which may contribute to the persistence and virulence of C. albicans in human tissue.	3.45231e-07
NZ_CP007155.1\|WP_025355405.1\|2006082_2007315_-\|beta-ketoacyl-ACP-synthase-II	gnl\|CDD\|274452	TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II. 3-oxoacyl-[acyl-carrier-protein] synthase 2 (KAS-II, FabF) is involved in the condensation step of fatty acid biosynthesis in which the malonyl donor group is decarboxylated and the resulting carbanion used to attack and extend the acyl group attached to the acyl carrier protein. Most genomes encoding fatty acid biosynthesis contain a number of condensing enzymes, often of all three types: 1, 2 and 3. Synthase 2 is mechanistically related to synthase 1 (KAS-I, FabB) containing a number of absolutely conserved catalytic residues in common. This model is based primarily on genes which are found in apparent operons with other essential genes of fatty acid biosynthesis (GenProp0681). The large gap between the trusted cutoff and the noise cutoff contains many genes which are not found adjacent to genes of the fatty acid pathway in genomes that often also contain a better hit to this model. These genes may be involved in other processes such as polyketide biosyntheses. Some genomes contain more than one above-trusted hit to this model which may result from recent paralogous expansions. Second hits to this model which are not next to other fatty acid biosynthesis genes may be involved in other processes. FabB sequences should fall well below the noise cutoff of this model. [Fatty acid and phospholipid metabolism, Biosynthesis].	0
NZ_CP007155.1\|WP_030111012.1\|1996448_1997204_+\|glucose-1-dehydrogenase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	6.75842e-77

>NZ_CP007155.1|WP_025355403.1|2004533_2005145_+|hypothetical-protein
MSAPQHPRRTGHWLIPVVGLILVCSVVGGFAARQFYAVGATAPGGHSTTNTAEPSDTGAPAVDPKSRTVVMTRDAQSSPVHDQVRRTAQRFFDSINDRDYQNWLKTVSYRLGQSKPEAAWKFDYDTTQDTAMVVERINPAHDGSDSVIAMVNFTSHQAVKKAPTKAPSDCNQWWIVWSMVWEQGNLVIDAGTANLFPQVRICQ
>NZ_CP007155.1|WP_025355402.1|2003995_2004499_+|DUF3145-domain-containing-protein
MNNRGSTSGVVYVHSSPSAVCPHVEWAISGTLGVRADLRWAAQPALPGQLRAECAWTGEAGTGSSLAGALKAWPMLRFEVTEDPSPGTDGERFCFAPGIGLWHSRTSANGDIVVTEDQLRALASGSRGGESFAHGVDSLLGKPWDDALEPFRRAGDGAPVTWLHRVG
>NZ_CP007155.1|WP_025355401.1|2002398_2003727_-|hypothetical-protein
MRLVRLGEATSKVAADLKAALAAWGSGDTILGGVALLGYQPPGHPRPVDAVLVLPGAVLVVVGVDLPDPALKLDAPLSGQWRIDGWPLVSPTGTVNPASEAVTATAAITAHLRPVLGESARLGVIVAVGPYVSEVTQPEEDLAGGARVLHPKPSTLLTCAQELATGPSMSAARAAAVLAALHPDAPTGDLAAEGFAEQEQEQEAVEAAAAPKQRQDKSRQDRQRPEKSRGETARPEPQLPPVPAPAKAEQKTGTGKPRKWLPIGAAAAVVVLIGAGIVAALVTGSSSRAVQPQTATVDGTNYTRADSTQDGTGCGQHSYGDLQVWLGAHPCADLRRWSYSAEVNGRSAALAVAEVGFADAKVAEQFRAAAAKPGGGGIADLVREGRGWPGGPSSFERAAFSSAQTGTKVRLVEAVWASGASSPEDAELTALTKRTLSLPLTD
>NZ_CP007155.1|WP_025355400.1|2001230_2002409_+|alpha/beta-hydrolase
MKRLALLVLLLTACSTPDALAQAKAAEAANALPRAAFYDTAPDSAAPGTPLRAERFTGWALPEGAVGTRLVYDSRSAQGKPVAASAAVLTPAGAPPSGGWPVIAWAHGTSGVAQQCAPSLMKDLYYGEFVANWLRQGFAVVATDYSGLGAGSGHEYLTLTANANDVRYSVAAARKAVAGLGDRWVVVGHSQGGQTAWGVARQQVAEPVGQFLGSVALAPVTPYDRLQQTVQDNQGQGQYLAYVASSIALQHPGFQPMDMLSEAGMRDYDQYLHAGCWSVGRVLSGTGTPRQLLRADWSHNPAVSQFLVGNRYSTAPLAGPLFVASGATDQDVAASTIAPVVAEQCGQGTPVAYHQYPGDHESVLDQASADLVRWIRDRFAGGSPAPSTCLSR
>NZ_CP007155.1|WP_035971902.1|2000478_2001090_-|TetR/AcrR-family-transcriptional-regulator
MDTSLRLIELHGAEGLSMRRLGAALGADATAVYRYFANKHQLLLALADELIGRTFAGFEPTGQWQRDLRTLAGLIHGVNLAHPRAAAVVTARVTGRPHELAAVETIIGILRGAGFTPARAVRHYHCFISLVLAFSALDSAMCSGDKAELAAETATWREVYRELPAGQYPNIAEGADLLVAQMRHSPFEATVELFLSALAARLD
>NZ_CP007155.1|WP_025355398.1|1999870_2000482_+|FMN-binding-negative-transcriptional-regulator
MLIHPWDAAQHDTEWRDWLSTHDFGQLIAPGAGRDLPVVVPTHFRYDGERTVLLHLARPNPVWHALDEHPRALLAVTGDYTYVPAAWNAAEDTDPAQGVPTSYYAAVHLECDVRVLDDPAVKAELLNAQLAHFEPGSGRHPVTPDERLLKGIRGIELTVTAVRAKFKYGGNRSEADRARISERLRERNGFLDAEARGHLTRRG
>NZ_CP007155.1|WP_025355397.1|1998834_1999866_+|serine/threonine-protein-kinase
MRQEQDLLAGRYRLGALLGEGGVARVYRAVDVRLNRLVAVKLFRPTLDEVGRRRFAQEARVLGTLRHPGLVKLFDAGTDGDRAYLVMELVDGATLLDRLCDQPLGPAEVAELGATLAQALTYVHARGVVHRDVKPSNILLDSDGAPHLADFGFARAVDATAVSPTGQIVGTAAYLAPEQVRGEPVGPAADVYALGLVLLECLTGELEYEGPRVEAALARLTRPPRIPADLPAPLAAALVAMTRAEPEDRPSARSCATRLSDVAQRLTTRTGVLSVPQLRRRRTIAVAAIGALALAALLLAQPHGSEEQHSVEPQQNTTTATPQAYTPIPVVSPLEQAADTRTR
>NZ_CP007155.1|WP_025355396.1|1997441_1998818_+|NAD(P)/FAD-dependent-oxidoreductase
MVIGGGPVGENVAARAVRGGLTAALVEHELVGGECSYWACMPSKALLRPGHALAAARRLPGVPVGDRLDPAAVLARRDSFTSHWDDSGQVSWAEGAGITVVRGHGRIAGERQVSVGDRLLTARHAVVVSTGSVPFTPPIEGIDTVRTWSSREATSAKSVPTSLAVLGGGVVGVEMAQAWARLGAEVTLVVSQDRPLPRQEPFVGELVAQGLAEDGVRVLTGVSGQAVSQVDGQVRLALSDGSTVSAQELLVATGRRPATADIGVDLVGLNPGSPLTCDDTGLVEGVDGQWLYAAGDVNGRAPLTHQGKYQARAVGDVIAARARGGAVDTSPWSPLVSTADHAAVPQVVFTDPEVAFVGRTAEQAAKDGLRTRVVDLDIAVAGSSLHADGYRGKARMVVDEDRRVLVGVTFVGQDVAELLHSATVAVVGAVPVDRLWHAVPSYPTISEVWLRLLEAYGL
>NZ_CP007155.1|WP_030111012.1|1996448_1997204_+|glucose-1-dehydrogenase
MSRFTDKVVLVSGAGSGLGRAAALAFAAEGASVVLTGRSADTLAETASAIEAAGGKALVVTADVAVEEDVRRVIDTVLAHHGRLDVAFNNAGVLGAGPLVELDSATVDEVLATNVKGTWLALKHQIPQMVRQGGGAIVNMSSVLGAYKSVPGTTVYGAAKAAVLALTKGAALEHAADKVRINAVSPGAVGGPMSQQPGETAQQRDQRVAETVPVGRIGSAEEIAEAVLWLASDQASYVTGQDVVLDGASSL
>NZ_CP007155.1|WP_025355394.1|1995812_1996391_+|TetR/AcrR-family-transcriptional-regulator
MARTKEFDPDAALRAAVDLFWRKGYEATSMQDLVDHLGIGRASIYATFGSKHELYTAALARYGEDAGGQVLDLLGRSGPALPAVRRLVRTFAEQSLADPDRKGCLVTNTAVECLPGDRELARLVEASLDQLETALAMALTRARAQGELAEGADPRALARFLLTLLQGIRVIAKTPDRQRLTDAVDQALSVLG
>NZ_CP007155.1|WP_025355405.1|2006082_2007315_-|beta-ketoacyl-ACP-synthase-II
MTEIDVVVTGLGATTPLGGDVASTWDGLLTGRSGVSALDADWVHKYEMPVQIAAQLAVEPTEILPRVEARRLDRSEQVAVVAAKQAYADAGLSEDAVDPFRLAVIVGTGIGGAMTLLNQDDLLETHGLRKVSPLTVPMLMPNGPAAHVGLLFKARAGVHAPVSACASGSEALAWAWRMIKTGEADVVIAGGAEACITGITMAGFAQARTMSTRNDDPARASRPFDGQRDGFVLGEGAGIMVLERGEFARARGARIYATLAGAGTSADSYHITGPDPEGTGQARAITAALRTGGIDKADVGHVNCHATSTPVGDVIESLAVHKSVGDHPLLTAPKGSLGHLLGASGAVEAIATVLSVRDGVIPPTANLENPDPAMLHEVVAGKPREVSLTAAVNDSFGFGGHNVALAFTPA
>NZ_CP007155.1|WP_025355406.1|2007311_2007551_-|acyl-carrier-protein
MENEEIRTGLAEIVEEVAGVAADDVTVEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPDDELANLKTVGDAVTYIAANA
>NZ_CP007155.1|WP_025355407.1|2007607_2008594_-|ketoacyl-ACP-synthase-III
MSGRPNLLRTSGPAGSKLLGFGSAQGNRVVTNEDIAASGVDTSDEWIRQRVGIVERRLADPDQSLVDMAVEAGSKALADAGLVPSDVDTVLVATCTMPGNIPNAAAQTADRIGVKAPAAFDLNAACAGFPYSLTVATDMIRGGSAKRVLVIGAERFTDWVDWQDRGNCIIFADGAGAAVVGPSEEPLIGPAVLGSAGDLVDMIGLTERGHIFQEGQSVFRWATTQIAPIAERAVEASGLKLSDIDVLVPHQANLRIVELIAKKLRARGARDEMVVADDIQYSGNTSSASIPMAIDHMRAAGRISSGDVMLLVGFGAGLSYAGQVAICP
>NZ_CP007155.1|WP_081789260.1|2008590_2009532_-|ACP-S-malonyltransferase
MTVFSERVIALLAPGQGSQAPGMLTPWLELDGVEQLVRGWSQATGLDLLRLGTTAEAEEIKDTAITQPLIVAMSLLAHRELVKRVELPEGTPVAGHSVGELAAAAIAGVLSADDAVALAAVRGAAMARACALESTGMAAVMGGNAEELLARLDDYGLTPANRNGAGQTVAAGSVEALRKLSEDRPAGTKVVMLKVAGAFHTHYMEPARVELAERAAQVSTADPVLPLLSNADGAVVTSGAEMLRRLVAQVTLPVRWDLCMDSLAELGVTTTVELPPAGALTGLVKRQLKDVVTQPLACKTPADLDRVLEAVRA
>NZ_CP007155.1|WP_025355409.1|2009677_2010064_-|hypothetical-protein
MHKALTVTAALAAVAAVSACSNPTGKAWAITYEVTAEGTGTLSNISYAETVNRYQNSTTKHELAGPLGLPWKLDVVIGAGEQAEVTAKPSAGTGVLSCRILLDGTKELAKATAPAAGQPVTCTKKTDS
>NZ_CP007155.1|WP_025355410.1|2010139_2011339_-|helix-turn-helix-domain-containing-protein
MNGVGGLEWESLSAKTLRELEHASGALASGTIEAMEQRLPWFRRLPADQRASVLLVTQSGVAGFVSWLRDTKQAIRLTADAFRSAPKDMSRWVSLRQTVELVRVALEVFEGRLPEIAADEHESAMLTAAVLRYGREIAFAAATSYAAAAEARGAWDARLEALVVDGIVRGDTEEALVSRAAALGWEPAAEATVLVGNPASDEPTRVVFDVRSRAARVSRPVLLSVQGSRLVVVLGGPADEAGGREVLPKMAEAFGPGPVVVGPTVSSVAEAHRSASDALSGLRAVVGWPTAPRPVRSLDLLPERALAGDPEAEYQLIDRVARPLEDATGGLMETVDAYLEVGGVLEACARKLFVHPNTVRYRLRRVAELTGRNANDPRDALVLRVALTVGRLARARGLW
>NZ_CP007155.1|WP_148309409.1|2011443_2012991_+|alpha/beta-fold-hydrolase
MRRMLAVAVSALAACLLVPPVSGAATPRLVWSPCTGSLSTLECGSLAVPLDHLHPDGEKIAVAVSRRRAADPQHRRGVLLINPGGPGGSGLSMPRYVADHTPLGQYYDLVGFDPRGVGASTALNCLRSPTLADTDSRPADAEFASWTAQARADEDACQRAGGGIRPFVTTANTARDMDLLRAALGEEKINYLGYSYGTYLGAVYGTLFPQRLNLSVLDSSVHPEWLWRKQFLEQAAAYRADVDAWADWVGHRDNAYGLGTSSGAVLSTVERLAGRLAKSPVGEFTRSMLDGALGQGARYRPLWSDLAVLVGRISRGQAPDPGVLDATRAGRALAEAGIHELRSGVFDTVTCEADWPTDPETYYQDMRTYRDRFPYGYGVSRAAPTGCTFRSFTPADHPVRLARTGYPVGVVVQAEADAQTQYAGGPAMANLLRDNLITVTDEGRHGEYGSNPCVNERINRYFVDGVLPDSRSVCAGDPRPGTAADPAVPPAAVAPARAASLTDSVRTYLSALPPI
>NZ_CP007155.1|WP_025355412.1|2013296_2014076_+|hypothetical-protein
MDSQLSQGLGAAWALITTFVPKLLGFLLVLLIGWLIATALSKAVQLLLAKTGFAKLVAKAGIGGPKSPVDAGGLIVKLVFYFILLIALQFAFGAFGPGNAVSELLNEVIAYLPRVVVAIVLVLIASAIARVVRDLVTGALAGRQFGPLLGTISYAFLLALGVIAALNQLGIATTVTEPVLIAVLATVGGVIVVGVGGGLIGPMQSRWEHWLTRAQAETTGGEPGSAGGQPAGAPWERNQPAPSETPTPPEGFTQPPTTG
>NZ_CP007155.1|WP_025355413.1|2014147_2014783_+|nicotinamide-mononucleotide-transporter
MNWLLENGLLLLGERISFAELIGQIGAVAVVFLAQRRTLWTWPVQLLAAVLLFSVYSSAHLGGLAIRQVIVFGISCYGWWAWTRRRDPVFGIEVRRSTRPELLGILAALVIGTVGMALLLQQFNASWAPWPDAAIFIGTAVAYAAQGLRLVEFWLIWLLVDAVGVPLQLASGLYFSAAVYIVFAGLVVKGWLDWARTARSISAREPAQVSG
>NZ_CP007155.1|WP_025355414.1|2014683_2015643_-|polysaccharide-deacetylase
MTQPWEWDEPTWRGHVQRVRAGRSLKPESWPGGARVAVALSFDADHETIPLRDADLSPCRLSQGEYGSRTAVPRVLRLLAEHGIPATFFVPAVSGLLHPEDLRLFVDAGHEVALHGWIHERNTDLPPGVERELALRSADTLERLTGRRPVGLRTPSWDFSADTLSIVRELGLAYDSSLMADDEPYELLADGQPTGVVEIPVEWIRDDAPFFPRDPTRPNLAPRDVLRLWCDEFDGAHAEGGLFQLTMHPHVIGHRGRLVALRELIGHVLGHQDVWWASHPRRGGRLGQPLTWAGSRALMLRAVLAQSSQPLTTSPANTM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_6

3365940-3366094

Orphan

Consensus_repeat	Method
CCCCGCTCGCGCGGGGACGACGC	CRISPRCasFinder

2 spacers

WYL

The CRISPR arrays of NZ_CP007155_6

>merge|NZ_CP007155|6|3365940-3366094|CRISPRCasFinder
TCCCGCTCGCCGGTGGGCGAGTCCCGCGCTGGCGGCGGTCGGGTCGGTGACAGGTCGGATTTGGTGCGGAACCCCGCTCGCGCGGGGACGACGCCTTTGCACCACCGCCGTACACATAGGTGAAGGGAACACCCCCGCTCGCGCGGGGAGGACGC

>NZ_CP007155|6|5|3365940-3366094|CRISPRCasFinder
TCCCGCTCGCCGGTGGGCGAGTC	CCGCGCTGGCGGCGGTCGGGTCGGTGACAGGTCGGATTTGGTGCGGAA
CCCCGCTCGCGCGGGGACGACGC	CTTTGCACCACCGCCGTACACATAGGTGAAGGGAACAC
CCCCGCTCGCGCGGGGAGGACGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025356567.1\|3376967_3377981_+\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP007155.1\|WP_025356547.1\|3354276_3355014_+\|proteasome-subunit-alpha	unknown	unknown	gnl\|CDD\|163403
NZ_CP007155.1\|WP_025356558.1\|3364952_3365813_+\|YegS/Rv2252/BmrU-family-lipid-kinase	unknown	unknown	gnl\|CDD\|237021
NZ_CP007155.1\|WP_042221828.1\|3368127_3368958_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP007155.1\|WP_025356565.1\|3375243_3375753_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP007155.1\|WP_042222118.1\|3356461_3357871_-\|bifunctional-phosphatase-PAP2/diacylglycerol-kinase-family-protein	unknown	unknown	gnl\|CDD\|224513
NZ_CP007155.1\|WP_025356562.1\|3372389_3373070_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025356561.1\|3369113_3372350_+\|methylmalonyl-CoA-mutase-family-protein	unknown	unknown	gnl\|CDD\|239650
NZ_CP007155.1\|WP_035976621.1\|3373132_3374158_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP007155.1\|WP_025356556.1\|3363754_3364000_+\|bacteriophage-holin	unknown	unknown	unknown
NZ_CP007155.1\|WP_081789886.1\|3364080_3364956_+\|twin-arginine-translocase-subunit-TatC	unknown	unknown	gnl\|CDD\|376413
NZ_CP007155.1\|WP_148309477.1\|3357949_3361600_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|223533
NZ_CP007155.1\|WP_025356554.1\|3361698_3362688_+\|WYL-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP007155.1\|WP_025356560.1\|3366918_3367953_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176531
NZ_CP007155.1\|WP_025356555.1\|3362761_3363736_+\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP007155.1\|WP_148309476.1\|3355598_3356408_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025356566.1\|3375868_3376966_+\|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|213783
NZ_CP007155.1\|WP_042222121.1\|3374255_3375242_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293811
NZ_CP007155.1\|WP_030110080.1\|3366312_3366657_+\|DUF1049-domain-containing-protein	unknown	unknown	gnl\|CDD\|227703
NZ_CP007155.1\|WP_148309475.1\|3355326_3355578_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025356567.1\|3376967_3377981_+\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	2.36132e-154
NZ_CP007155.1\|WP_025356547.1\|3354276_3355014_+\|proteasome-subunit-alpha	gnl\|CDD\|163403	TIGR03691, 20S_bact_alpha, proteasome, alpha subunit, bacterial type. Members of this family are the alpha subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In most Actinobacteria (an exception is Propionibacterium acnes), the proteasome is accompanied by a system of tagging proteins for degradation with Pup. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	9.09639e-120
NZ_CP007155.1\|WP_025356558.1\|3364952_3365813_+\|YegS/Rv2252/BmrU-family-lipid-kinase	gnl\|CDD\|237021	PRK11914, PRK11914, diacylglycerol kinase; Reviewed.	8.45119e-74
NZ_CP007155.1\|WP_042221828.1\|3368127_3368958_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	2.81642e-25
NZ_CP007155.1\|WP_025356565.1\|3375243_3375753_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.67176e-32
NZ_CP007155.1\|WP_025356560.1\|3366918_3367953_-\|hypothetical-protein	gnl\|CDD\|176531	cd08589, PI-PLCc_SaPLC1_like, Catalytic domain of Streptomyces antibioticus phosphatidylinositol-specific phospholipase C1-like proteins. This subfamily corresponds to the catalytic domain present in Streptomyces antibioticus phosphatidylinositol-specific phospholipase C1 (SaPLC1) and similar proteins. The typical bacterial phosphatidylinositol-specific phospholipase C (PI-PLC, EC 4.6.1.13) catalyzes Ca2+-independent hydrolysis of the membrane lipid phosphatidylinositol (PI) to produce phosphorylated myo-inositol and diacylglycerol (DAG). The catalytic mechanism is based on general base and acid catalysis utilizing two well conserved histidines, and consists of two steps, a phosphotransfer and a phosphodiesterase reaction. In contrast, SaPLC1 is the first known natural Ca2+-dependent bacterial PI-PLC. It is more closely related to the eukaryotic PI-PLCs rather than the typical bacterial PI-PLCs. It participates in PI metabolism to generate myo-inositol-1-phosphate and myo-inositol-1:2-cyclic phosphate simultaneously. SaPLC1 and other members in this subfamily have two Ca2+-chelating amino acid substitutions which convert them from metal-independent enzymes to metal-dependent bacterial PI-PLC. Additionally, SaPLC1 active site utilizes a mechanism of amino acid juxtaposition, swapping amino acid positions, to adapt a calcium binding pocket and maintain more ideal active site geometry to support efficient catalysis.	9.21161e-81
NZ_CP007155.1\|WP_042222121.1\|3374255_3375242_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293811	cd07725, TTHA1429-like_MBL-fold, uncharacterized Thermus thermophilus TTHA1429 and related proteins; MBL-fold metallo hydrolase domain. Includes the MBL-fold metallo hydrolase domain of uncharacterized Thermus thermophilus TTHA1429 and related proteins. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.14421e-36
NZ_CP007155.1\|WP_025356561.1\|3369113_3372350_+\|methylmalonyl-CoA-mutase-family-protein	gnl\|CDD\|239650	cd03678, MM_CoA_mutase_1, Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, unknown subfamily 1; composed of uncharacterized bacterial proteins containing a C-terminal MCM domain. MCM catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA. The reaction proceeds via radical intermediates beginning with a substrate-induced homolytic cleavage of the Co-C bond of coenzyme B12 to produce cob(II)alamin and the deoxyadenosyl radical. MCM plays an important role in the conversion of propionyl-CoA to succinyl-CoA during the degradation of propionate for the Krebs cycle. In some bacteria, MCM is involved in the reverse metabolic reaction, the rearrangement of succinyl-CoA to methylmalonyl-CoA. Members of this subfamily also contain an N-terminal coenzyme B12 binding domain followed by a domain similar to the E. coli ArgK membrane ATPase.	0
NZ_CP007155.1\|WP_035976621.1\|3373132_3374158_+\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	1.52326e-55
NZ_CP007155.1\|WP_081789886.1\|3364080_3364956_+\|twin-arginine-translocase-subunit-TatC	gnl\|CDD\|376413	pfam00902, TatC, Sec-independent protein translocase protein (TatC). The bacterial Tat system has a remarkable ability to transport folded proteins even enzyme complexes across the cytoplasmic membrane. It is structurally and mechanistically similar to the Delta pH-driven thylakoidal protein import pathway. A functional Tat system or Delta pH-dependent pathway requires three integral membrane proteins: TatA/Tha4, TatB/Hcf106 and TatC/cpTatC. The TatC protein is essential for the function of both pathways. It might be involved in twin-arginine signal peptide recognition, protein translocation and proton translocation. Sequence analysis predicts that TatC contains six transmembrane helices (TMHs), and experimental data confirmed that N- and C-termini of TatC or cpTatC are exposed to the cytoplasmic or stromal face of the membrane. The cytoplasmic N-terminus and the first cytoplasmic loop region of the Escherichia coli TatC protein are essential for protein export. At least two TatC molecules co-exist within each Tat translocon.	6.00725e-70
NZ_CP007155.1\|WP_148309477.1\|3357949_3361600_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|223533	COG0457, NrfG, FOG: TPR repeat [General function prediction only].	1.28074e-19
NZ_CP007155.1\|WP_025356554.1\|3361698_3362688_+\|WYL-domain-containing-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.19707e-36
NZ_CP007155.1\|WP_042222118.1\|3356461_3357871_-\|bifunctional-phosphatase-PAP2/diacylglycerol-kinase-family-protein	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	4.0116e-24
NZ_CP007155.1\|WP_025356555.1\|3362761_3363736_+\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.67109e-51
NZ_CP007155.1\|WP_025356566.1\|3375868_3376966_+\|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha	gnl\|CDD\|213783	TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit. Members of this protein family are the alpha subunit of the E1 component of pyruvate dehydrogenase (PDH). This model represents one branch of a larger family that E1-alpha proteins from 2-oxoisovalerate dehydrogenase, acetoin dehydrogenase, another PDH clade, etc. [Energy metabolism, Pyruvate dehydrogenase].	3.7617e-160
NZ_CP007155.1\|WP_030110080.1\|3366312_3366657_+\|DUF1049-domain-containing-protein	gnl\|CDD\|227703	COG5416, COG5416, Uncharacterized integral membrane protein [Function unknown].	5.6794e-15

>NZ_CP007155.1|WP_025356558.1|3364952_3365813_+|YegS/Rv2252/BmrU-family-lipid-kinase
MRIALLVCPASGLGAAGRVAGTVAARLRQISPDVQPFVARDAEGTARFAHEAVTGGADVLAVLGGDGAAHAAVQACAGSQTALAIIPAGTGNDFARAFSLSLDGVDEALRQGSRRQVDLGRVRGGAWFGTVLCAGFDSRVNERANQLRWPRGPRRYDLAVLAEIAQLRADQLVVRTEHESLELDATLIAVGNTPYYGGGIPVCPDADPADGLLDVTIARRVGRGQLVRILPQLRAGRHTDHPAVTTLRARSLTIEGNDWVGYADGERQRELPLHLDCVPNALTLVA
>NZ_CP007155.1|WP_081789886.1|3364080_3364956_+|twin-arginine-translocase-subunit-TatC
MTLVEHLYELRYRLGLALIGIGIGAIFGFVWFGVSLGPVPSLGRLLLAPYTSLPNNLKLPGTEDKLLATAPFEQFMVRLQVGLVAGTVVFSPMWLYQLWAFITPGLYAKEKKFARVFVGAGALLFLAGAALAYYVVPEALLVLASIGSGEFVNAFTADKYLSFLLALILVFGVSFELPLLVVMLNRVGILPYVKLKKWRRGIIFGLFCFAAVATPGQDPISMCVLAGALTVLFELAVQLSRLNDRRKKTEDDWSELSDDEASPLDLSTHPEQPTPESQLAAEAKQRYDDAT
>NZ_CP007155.1|WP_025356556.1|3363754_3364000_+|bacteriophage-holin
MPYLPSALLIILGLVLLVLALLRVFRSLRGLSSASRLARARFSDRSGLLRARVAALGVAIAERRRNHWGRRDGGERAGATR
>NZ_CP007155.1|WP_025356555.1|3362761_3363736_+|YafY-family-transcriptional-regulator
MSTAATERLARLLALVPYLIARPGIRVDEAAADFGVSPRQLRRDLELLWMCGLPGYGPGDLIDLSFEGETITVGFDAGMRRPLRLTGAEATALVVALRALAETPGVADADAVQRALAKVEAAGGEARPAGVVVGLATREPEATPEVRSAVTQAVQGRRAVHIRYYTASRDEITERTVDPMRVLLVEGRSYLEAWCRSAQGVRLFRLDRIDAIEVLDEPAAPPPYAEPTDVSEGLFRPQEGHRNVELVLEPDGRWIAEYYAVERVTELDGGRCRITMRYTDPDWVVRLVLGTGGQAVVLSPPELAERVLHRAQDALRRAGDQLDG
>NZ_CP007155.1|WP_025356554.1|3361698_3362688_+|WYL-domain-containing-protein
MSIVRAERLVNLVLCLLSTRQYLSAERVRTIVPGYTDAATPEAFYRMFERDKAELRDLGIPLETGRNTAFDQAEGYRIARRDYELGDIDLEPDEAAAVALAVRLWDSPELTGAAEGALLKLRAAGVDVDQSTPAVIEPRVRTSEPAFAPLLAAVQTGSVVRFDYRKPAPVEVLTRTVEPWGVVSWRGRWYLVGHDRDREAVRCFRLSRIVGTARAVGRPGVVQPPGEVDLMQFVRGSGDEPVTGTTALLWVARGQAQGLRRRAKVVGTRTVDGVAGDLLEIELRLPESAAGWIAGFGADVAVLEPEVLRKAVYERLLGAVAAARKVVTG
>NZ_CP007155.1|WP_148309477.1|3357949_3361600_-|tetratricopeptide-repeat-protein
MEGRADNSVSGTVHGTVVQGNQVHITQVTHTVPVPCQLPPELPDFTGRASDLAALDALPADRGTVLITAIHGMGGVGKTALAVHWAHRVRDRFPDGQLHVNLRGYDPGQPARPDEVLDGFLRALGVPAEQIPAGLDARTAQFRALCQGRRLLVLLDNANNAEQVRPLLPGSPGCLVLVTSRDSLHGLATTEGAGRLAVDLLPEAEALALVRGIIGERRAEAEPAAVAEIVRLCAGLPLALRIVAHRVGGPLAVVAEELADERERLDALSAGSDERSAVRAVFSWSYRALSAEQAAAFDLLGLVPAPEVSVHAMAALANTSVARARRTLTALAEAHLVDQVAPDRYGCHDLLRSYARELAAERDHDVAPHRLLGFALHTASAADHLLFPAANAWSSDGAPPPAHPLPLADHAAALAWFTAERPLLIALVRQVTGMDRAVWQLTAAMWSYFKRQMVFDAVWVEVFELGLAAARRCGDRLGQAHLHNCLADAYRMARRAEDAAAAANRALALCRDLGDRNGEAAALNNLGTSSRDAGEHEQALEHYRRALRLRERTKDRYRQAITLNNLGSTCITLRRYDLALEYLTEALALRERLDDPNGLSVSLNNLGNLHRYERRYEQAIDYYRRVLALRVELGDTFGLALTTNCLGMTYASMGRPQEAIEQFEHALRLRREAGDRDGEAFTLSKIGYALEVLGRSGERSRTGGPPWPSSRRPATPAGPRRCGGCWPGAARTGPPPRSQRGDQPFHPLVHGTERVLAQHGALCLVVQLQVHPVDREVPARGLCRGDEVTAQLGPGRLRRGVLGGLDLAVVGHPVHQVLALQQVEDAPATADVVVGQVQLGDARAGQLQPVLGLVALDQPVLDRPVDLPIDLGQVLGLHRVQGLAPQLDHPLRGRVRRALRDVLHRLGVVLALDVQRAGLPATGQPHQPAPGQVVADLADGPDRVVQAEVAELHALLDHLQHEVGAAHLEQGRHLGHVRVAHDHVQPAVALGVRVRLVPGVDDRPRPGGGAGHALPDVLGPLGQAVHGPARGLQHLARPADQLPGHQERQQHVGDAGELPRPRDQVVLVAAVGVARRVRVVLEQEDVAADALVGQPPLGVDEQVLQDPLTGLVVGDQLCEVVALRCRVLGVRADVEIQARTVAQEHVRRSSPRHDAPEQVPRHLVGGQPTLPVKGAGHPELGLDAEDPPLHLSTVGGCRPTDRAPFGEACGFSTTFP
>NZ_CP007155.1|WP_042222118.1|3356461_3357871_-|bifunctional-phosphatase-PAP2/diacylglycerol-kinase-family-protein
MQRSAALPRSRADTVLKVISAAANHSLLWGAVAAVLAARKGPTRRAALRGIAAIAGASFTANAVGKTLLPRRRPAAELVAEHRRLVKRPTSSSFPSGHAASAAAFTTAVALESPKAAAVVAPLAAAVAYSRVHTGVHWGSDVACGALVGVAAGLLTRRWWPVVDEQAPPTRRRVEVPAFEQGEGLLFVVNPNSGPGEGDFSEQVRENWPSATVVLLDQDTDLDALVGEHGPKALGVAGGDGTVAAMAALATEHDLPLVVLPAGTLNHFARDLGVDAVQTARAAVRAGDGAAVDLGAVTVGGSEPRLFLNTASLGGYPDLVRLRDKHADRWGKWPAGAYALIRVLHEARPLDVTINGERLRVWMLFVGNNVYLPRGFAPLTRARLDTGLLDVRYLRADLPLSRTRFILAAVLGALHRSHVYRQADLPRLRVTVHSAPVAIATDGEVGEQATRFEFTARRAALVTYLPQLS
>NZ_CP007155.1|WP_148309476.1|3355598_3356408_+|hypothetical-protein
MPSAVTGVSATDEWVFGRDDSGGSTRFPGYRWNGGRWTEQGSKDFEVLAAQSRSASDLWAAGSDRGDGYFHPQVGHWNGSSWSVTRTPVPAGYSGSLTAVHAVSATDVWAAGSINADVANAKSEPYLVHWDGTSWTRAALPGFTEDVRLTSVLVRANGEVWAGGYQSKYVPGKAIVLRGTAQGFGLVPVPDTGDTRLTGFAEDGGTLYAGIGGTGDTTNGLLSWTGSGWQTATGPTAPTRRVGVLTAVPGGGLWAGGADKSGKQFLALR
>NZ_CP007155.1|WP_148309475.1|3355326_3355578_+|hypothetical-protein
MRRLLAAAAAGMMLVLGTGAQAGAAEPGWQVHNPPTTMDGWYTDQITAFNHDSAIALGTEYWIIGNHRTYKRVWQWGVSSGPP
>NZ_CP007155.1|WP_025356547.1|3354276_3355014_+|proteasome-subunit-alpha
MTMPLYASAEQVMRDRSELARKGIAKGRSVVVLTYTGGVLFVAENPSSTLHKVSEIYDRIGFAAVGRYSEFESLRVAGVRHADLRGYQYDRRDVNARALANAFAGLLGSIFTEQLKPFEVEVCVAEVGTEYGQDQLYRLTYDGSIFDEPQYVVMGGQAEAISTALKNSYQEGAELADALRVAVSAFDAGSSAATNGAARPLEVAVLDRSRPRRAFRRIQGAALETLLASTAPAAEPAAEEPKPEQ
>NZ_CP007155.1|WP_030110080.1|3366312_3366657_+|DUF1049-domain-containing-protein
MIDHDSARQEPATTVEPETTPPPAPTVKVRRTRISGLWIGMILAAVVLLLLLVFILQNNQPVDIAFFGMSGQFPLGVALLLAAICGVLLVAVPGGARILQLRRTVRRAGARHAR
>NZ_CP007155.1|WP_025356560.1|3366918_3367953_-|hypothetical-protein
MRVSAVAVALLAVTGLGLSTGTAGADTGSLRLSEATTVGVHNTYDKGAYTYLADALDAGAGMIELDAWFNIFTRKWNVSHSNPLGSDNNCVQAKSPTANLHTGNRDQNLNDCLDDVNVWLAQHPGAGPLTVKLELKAGFDATIGMGPAHLDDYVRTSLGSRVFKPADLMGGKYATLDDAARANNWPSRSALAGKVIVEVIPGTVEEGNPTDHLWTDVEYARYLRDLAAAGHADQAQIFPAVHNSAAGDPRTRYSETNLRPWFVVFDGDASSYVDGGIDTSFYVNNHYYLVMTDAHNVKPAIDDTNPTEQQAKDRVALLAAKGASVVGTDWRKLTAVLPEVLPRT
>NZ_CP007155.1|WP_042221828.1|3368127_3368958_+|IS5-family-transposase
MAATHQPTRRANRYPSDVTDAQWAVLDPLLPDPAWLGGRGGRRERHCRRVIVDAILYLVDNGIKWRALPADFPPWPTVYKRFALWEKSGATQRILDGLRDRARLAEGRVAAPSAAVIDSQSVRAAETVGRATRGWDAGKKVNGRKRHIVVDTVGFVLAVLVTPASIQDRVAARALLLRLGATVGDRIRLVWADGGYTGTLLDWARQALGVVVEIVKRPDLPHFTVLPRRWVVERSLAWITGHRRCVRDYERLPHHHEAMVRWAMIRITSRRLTQTL
>NZ_CP007155.1|WP_025356561.1|3369113_3372350_+|methylmalonyl-CoA-mutase-family-protein
MSAALHRPVNPVRFVTAASLFDGHDAAINIMRRILQSQGAEVIHLGHNRSVNEVVNAAIQEDAQGVAISAYQGGHVEYFSYLVELLRERGAGHIQVFGGGGGVIVPQEIELLHSRGVARIFSPADGQHMGLAEMINTMVRACDTDLTEQVPASWDGLFTGAQDALARAITLIEAGRLPSAVSAGITEAADRRHVPVLGITGTGGSGKSSLTDELVRRFRQDQQDKLRIAVLAIDPTRRRGGGALLGDRIRMNCLDGEHVFFRSLATRRAGAEVPDGLAEAIAACKASGADLVVVETPGIGQGDAAIVPFVDISLYVMTPEFGAASQLEKIDMLDFADAVAINKFERRGAEDARRDVARQLVRNREAFGSTWQDMPVFGTSAATFNDDGVTALYQHLVSELAEKGLDLAEGVLPAVQGKVSTSAATIVPAARARYLSDIADTVRGYHRHTDEQVAAVRRHGQLAGAAKALEAAEKSTVDLDELVAGAARKVDRDTEDLLAQWPATVEQYSGDELVFKVRDKEIRTQLTRETLSGNKVRRVSLPRYEDEGTLLRFLRKENLPGAFPFTAGVFPFKREGEDPARMFAGEGDAFRTNKRFKYLSSGSAATRLSTAFDSVTLYGRDPDTPPDVYGKIGTSGVSIASLADMKALYDGFDLTSPTTSVSMTINGPAPTILAYFLNTAIDQRVDAFRAEHGREPSAEEHAELSAWALANVRGTVQADILKEDQGQNTCIFSTEFSLRMMADVQEWFIANKVRNFYSVSISGYHIAEAGANPISQLAFTLANGFTYVESYLARGMDIDDFAANLSFFFSNGMDAEYSVIGRVARRIWAVAMRERYGANERSQKFKYHVQTSGRSLHAQEMNFNDIRTTLQALCALYDNCNSLHTNAYDEAITTPTESSVRRAMAIQLIINKEWGLSANENPLQGSFVIEELTDLVEEAVLAEFDRLSERGGVLGAMETGYQRGRIQDESMLYEQRKHDGSLPLVGVNTFLPEHAEDEAFEIELARATEQEKASQVERTRQFQQEHREQAQQALARLRAAAATDENVFAVLMDAARVCTLGQITEAFFEVGGQYRRNI
>NZ_CP007155.1|WP_025356562.1|3372389_3373070_+|hypothetical-protein
MDAQLVRIVIGAALVLIGGAVMQGGVLRKLGWGPVSVVIHGNRPARTPRSAVAVGVLLTVIGMAVVVTGFLPAAMTTGSVPGTPEAAPPAASSPPRTSAVSPGGARSVRGRWEGSLGAVKLAVTQVDAANGLVTLHLEAVNNSPVTVMLIAPGNFTATDDRGTTYHAAAILTGWPYLVQSGQTAKGTIKLDMPLTAGATSLSVSFDSVIGSPVYGPLTVEDVGLPR
>NZ_CP007155.1|WP_035976621.1|3373132_3374158_+|amidohydrolase-family-protein
MVLPEREERSFWIDGELLRADPVPGGEFVVDGGWLLPGLVDVHTHPGRADLDQPFSEDVLRQHLVDHRDAGVLLVRTPGSDQRIPGWVDEDPELPRVRSAGRWLATPGRFIEGLGRHIGEDEVVRAAVEEAQAGSGWCKVIGDWRYDKPALPLEILTAAVEAVHAVGGRVAVHCQTAEGSRNAVLAGADSLEHGMHLDPELIDRMAAQGTALVPTLSVFGASVDRKRASEPGPRKDWWLSGWEGLLTNVRAAHEAGVTVLAGTDSFPCGTVAGEVNWLAQAGVPAEQALGAASWTARCWLGLPGLVDGGLADLLAYDTDPTEDLAVLAHPSRVVLKGRVLR
>NZ_CP007155.1|WP_042222121.1|3374255_3375242_+|MBL-fold-metallo-hydrolase
MEPGAFEVAPGVHRIPLPLPNDGLRAVNVYAVRDGDGLVLIDSGWALAEARQQLERALDQLGHGFEDVHRFLVTHLHRDHYTLGVTLRRTFGTRISLGAGEQPSMAAILAGRVEGQYRDLVRWGAGELVEPLRQARSGDREGVDGYEPPDDWIPGAVDVPLAERILRAVPTPGHTNGHLVFLDPEAELLFAGDHVLPHITPSIGFELARAGSPLSDYLESLRLVRSYPDMRLLPAHGPVTASAHARVDELLAHHERRLDLTCAAVGETASTALEVAGRIGWTRHNRKLADMDLFNKFLAVGETAAHLDVLVRLGRLRSSTVDGVVRYA
>NZ_CP007155.1|WP_025356565.1|3375243_3375753_-|Lrp/AsnC-family-transcriptional-regulator
MSFETHATPTAGGRSAAQLDEIDRAILSELHKDGRVSIRVLAERVHISRTNAYARLDRLLSEHVITGFTAEVSPHRAGLGTSAYVLLTIEQNSWRTVAGALRKIRYIEHLAMVGGDFDVLALVRAPDNAALREVVLEQIQSVKGVRGTRTWLVFDEAEGRGPEWVPAGK
>NZ_CP007155.1|WP_025356566.1|3375868_3376966_+|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha
MSDSVVQDLLPSPTPVRLLAEDGTTVEGCPTGYERPTVPQLLAAHRKMVIGRRFDAQATALTKQGRLAVYPSSHGQEACQIAAAEVLGPGDWLFPTYRDSVALVARGVDPVEVLTLLRGDWHCGYDPKAVRVAPQCTPLATQVLHATGLASAMRRKGENTAVLALIGDGATSEGDFHEALNFAAVFNAPVVFLVQNNGYAISVPLSKQSAAPSLAYKGIGYGVRSEQVDGNDTAAMLAVLGTAMDRARSGGGPFLVEAHTYRLEAHTNADDATRYRDQEEVRGWLAADPLPRLEKHLRDVGALTDEDVLAAQEEGERLAADLRQRMNADPHLDPMSLFDHVYAVPTPQLAEQRDLLATELKAQEG
>NZ_CP007155.1|WP_025356567.1|3376967_3377981_+|alpha-ketoacid-dehydrogenase-subunit-beta
MAATSMAQALNAALRDALSENERVLVFGEDVGQLGGVFRITDGLTAQFGEQRCFDTPLAEAGIVGYAVGLAMGGFLPVVEMQFDAFAYPAFEQIASHVAKIRNRTRGALSIPMVIRVPYAGGIGGVEHHCDSSEAYYVATPGLKVVTPATPADAYTLLRAAIDDPDPVVFMEPKKLYWSKEDTELRYDSEPLGRAAIRRSGKDATLIAYGPSVPVAMQAAKVAAEDGLDLEVVDLRSLVPFDDETVTASVRRTGRCVVVQEAQGFAGFGAEVAARVQERCFHSLSAPVIRVGGFDIPYPPPMLEHSHLPGVDRVLDAVDRLQFSDEPDGRYLTGVRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_7

3629719-3629812

Orphan

Consensus_repeat	Method
GCGCATCAGTGCCAGCTCCACCTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_7

>merge|NZ_CP007155|7|3629719-3629812|CRISPRCasFinder
GCGCATCAGTGCCAGCTCCACCTGGTCCTGGATCTGCTCGATGTGCAGCGGGCGCTCGGGCCCGGCGTGGCGCATCAGTGCCAGCTCGACCTGG

>NZ_CP007155|7|6|3629719-3629812|CRISPRCasFinder
GCGCATCAGTGCCAGCTCCACCTGG	TCCTGGATCTGCTCGATGTGCAGCGGGCGCTCGGGCCCGGCGTG
GCGCATCAGTGCCAGCTCGACCTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025356782.1\|3636206_3637307_+\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|223635
NZ_CP007155.1\|WP_025356779.1\|3633368_3634409_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|235533
NZ_CP007155.1\|WP_025356771.1\|3613774_3617632_-\|non-ribosomal-peptide-synthetase	unknown	unknown	gnl\|CDD\|274093
NZ_CP007155.1\|WP_030108172.1\|3626134_3627184_-\|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|235968
NZ_CP007155.1\|WP_025356773.1\|3618753_3621189_+\|glycoside-hydrolase-family-3-protein	unknown	unknown	gnl\|CDD\|224389
NZ_CP007155.1\|WP_158510752.1\|3639327_3640521_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380454
NZ_CP007155.1\|WP_042222167.1\|3634435_3635260_+\|3-hydroxyisobutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|130753
NZ_CP007155.1\|WP_025356768.1\|3610362_3611757_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173803
NZ_CP007155.1\|WP_025356781.1\|3635256_3636033_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|180295
NZ_CP007155.1\|WP_025356783.1\|3637336_3637759_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025356774.1\|3621217_3621574_+\|cold-shock-domain-containing-protein	unknown	unknown	gnl\|CDD\|239905
NZ_CP007155.1\|WP_030109507.1\|3637917_3639177_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP007155.1\|WP_025356778.1\|3632229_3633369_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173851
NZ_CP007155.1\|WP_025356769.1\|3611926_3612538_+\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|379056
NZ_CP007155.1\|WP_025356767.1\|3609629_3610271_-\|DsbA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|239322
NZ_CP007155.1\|WP_025356777.1\|3630727_3632224_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143404
NZ_CP007155.1\|WP_052360461.1\|3621729_3626085_+\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238121
NZ_CP007155.1\|WP_042222162.1\|3612449_3613727_-\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341066
NZ_CP007155.1\|WP_025356772.1\|3617770_3618559_-\|PaaX-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225864
NZ_CP007155.1\|WP_025356786.1\|3640513_3641089_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025356782.1\|3636206_3637307_+\|HAD-family-phosphatase	gnl\|CDD\|223635	COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only].	8.66857e-24
NZ_CP007155.1\|WP_025356779.1\|3633368_3634409_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|235533	PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional.	3.04732e-174
NZ_CP007155.1\|WP_025356771.1\|3613774_3617632_-\|non-ribosomal-peptide-synthetase	gnl\|CDD\|274093	TIGR02353, NON-RIBOSOMAL_PEPTIDE_SYNTHETASE, non-ribosomal peptide synthetase terminal domain of unknown function. This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide. This domain is roughly 700 amino acids in size and is found in polypeptides roughly twice that size.	0
NZ_CP007155.1\|WP_030108172.1\|3626134_3627184_-\|ribonucleotide-diphosphate-reductase-subunit-beta	gnl\|CDD\|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NZ_CP007155.1\|WP_025356773.1\|3618753_3621189_+\|glycoside-hydrolase-family-3-protein	gnl\|CDD\|224389	COG1472, BglX, Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism].	2.24426e-64
NZ_CP007155.1\|WP_158510752.1\|3639327_3640521_+\|hypothetical-protein	gnl\|CDD\|380454	cd19531, LCL_NRPS-like, LCL-type Condensation (C) domain of non-ribosomal peptide synthetases(NRPSs) and similar domains including the C-domain of SgcC5, a free-standing NRPS with both ester- and amide- bond forming activity. LCL-type Condensation (C) domains catalyze peptide bond formation between two L-amino acids, ((L)C(L)). C-domains of NRPSs catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). In addition to the LCL-type, there are various subtypes of C-domains such as the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. Streptomyces globisporus SgcC5 is a free-standing NRPS condensation enzyme (rather than a modular NRPS), which catalyzes the condensation between the SgcC2-tethered (S)-3-chloro-5-hydroxy-beta-tyrosine and (R)-1phenyl-1,2-ethanediol, forming an ester bond, during the synthesis of the chromoprotein enediyne antitumor antibiotic C-1027. It has some acceptor substrate promiscuity as it has been shown to also catalyze the formation of an amide bond between SgcC2-tethered (S)-3-chloro-5-hydroxy-beta-tyrosine and a mimic of the enediyne core acceptor substrate having an amine at its C-2 position. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity. An HHxx[SAG]DGxSx(6)[ED] motif is characteristic of LCL-type C-domains.	5.30648e-43
NZ_CP007155.1\|WP_042222167.1\|3634435_3635260_+\|3-hydroxyisobutyrate-dehydrogenase	gnl\|CDD\|130753	TIGR01692, 3-hydroxyisobutyrate_dehydrogenase_mitochondrial, 3-hydroxyisobutyrate dehydrogenase. 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446). [Energy metabolism, Amino acids and amines].	1.11377e-112
NZ_CP007155.1\|WP_025356768.1\|3610362_3611757_+\|S8-family-serine-peptidase	gnl\|CDD\|173803	cd07477, Peptidases_S8_Subtilisin_subset, Peptidase S8 family domain in Subtilisin proteins. This group is composed of many different subtilisins: Pro-TK-subtilisin, subtilisin Carlsberg, serine protease Pb92 subtilisin, and BPN subtilisins just to name a few. Pro-TK-subtilisin is a serine protease from the hyperthermophilic archaeon Thermococcus kodakaraensis and consists of a signal peptide, a propeptide, and a mature domain. TK-subtilisin is matured from pro-TK-subtilisin upon autoprocessing and degradation of the propeptide. Unlike other subtilisins though, the folding of the unprocessed form of pro-TK-subtilisin is induced by Ca2+ binding which is almost completed prior to autoprocessing. Ca2+ is required for activity unlike the bacterial subtilisins. The propeptide is not required for folding of the mature domain unlike the bacterial subtilases because of the stability produced from Ca2+ binding. Subtilisin Carlsberg is extremely similar in structure to subtilisin BPN'/Novo thought it has a 30% difference in amino acid sequence. The substrate binding regions are also similar and 2 possible Ca2+ binding sites have been identified recently. Subtilisin Carlsberg possesses the highest commercial importance as a proteolytic additive for detergents. Serine protease Pb92, the serine protease from the alkalophilic Bacillus strain PB92, also contains two calcium ions and the overall folding of the polypeptide chain closely resembles that of the subtilisins. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	6.13783e-55
NZ_CP007155.1\|WP_025356781.1\|3635256_3636033_+\|enoyl-CoA-hydratase	gnl\|CDD\|180295	PRK05862, PRK05862, enoyl-CoA hydratase; Provisional.	1.25465e-156
NZ_CP007155.1\|WP_025356774.1\|3621217_3621574_+\|cold-shock-domain-containing-protein	gnl\|CDD\|239905	cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea. CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA. CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.	2.00549e-20
NZ_CP007155.1\|WP_030109507.1\|3637917_3639177_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	4.94103e-15
NZ_CP007155.1\|WP_025356778.1\|3632229_3633369_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173851	cd01162, IBD, Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA dehydrogenase (IBD) catalyzes the alpha, beta- dehydrogenation of short branched chain acyl-CoA intermediates in valine catabolism. It is predicted to be a homotetramer.	0
NZ_CP007155.1\|WP_025356769.1\|3611926_3612538_+\|GAF-domain-containing-protein	gnl\|CDD\|379056	pfam13185, GAF_2, GAF domain.	1.20469e-06
NZ_CP007155.1\|WP_025356767.1\|3609629_3610271_-\|DsbA-family-oxidoreductase	gnl\|CDD\|239322	cd03024, DsbA_FrnE, DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	1.21935e-84
NZ_CP007155.1\|WP_025356777.1\|3630727_3632224_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	gnl\|CDD\|143404	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD.	0
NZ_CP007155.1\|WP_052360461.1\|3621729_3626085_+\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	7.00206e-81
NZ_CP007155.1\|WP_042222162.1\|3612449_3613727_-\|M1-family-metallopeptidase	gnl\|CDD\|341066	cd09603, M1_APN_like, Peptidase M1 family similar to aminopeptidase N catalytic domain. This family contains mostly bacterial and some archaeal M1 peptidases with smilarity to the catalytic domain of aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease belonging to the M1 gluzincin family. APN preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and, in higher eukaryotes, is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation, thus considered a marker of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. APNs are also present in many pathogenic bacteria and represent potential drug targets. Some APNs have been used commercially, such as one from Lactococcus lactis used in the food industry. APN also serves as a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs have also been extensively studied as putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	1.38139e-168
NZ_CP007155.1\|WP_025356772.1\|3617770_3618559_-\|PaaX-family-transcriptional-regulator	gnl\|CDD\|225864	COG3327, PaaX, Phenylacetic acid-responsive transcriptional repressor [Transcription].	2.79501e-41
NZ_CP007155.1\|WP_025356786.1\|3640513_3641089_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.33852e-11

>NZ_CP007155.1|WP_030108172.1|3626134_3627184_-|ribonucleotide-diphosphate-reductase-subunit-beta
MTGLGSIDRSGGRVSVDEKAMINCRADVNQLLPLKYHWAWDKYLAGCNNHWMPTEVSMQADIALWKSAEGLTADERLMIKRNLGFFATSESLVANNIVLAVYRHLTNPECRQYLLRQAFEEAVHTHTFQYICESLGLDEGELFNMYREVPSITDKAAWALDYTQHLEDPEFRTGTPENDQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDTINQIKIENPHLWSERFQQEVRTMLAEACELEVAYGRDTMPRGVLGINAELCEQYMHFITNRRCAQLGLEPVFGPAENPFPWMSEAMDLKKEKNFFETRVIEYQSGSSLDWD
>NZ_CP007155.1|WP_052360461.1|3621729_3626085_+|winged-helix-turn-helix-domain-containing-protein
MLHVNLLGVVRATMDGRELELGPPKQRAVFVQLAIRRNQVVSRTELIDGVWGEQPPGSVRGIIHTYVSMLRQSLAGEQRTSAKNSVLASVGSGYRLELEPHNHDVWQFEDAFQQAARLRAENDVVAAIAQWDKGLSLWQGEPLAGIPGPFAETERKHLEELRLSAVEDRADALLSLDRESDVVADLAAAVAERPLRERMRALLMVALFRGGRQAEALEHYDRLRRMLAEELGVSPSAEVQQVYQRILDSDPGLGGPAARPVTRHAPAAAPDPEPQGPARPRTTRSPYPGLMAFSVGNAQYFFGRQQLTATLVDRLGADGPIAVVGASGSGKSSLLRAGLVPTIEGMDLATPRRWSWLLLTPGNKPVEALASALAQATGRPVTEVLHLVKEESSELRDLLADGDNARTERLVVVIDQFEELFTQCEHESERRTFVRALSALSAPPAAPASVVLAVRADFYGHCARYPELVASLERSLVVGPMTAVELREAIERPAELAGLELEPGLSELLLRDLGAEEDAGGILPLLAHTLLATWQVREGNRLTLHGYAGVGGIHRAIATTADATYERFDPFGRDLVRRMLLRMVHVGEGVEVTRWRVDRTSLIESSGDPETAAAVLDALARARLVTLDENTAEISHEALLRSWPRLRQWIADDREGLRLHQQLAQDAQSWQREGRDDSALYRGARLVIARNWADNLADEGALAPVERELLDASSRREEAEQQTAVRRTRRLRQLVAALTVLLLVAVSATVFALVERSTALDERANATSRQVALRANSLRGADPALAAQLSLAAYRISPTTEARSSLLTTSGAPEATRLLGHTDAVAALAYSGTLIASASKDKTVRLWDGKSRTALSTVRTPTAAYGVALSADGRRLAAGVAGGSVLLWDVSDPHSPVALATGSGHADTVVAVAFSPDGKLLASASADKTVRLWRVDGSHIQLAATLTGHAKAVTSVAFSPDGKLVASGAYDNTVRLWNAADGSPVATLTDHTNAVTAVAFSPDGTTLASASYDLTVRLWNTADRTLKAKLTEATSFLEAVAFSPDGRTVAATGDDHETRLWDVAAQLQVASFTAPATVRAVVFSPDGTRIVTGAANWAVTVWDVRAAEVNGHAQSGWAIGYDKTGKVLASGHYDGKVRLWDMTDPLRPAALATLDGHTNAVTSVVFSPDGKTLASASYDHNVRLWDIADPAHARQLATIPASSGQLESVAFSPDGRMVASAGDDHQIRLWDVSDPTAVRPLGQPLTQHGDVVSSVVFSGNGAALASGSYDGSARIWDVSDPLHPVAGARIATSQAAPIRGIAFTPDAHLLATAGDDHAVELWDVSDPAHPSVLSTLKDHTNTVTSVALSADGKRLASASWDRTVSTWDISDPRVPVQTATFSGPTDNVTAVAFNPVDGSVAAGVANAPNSVWQNDVEAVAKQVCETRGTPISNEEWANYVGDGSPVDPCSS
>NZ_CP007155.1|WP_025356774.1|3621217_3621574_+|cold-shock-domain-containing-protein
MATGRILRFDDDRGFGFIAPDAGSEDVFVHANDLLDEKSAFKPGTAVEFEIEEGNRGLKAVDVRAVGGRRPSGSGGGSGFSVELTETLLERMPELTGGQVLRIRQLVADVARDQGVSL
>NZ_CP007155.1|WP_025356773.1|3618753_3621189_+|glycoside-hydrolase-family-3-protein
MQQHATIAELVGKLDLDTKAGLLAGQDIWTLPAVPEIGLRSVVMSDGPVGVRGVRWTPEDPSVVLPSPTALAATWDPELARRAGRLLAQEARRKGVHVLLAPTVNLHRTPLGGRHFECYSEDPLLTGLIGAGYVRGVQEGGVATTVKHFVANDSETERYTVDVRAEERTLRELYLRPFEIIVREARPWGVMAAYNGVNGSTMTEHARLQNEVLRAEWGFDGVIVSDWTAARDTVRAALGGMDLAMPGPHTVYGPALAQAVREGAVPEQVVDTMVARVLLLAARVGALDGVPSGFTAPEELDGNEVAREVAARSAVLVRNDNALLPLRAEDLRTVAVIGAAADEARILGGGSATVFPGEVVSPLAGLRAVLPGAEVRYCVGADPRTTLPPARDGFELTLVARDGAGAELASYAVPEAGLTWIGEVPEAVDAERVRAVEFTGTFTPEVGGSHEFGFRGLGEAVLTVNGRVLFDGVSLPEGDDPFTAAMDLSERRFRTDLVAGETVRVSLLLHPLTLAEGGAGPFVFVVTALGHAAPGPGPDAQIEQAVAVARESDVAVVVVSTTEEVESEGFDRTDLALPGRQDELVRRVAAANPRTVVVVNAGSPVEMPWLEQTGAVLLSWFPGQAAGTALAEVLLGAREPGGRLPTTWPARLADAPVVRVKPEQGVLHYEEGVFIGYRAWQRAGTAPAHWFGHGLGYTEWTYESARFDPASRTLEVELRNSGPRAGREVVQVYCAPGEPDPNRPARWLVGFAQVHAEPGESVLARVTVPGDATRVWDSGVGGWRQDTGPHLLEVGRSAGDLRLSVGTVNGL
>NZ_CP007155.1|WP_025356772.1|3617770_3618559_-|PaaX-family-transcriptional-regulator
MTLLGEYVLHHDRPMWTSVFVDALARLDIEEKSARQALSRTAAAGWLESEQVGRRARWSLSAAAREMLESGTRRIYGFGTDPTEWDGRWLVLLVSVPESRRDLRNQVRTRLAWAGLGSPEPGVWIAPDTAREPEVRRILAELGLTGSARSFTARYGGIGQQEQLVADAWDLRALAEGYAEFTGEFSAPVTDSGDAVWKAQTRLVHRWRAFPALDPCLPARLLPAGWPGAAALWLFQRRHEQWHEGAQRRWREILASHEEPGT
>NZ_CP007155.1|WP_025356771.1|3613774_3617632_-|non-ribosomal-peptide-synthetase
MTAVHPPHELVETWSGPKALFRAGATTAPRTLLDVLAQTARLHPAAPAVHDGTTTLTYRALAAEVDQLRARLAAEGIGVGDRVGVRVPSGTVDLYVCILAVLAAGAAYVPVDAEDPEERAELVFSEADVCAVLGEHRALTRRGTPMGAVGSPGLDDDAWIIFTSGSTGKPKGVAVSHRSAAAFVDAEARLFLTEEPIGPGDRVLAGLSVAFDASCEEMWLAWRHGACLVPAPRSLVRTGVDLGPWLVDNEITVVSTVPTLASLWPAEALEEVRLLIFGGEACPPELAERVAVEGREVWNTYGPTEATVVACAAQLTDQGPVRIGLPLDGWELAVVDQQGELVPMGESGELVIGGVGLARYLDRAKDAEKFAPLPAMGWDRAYRSGDLVRAEPEGLLFLGRADEQVKLGGRRIELGEVDAALQALPEVIGAAAAVRNGTILVGYVVATPEFDQAAALERLRAALPAALVPLLAVVDTLPTRTSGKVDRNALPWPLPTSADAPALAGTQGWLAEQWGAVLGVAPVEAEADFFASGGGSLAAARLVGLIRQRYASASVSDIYQNPTVRAMAARLDEFDSAAASKRIVTPTPRSAGLVQTLLLLPLFTLVGLRWTVALAAAGNLLSLLDGFTWLPTVSWWWVLAGWLALVHPAGRTLIAAGGARLLLRGVKPGSYPRGGGVHLRLWFTEKLAEFTGASELTGAWLTRYARALGVKVAEEVDLHSLPPVTGMLKLGKGCAIEPEVDLSGHWLDGDLLHIGKIRVGAGATVGARSTLFPGARIGKRAEIAPGSGVTGSVPAGQRWAGVPASRDGKATRRWPASRPARFRRWQWAYGLTTGALSLVPVLATVPALAVVGLFLRGATSVSSALGGALLAAPLATLAWLAAYALVVLCAVRLLSIGLREGYHPVHSRIAWQAWTTERLMDLARVALFPFYASLFTPVWLRALGMKVGRRVEASTVLALPSMTTVGDGAFLADDTLVGSYELGGGWLRIGEARIGKRAFLGNSGMTAPGRSVPNRGLVGVLSATPKRAKAGSSYLGMPPMKLPRAVEEGDQSRTFKPPRRLVIARALVELCRVLPVMAKFALAVLTVAAVETVASRYGFTVAGLAAGLLLVAGGVLACLLAIAAKWLLVGRFRAVEHPLWSSFVWRNELADTFVEVLAVPLLAGRVGGTPVMSLWLRGLGARIGRGAWVETYWLPEADLVDIGAGAVVNRGCVVQTHLFHDRIMRMDEVRLEDGATLGPHGIVLPGAGIGAGATVGPASLVMRGEHVPSDTRWLGNPISAWRTKR
>NZ_CP007155.1|WP_042222162.1|3612449_3613727_-|M1-family-metallopeptidase
MDSYLPEHGNGGYQVRHYDLDLDYRLGPGRLSGRARITAAAGPSLSAFSLDLEDSFKVGRVTVSGKAARYTHRGGKLRVRPAKPVPAGADFVVDLRYVGTPVPVRSAHWGEIGWDQLTDGVIVASQPIGAPSWFPCNNTPADKAAYRISVTTATPYTVVANGVLVSQRTNASTTTWVYESTAPMAAYLATVQIGQYELVDLGPAQRAAVPGRLLPVFGHDFGRQPEMMSAFEALFGQYPFEEYTVVVVDDELDVPIEAQGLSVFGTNHVDGYRGAEHLVAHELAHQWFGNSLTVADWRHIWLNEGFATYAEWLWSECSGGVPAAGLAARSRSELARQRQDLRVSDPGARRMFDDRVYQRGALTLQALRVEVGDDAFFALLREWTLVNRHCTVTTEQFTTLAQRHTDRPLAPLFRRWLHETPMPLA
>NZ_CP007155.1|WP_025356769.1|3611926_3612538_+|GAF-domain-containing-protein
MAANADDVIDQAICQLGEAKTLEDVQEIVRCAARRAVNAHGATMVLLEGDQCYYLDEDSMSPLWKGMRFPAANCISGWAMLNGETVVIPDIRVDSRIPQKAYRPTFVRSLVMTPIRRESPIGAIGAYWALCHCATDVEVGALEALGAAAGEVMVHRGLPSTAPPYAPLVNACVRPTPAASGSRAASAGTGAPADGRCGVGRGW
>NZ_CP007155.1|WP_025356768.1|3610362_3611757_+|S8-family-serine-peptidase
MTRTLTVLSAIGLLLAAPVAQAEPAPTSEPAAAADPGQLVLPHVVVTGADRLSTWRAERVIRGAGGTVVSAYPQVGVLVAYSAREDFAAKVRATPGIAAVGATRTAKIAAGWFAPRRDLEYTGPAAPSTPPPAEGTAWDVPALGLAKAHEVTTGSRRVIVGVLDTGVDDTHPDLAEAVDTRNSVSCLSGWADRGRGAWRPTLDGHGTHVAGTIAAAENGFGVVGIAPDVRVAAVKMAELDDTETPESMVCGFVWAAEHGFRVVNNSYRLNPWRYSCPDQVDQAAIRLAVGRAVSYAQRNEVLVVASAGNAGIDLTNRKTDDESPYDSSPVHREISNECIRLPHELPGVIGTGAVDEKLAKASFSNYGIGPVALAAPGVRTWSTWPGNGYRPASGTSMSAPHTVGVAALIASEHPRWSAERIKAQLFRTATPAACPTGSPCVTRDGQTSYFGHGLVNAAAAVAED
>NZ_CP007155.1|WP_025356767.1|3609629_3610271_-|DsbA-family-oxidoreductase
MRVDIWSDLVCPWCYVGKRRFERALAEFEHREQVEVVHHSFQLDPGFPAGQSKPQVEVLSAKYGMSPAEAEAVEANMERTAAEDGLDYNLTGIRTGNTVDAHQLVHLGAREGLADKVIERLYRAHFTEQRSLFDHDSLVALAEEAGLDSREARRVLTEGTYAQAVAEDGRQAQQLGATAVPFFVIDERYGVSGAQPAELFGKALTQAWQETRG
>NZ_CP007155.1|WP_025356777.1|3630727_3632224_+|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase
MRELTHFVGGKHIPGSSGAFGDVWDPNTGQVQARVPLADRAETEAAIADAERAQQEWAAWNPQRRARVLLRFLDLVQREMDPLARLLASEHGKTVPDARGDIQRGLEVVEFAAGIPHLLKGEFTDGAGTGIDVHSLRQPLGVVAGITPFNFPAMIPLWKAAPAIACGNAFVLKPSERDPSVPLRLAELFLEAGLPPGVFNVVNGGKEAVDTLLTDSRVRAVGFVGSSEIAQYIYSTAAAHGKRAQCFGGAKNHMIIMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGEQTAEALLDKLIPRVRALKIGTSQDETADYGPLVTRQAVDRVREYIQSGVDEGAALVVDGRDFVLPGHEKGFFLGGSLFDNVGTDMRIYREEIFGPVLSIVRAGDYEQALRLPTEHEYGNGVAIFTRDGDTARDFTRRVDTGMIGVNVPIPVPVAYHTFGGWKRSGFGDLNQHGPDSIRFYTKTKTVTTRWPAGTRQGASFVIPTMA
>NZ_CP007155.1|WP_025356778.1|3632229_3633369_+|acyl-CoA-dehydrogenase-family-protein
MFTLSEDQRAIAATAAEFAQEHLAPNAVQWDQDKHFPVDVLRKAAELGMGGVYVREDLGGSGLSRMDAALIFEALATGCPSIAGYLSIHNMVAWMVDTFGNDAQRARWVPNLCSMQSLGSYCLTEPEAGSDAAALRTRAVRDGDHYVVDGVKQFISGAGTSEVYVVMVRTSGNGARGVSALVVEKGSPGLSFGPNEKKMGWNAQPTRQVIFDGVRVPVANRLGAEGDGFKIAMRGLNGGRLNIGACSLGGGQAALRQAIAYLETRKAFGTNLIRSQALRFQLADMDTELEAARTLLWRAATALDSGDPRAVELCAMAKRFATDTGFAVANRALQLHGGYGYLAEYGIEKLVRDLRVHQILEGTNEIMRVIVSRGLTGAA
>NZ_CP007155.1|WP_025356779.1|3633368_3634409_+|enoyl-CoA-hydratase/isomerase-family-protein
MDTEDVLLRRDSGLGRIVLNRPKAINALTHAMVQQIDVALGEWAAEDEVRAVLITGVGERGLCAGGDIRSIHADSVSGNRASLAFWRDEYLLNHHIANYAKPYVAIMDGIVMGGGVGVSAHGSVRVVTERTKLAMPEVGIGFVPDVGGTYLLSRAPGELGTHLGLTASVATGADAIHCGLADHFVPSGRLPAFLESLALKGPEQAVAEHAVDAPASELAEQREWIDACYSADTVEEILSRLHELGEPAAKEAAESISGKSPTALKVTLRSLRQARALPGLGAVLDQEYRVSTACLDSADLVEGIRAQVVDKDRDPKWAPSTLEQVTDVDRYFAVLGAAELGLGEQR
>NZ_CP007155.1|WP_042222167.1|3634435_3635260_+|3-hydroxyisobutyrate-dehydrogenase
MGGPMAANLAAAGHEVTGYDVLPGLGTATDPVQAVRDAEVVITMLPSGRHVLDCYESVLAHAKPGTLFVDCSTIDVTDARAAHQAAVRAGHRAADAPVSGGVVGATAATLTFMVGAREEDFALAEPVLSAMGRKVVHCGQPGAGQAAKICNNMILGVSMIAVSEAFVLAEKLGLSEQALYEVASTASGQCWALTTNCPVPGPVPTSPANNEYRPGFATALMLKDLGLAASAARSAGVDAELGSLAEQVYRRFAEQGGGGQDFSAIVTAIRERSA
>NZ_CP007155.1|WP_025356781.1|3635256_3636033_+|enoyl-CoA-hydratase
MTEYTTIRTEQVDRVGVITLHRPEALNALNTQLMTEVLDAVTGYERDPGIGAILITGSEKAFAAGADIKEMQPQTYADTFAGDLFAAWDQLAQARKPTIAAVAGYALGGGCELAMLCDVLLAADTAKFGQPEIKLGVIPGIGGSQRLTRAVGKAKAMEMVLTGRMIGAEEAERAGLVSRVVPAAELLTEAHKVAATIAGMSLPIAMMAKESVNRSFETTLAEGIRFERRIFHATFATADQKEGMAAFIDKRPPEFNHS
>NZ_CP007155.1|WP_025356782.1|3636206_3637307_+|HAD-family-phosphatase
MDTVDTAAAVVLRGGLLLAVRRHGASEFGVPLARDLASETGLLLRSWRPMHGLGACLAVADGVAAPTGAVAEVAWIDDACEQDGIALGEQLGALVPELRARGLLRRRAELTGRQSGQRVVLAVDLDGTTVFDGDRPGPRVTAVLTELVEREDVRVVVATSRAPRGVRTLLGPLAERVDLLCCNGSLHAHEDRLTRFAQLPPQRLHRVVGELTAEGTPFYLEYGDRFAVSGAGFAWMDYPDRCALPAEPELAGVVKLVVDAPEPPWGAARLRELAGPGTELCPHTDGVIEVTPVGVSKATGLAALLGGPADPLVVFGNDLNDQDLLGHADMAVVVGDGLPGVERAGHVRRVAAQDGAVAMALRQAVG
>NZ_CP007155.1|WP_025356783.1|3637336_3637759_-|hypothetical-protein
MNKSARTALVLGAAALVLGGAFVSTSAAAGPAAPKAPAAVTSSWAKVSANGALLAGQGITGINKFGRGRYNLTTSGDISNCALNGTLNTNGGSDPGPGSSSILVGAVSGNTLFVRTATPSSTSPYTVDDDRPFSLSITCY
>NZ_CP007155.1|WP_030109507.1|3637917_3639177_+|alpha/beta-fold-hydrolase
MYRRPGLVCRDHLLTVPLDHSAPTGAQIQVFAREVVSSQREHDDLPWLLYLQGGPGNKANRPVPTSPWLRRALTEYRVLLLDQRGTGRSTPATRQTLAGMSPVEQAGYLGHFRADSIVRDAELLRRHLLGEDGRWTVLGQSFGGFCATTYLSLAPEALDGVVLTGGLPPLHADAEQVYRALYPRVLAKNKLYFRRYPGDEELADRVVRHLRRNEVVLPDGARLSVERFLSLGIDFGAAARFDGLHYLLEEAFLGEELSETFVQAVVAATSFATRPLYAVLHEATYCQGGASRWAADRVRAEFAEFDAEAGQVRFTGEMIYPWMFEQDPALVPLRAAADLLAERADWPHLYDPDRLARNEVPVVAALYHEDMYVDRDFSLETAEAIRGTRTWVTNEYEHDGLAANGAVLDRLLSLLHGHA
>NZ_CP007155.1|WP_158510752.1|3639327_3640521_+|hypothetical-protein
MVVLSGQRQILLDETVTADSRQHVLAAELVVTGSLHVEHVVAAARRLVWRHSALRARYWFAQVDFEQEVVDSATPEISFQFAVNLTGVRQVRERELARPFDFLRPIVPRFVVTSIGDTQHHVLIVVHQVCCDHWALNLLVAEFVELYSALVGGRSAEVDHRPPQFHHYLDRTAEVDRQLVYWKQRLCDAPPLLAEVRERQRPAAAPIPVRLPDQAVRQGASRAGVTSLDVLVTAWARSLGETARAREVCVAVPVPGRTAPGSERTVGPFVNTVVLRLGSRFSSADTHEVMCHAWQHQDVPFDEVLRHLGGARQSPAQAMIALRPQARRTYELPSGAVAQVRTDVQPRRLGRFGLLLDLVPADGGYTGWLSYGQDLVRRSEALEALHRFYRWVRAELS
>NZ_CP007155.1|WP_025356786.1|3640513_3641089_-|TetR/AcrR-family-transcriptional-regulator
MTSSTRRRLSPEQRRSELLGIGARLFAQRPYEEVWIEEVAELAGVSRGLLYHYFATKRDFFAAIVREESEQLYALSDPDPALPNEQRLAAALDVYLDYVQQHEHGFRAVHRGAASADEGIRAIVREGQSRQAERIMAALAPGELGAEVLRLAVRGWFSFLTTVCLDWLDNPEISREQLRDLCARTLLSAVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_8

4180952-4181060

Orphan

Consensus_repeat	Method
CGTCGTGAAGGGCACCTTCGTGACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_8

>merge|NZ_CP007155|8|4180952-4181060|CRISPRCasFinder
CGTCGTGAAGGGCACCTTCGTGACGCGAGGGGTGCGGGCCTGGGTTGGCGGCCGAGTCATGAAGGTGCCCTTTGGGGCATTGGGCGTCGTGAAGGGCACCTTCATGACG

>NZ_CP007155|8|7|4180952-4181060|CRISPRCasFinder
CGTCGTGAAGGGCACCTTCGTGACG	CGAGGGGTGCGGGCCTGGGTTGGCGGCCGAGTCATGAAGGTGCCCTTTGGGGCATTGGG
CGTCGTGAAGGGCACCTTCATGACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025357224.1\|4177047_4178676_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP007155.1\|WP_025357223.1\|4175827_4176826_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_051913344.1\|4179163_4180789_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223839
NZ_CP007155.1\|WP_025357230.1\|4183784_4185293_-\|carboxylesterase-family-protein	unknown	unknown	gnl\|CDD\|365897
NZ_CP007155.1\|WP_025357219.1\|4170948_4171725_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235975
NZ_CP007155.1\|WP_025357222.1\|4174725_4175718_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_030109208.1\|4188178_4188877_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP007155.1\|WP_025357231.1\|4185298_4186336_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226855
NZ_CP007155.1\|WP_042220524.1\|4182646_4183792_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340951
NZ_CP007155.1\|WP_025357233.1\|4186939_4188091_-\|glycoside-hydrolase-family-88-protein	unknown	unknown	gnl\|CDD\|369381
NZ_CP007155.1\|WP_025357221.1\|4172662_4173964_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP007155.1\|WP_025357228.1\|4181898_4182654_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP007155.1\|WP_042220521.1\|4171721_4172585_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131459
NZ_CP007155.1\|WP_148309522.1\|4170020_4170821_-\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|188352
NZ_CP007155.1\|WP_025357227.1\|4181089_4181806_-\|SIS-domain-containing-protein	unknown	unknown	gnl\|CDD\|179510
NZ_CP007155.1\|WP_025357236.1\|4189534_4190218_-\|DUF4166-domain-containing-protein	unknown	unknown	gnl\|CDD\|379359
NZ_CP007155.1\|WP_030111189.1\|4174011_4174713_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP007155.1\|WP_025357235.1\|4188891_4189527_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP007155.1\|WP_025357225.1\|4178876_4179086_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025357232.1\|4186362_4186929_-\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|133025

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025357224.1\|4177047_4178676_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	1.43863e-174
NZ_CP007155.1\|WP_025357235.1\|4188891_4189527_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.12007e-05
NZ_CP007155.1\|WP_042220524.1\|4182646_4183792_+\|MFS-transporter	gnl\|CDD\|340951	cd17393, MFS_MosC_like, Membrane protein MosC and similar proteins of the Major Facilitator Superfamily of transporters. The gene encoding Sinorhizobium meliloti membrane protein MosC is part of the mos locus, which encodes the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine. MosC belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.25717e-79
NZ_CP007155.1\|WP_025357232.1\|4186362_4186929_-\|nucleotidyltransferase-family-protein	gnl\|CDD\|133025	cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	6.57355e-49
NZ_CP007155.1\|WP_025357230.1\|4183784_4185293_-\|carboxylesterase-family-protein	gnl\|CDD\|365897	pfam00135, COesterase, Carboxylesterase family.	8.13942e-119
NZ_CP007155.1\|WP_042220521.1\|4171721_4172585_-\|hypothetical-protein	gnl\|CDD\|131459	TIGR02406, L-24-diaminobutyric_acid_acetyltransferase, diaminobutyrate acetyltransferase. This enzyme family is the EctA of ectoine biosynthesis. Ectoine is a compatible solute, analagous to trehalose, betaines, etc., found often in halotolerant organisms. EctA is L-2,4-diaminobutyric acid acetyltransferase, also called DABA acetyltransferase. [Cellular processes, Adaptations to atypical conditions].	0.000145012
NZ_CP007155.1\|WP_030109208.1\|4188178_4188877_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	7.75136e-46
NZ_CP007155.1\|WP_025357231.1\|4185298_4186336_-\|oxidoreductase	gnl\|CDD\|226855	COG4447, COG4447, Uncharacterized protein related to plant photosystem II stability/assembly factor [General function prediction only].	6.2621e-25
NZ_CP007155.1\|WP_025357233.1\|4186939_4188091_-\|glycoside-hydrolase-family-88-protein	gnl\|CDD\|369381	pfam07470, Glyco_hydro_88, Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.	1.22363e-96
NZ_CP007155.1\|WP_025357221.1\|4172662_4173964_-\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	7.29446e-80
NZ_CP007155.1\|WP_025357228.1\|4181898_4182654_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	6.29413e-82
NZ_CP007155.1\|WP_025357219.1\|4170948_4171725_-\|SDR-family-oxidoreductase	gnl\|CDD\|235975	PRK07231, FabG-like, SDR family oxidoreductase.	4.04497e-108
NZ_CP007155.1\|WP_148309522.1\|4170020_4170821_-\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|188352	TIGR03605, antibiot_sagB, SagB-type dehydrogenase domain. SagB of Sterptococcus pyogenes participates in the maturation of streptolysin S from a ribosomally produced precursor polypeptide. Chemically similar systems operate on highly diverse sets of bacteriocin precursors in numerous other bacteria. This model describes a domain within SgaB and homologous regions from other proteins, many of which appear to be involved in biosynthesis of secondary metabolites. While some substrates may be intermediates in non-ribosomal peptide syntheses, others are involved in heterocycle-containing bacteriocin biosynthesis, and can be found near SgaC-like (see TIGR03603, cyclodehydratase) and SgaD-like (see TIGR03604, "docking") proteins. Members of this domain family are heterogeneous in length, as many have a partial second copy of the domain represented here. The incomplete second domain scores below the cutoffs to this model in most cases.	3.84234e-25
NZ_CP007155.1\|WP_025357227.1\|4181089_4181806_-\|SIS-domain-containing-protein	gnl\|CDD\|179510	PRK02947, PRK02947, sugar isomerase domain-containing protein.	2.26462e-85
NZ_CP007155.1\|WP_025357236.1\|4189534_4190218_-\|DUF4166-domain-containing-protein	gnl\|CDD\|379359	pfam13761, DUF4166, Domain of unknown function (DUF4166). This domain is often found at the C-terminus of proteins containing pfam03435.	1.33839e-61
NZ_CP007155.1\|WP_030111189.1\|4174011_4174713_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.98613e-16
NZ_CP007155.1\|WP_051913344.1\|4179163_4180789_-\|hypothetical-protein	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	2.47976e-55

>NZ_CP007155.1|WP_051913344.1|4179163_4180789_-|hypothetical-protein
MQSKTRRWILGSGGAAVLAIIAVTGYLVFAPGPASRGGGGQQGVAPVKATADSVATSYLAAFSGQSTEGAAALTDDRTTASAALAKVYQGMGKASLTTSRDGGTETAQDGLSATARFGVKWTLPGGGTFSYQDSMQLRRNGEDWQVHWSDALVHPDLTKGQSLALRTETGKSSLLDRAGKPVTSDSGIPAGVLQGVRQEVGEVNGTDGWRVVAVDSAGADGRTLQEKKGSTPEQYTVTIDARTQKAAQDAVSAQSGAAAVVALSPAGEFLAVATNSAYDARNESPLTGLYTPGSTFKIVTATAALEQGQVSGGSTVSCPPTITIGQRTIPNDGNPPFGGGAAPDYSVSLRTAFALSCNTTFSTLASKLDTSALPATARQLGIGVDFTIPGVTTNTGSIKPVSSPAEQIEDGFGQGTDTTSPFGLAVLAATVQSGKLPTPTLIRGKQTQVTGQVPAPSPGVLAQVRQMMRDVCTTGTAKSLAGFPGLAGKTGTAEVGAGQSKQAHGWFVGYREGLAFAVLMPDAGTSHTAVDTAGAFLRGLG
>NZ_CP007155.1|WP_025357225.1|4178876_4179086_+|hypothetical-protein
MADLKKGARITGPTRDKLAADLKKKYEKGASIRALAESTGRSYGFVHRVLSESGVQLRGRGGATRTKKK
>NZ_CP007155.1|WP_025357224.1|4177047_4178676_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MITVTDLELRAGSRILVSGATLRVQPGDRIGLVGRNGAGKTTSLRVLAGEGQPYGGEVRRSGELGYLPQDPREGDLSVTAKDRVLSARGLDQILRDMEKAQTTMAELVDQNELDAAVRKYGRLEERFGSLGGYAAESEAARICANLGLADRILAQPLRTLSGGQRRRVELARILFGASESSAGGKDGTTLLLDEPTNHLDADSIAWLRSFLKSHTGGLIVISHDVELLADVVNRVWFLDATRGEVDMYNMGWQKYLEARATDEKRRRRERANAEKKASALMAQADKMRAKATKAVAAQNMAKRAEKLLSGLEDARQADKVAKIRFPEPAPCGKTPLMAEGLSKSYGSLEIFTGVDLAIDRGSKVVVLGLNGAGKTTLLRLLGRMDQPDAGRLVPGHGLRVGYYAQEHETLDHGASVWANIRHAAPDTGEQQLRSLLGTFLFTGEQLDQPAGTLSGGEKTRLALAGLVSSAANVLLLDEPTNNLDPASREQVLDALRRFEGAVVLVTHDPGAVSALQPERVILLPDGTEDHWSDDYLELIELA
>NZ_CP007155.1|WP_025357223.1|4175827_4176826_-|hypothetical-protein
MSRSARPRATALLAVLALAATTATQCAGPEPLGWTRETGGSNYDFYGLAGRCDREGFGVINGFARGRDTITAQLAQMYRAGQRRLRIGVFHHRGPDTGTIMDSTGGDLSPANRRNLADLLAAVRAAGFAEVEVAMQPSDENHPDWSHWREDLYQENWNLVANLRPVIAAAGIPYRIDLLNEGSPMSTEPALRRYAQRLWQDYTANFGKADTVGFSMTVWIADRATQLAAVYGDNPPEVFDVHLYGDAHNGDERTQFVDADRKMRELGYTQDWIIGEAYFDDRTAARGIAQAIAQTGRTVRYLAQWPLTRARSCADVDVAAPIAFEAYGRLPR
>NZ_CP007155.1|WP_025357222.1|4174725_4175718_-|hypothetical-protein
MKRLSHLCCALVTTTVVGTTALTGAASAQPMGTTALAGGSNYDFYGESGCDREPFGVVNSFDTGRATITAQLAQMYQQGQRRLRIGLFHHHAGDSGTVTDSTGPVSEHYKRNLADLLAAVRQAGFAEVEFSYYPVDANNPGNWSRFDEKLYQENWNFVAQVHPVLAAAGIPYKVDLLNEGMPMTGQQVRLEYAKRLWADYTANFGRADTVGFSMTVWLADRANQLRAVYGDNPPDLLDIHLYGDTHNGDEYTQFVNADKKLRELGYTQDWVIGETWFNDTNAAQGIGRAIAETGRRVRYLAQWPLARTHHCDFVDSAPPIKYDVFRQLQP
>NZ_CP007155.1|WP_030111189.1|4174011_4174713_+|alpha/beta-hydrolase
MDELRVRTGGTGEPNIVLLHGLGATSEVWDGVTERLTGSWIAPDLPGHGGSRRLAEYTFDRLADALAPCVPPDPVLVGHSLGGVLALALAARVRARSVLAIGVKVVWAQEELDRAAAMAARPGKLFATREEAAERYLKVAGLTGPDAPDAGLVREPGGWGLALDNRAFGVGAPDMRALLDGAGCPVVLAAGAEDPMCRPEQLRALDPEAVVLPGLGHNAHAEDPAAVAELISR
>NZ_CP007155.1|WP_025357221.1|4172662_4173964_-|cytochrome-P450
MTGILDPDTYVRGVPYEQLALLRERAAVNWVEEPDGPGFWAVLRHAEVRHVLRTPQVYSSHLGTTQIRDPATEQDLRYVRRMMLNTDPPDHSRLRGLLTKAFTPKAVAAISERVSRWAGELVAAVADRGECDFAKDVAADLPLLTLAEVFGVPAGDRGLMFDWSNRVIGYQDPEYAVSASVRGPEVSDLARAALALRPEPGPDGTMPDPRTRAGMPDLYAYAHSLGELKRREPGEDVMSNLMRSPVSIEEFENLFWLFSVAGNETLRNGLPGGMLALLTHPEQYRRLLADRSLVDSAVEEMLRWWTPVMHFRRTAASDTELAGVRISRGDKVVVFFSAANRDPRVFDSPDIFDVTRSPNEHLTFGYGPHFCLGAHLARVQMRAMFTAVLDQLGQVELAGDPVRLRSTFQNGLKSLPIRWPPPRESRSGARESR
>NZ_CP007155.1|WP_042220521.1|4171721_4172585_-|hypothetical-protein
MHSIRVARAEDLEPVIALLARSQARPEYLIGYHGETPEELAQELAEISPDWASCTVLAERDGRLVGLLTVDVHTEQRRSWLQGPYAEVDTGWAELADALFAAASDLPVMRGVHRFDLFGHVRHTRLAEFAGRHGFTTGKPVSVVQLDGDALRELISTPRPAPVLTERQRRAVTELHEELFPDSYMTGTDLLGRTTVICEEGGYAAGRAHEAEYFVDFVGVEPRHRGRRLVARLVADLLAALAAEHGPRPAACATIALGNTASERSFAAAGFRVLLDLVSYQRVTSAA
>NZ_CP007155.1|WP_025357219.1|4170948_4171725_-|SDR-family-oxidoreductase
MTAQDFVGKAALVTGASRGIGYAIARELLARGASVTITSRKPDAVAAAVEELTTEVADSEKRVLGVPGNAGNGEDRERAVTETLERFGSLDVLINNTGINPTFGFLPDADLDAVRKIFDVNVVGALGFVQLAWKAWMSEHGGSIVNVASVAGLRSSGVLGAYGASKAALIRLTEELAWQLGPKVRVNAVAPAVVKTKFAESLYTGREEEASQAYPLKRLGTPQDVASLVAFLASEGAGWISGETVRVDGGLLATGTMG
>NZ_CP007155.1|WP_148309522.1|4170020_4170821_-|SagB/ThcOx-family-dehydrogenase
MRLRRLRGMTCYWQDGSFVVHCHPGPGPVRVRPAVVEVLAAFDTWSTVEEASEALDHLRPTSVAEAAGTLRELGLLVEQDVEEHSAPQPPRATRILLPRIPGPRTGSTTGVSSAPVALSVLSTLLAQVFGQSELDAYLGVVTVDGVEPGVYHYNSQEHSLEQLVDGFSHSEAARLCAGWPGIDQAAFVVFVTATLDRMWTKYRVSLLDAGRLEQHFALCATTLGLGTCRGTAFDDRAVARRLGIDGVSDVPVHAFAAGVPASEVVG
>NZ_CP007155.1|WP_025357227.1|4181089_4181806_-|SIS-domain-containing-protein
MDYGQFLRDALHEVEEHNAEALDQVAELLLNCVRADATVVTAGAGHSLAAVAETFYRAGGLACVRPLYHPSLLPMHGAVASTTAERRSGLAAEVLEEVKLSEDDVLVVFSTSGVNPYPVELARAARSAGTPVVAFTSVTASSVAPRRAGSTLAEEATVVLDNLVISGDAAYPPEAPATAPSSSLANAFLWNLALVRLSDLAVQAGVELPLWRSANVVGGDAANKALLAKYTARIPELA
>NZ_CP007155.1|WP_025357228.1|4181898_4182654_+|DeoR/GlpR-transcriptional-regulator
MDSAERHELILRALRDRDRVPVAELAELTGCSEMTVRRDLDLLERNGLLRRVRGAAVGVLTGEETPYPARSRHQVAAKQRIGAAVADLIDDGESVALDSGTTTLEVAKCLVDRRLTVLPLSLHAVDVLRGSDQLRLVVPGGDLRPAEQSFVGPLTEHVFDVVRLDTAVLGCCGITARDGVSAYDLGEAQVKRAAVHASKRVIAAVDSSKLGRTAFGRVCPVSDVHVLVTDSAAPAEQVEQFQAQGVEVVLV
>NZ_CP007155.1|WP_042220524.1|4182646_4183792_+|MFS-transporter
MSESVQLRAPRAARWSTTAVFALHAVIFAAWTPHIPAVKQHLGLTDGTLGLALLGAPFGSVCAMFVAGLAVSRWGSRPVVAVSLAGYALLSVGLGLAESWLGLFLALVVWGAFQSTLDIAMNAQAVVVENGYGRPVMSSFHAGWSLAGFCGAGLGTLAVSLGIGLTWQMLTFGLVIAAFAWPLTKPMLRNDIASEEHKFALPWRNRALVVLSALMFAGLFCEGAMGDWTALYLRESLHAPAQLAGSGYAVFAVAMFAGRAMGDWLVSRFGDHRVVGGLAGAGAVLFALALVIGSPWAALVGFVAFGLGLSCIVPVVYRAAAAVPGLHAGAAIAGASTAGWSGMLLGPPVIGLLSEASTLPLALGLLPLLSAVVALGARFLR
>NZ_CP007155.1|WP_025357230.1|4183784_4185293_-|carboxylesterase-family-protein
MGLLHWTLAALTTLGLAAPPADAGPIARTTSGPVRGAHLDAVDSYQGIPYAQPPTGELRWRAPVPPHPWSAVRPVTKSGPACAQNNATGTSEDCLYLDVVAPRASTHRPVMVWIHGGGNTTGTGAQFDAARMAARGDVLVVTINYRLGVFGFFGYPGLPDSGTFGLQDQQAALRWVRANAAAFGGDPSDVTVFGESAGGVDVCAQLTSPGARGLFDRAIMQSGSCLTRVPTYATPGGPVHVSTSGFWGPVADREATGQQVAGKVGCGTLECLRDKHFEDLLRYEAGFGPAYGTPTLPQDPVLALRRGEVNRVPVLSGNTRDEARLTTMYSELLAGPFTVDGYTSLLRTTFGEERAAAIEGAYPAGADPGLAFATMDTDRVFACPQLATNRELARVTRVHGYEFADEDAPTYSQYFGPRPPGAAHGSELAYLFDLRGGAPYRGTQHAELTAPQRELGDTMIDAWTGHTPWPQWPYVQSLAPQRIGPVDGWAEHHCDLWADHLT
>NZ_CP007155.1|WP_025357231.1|4185298_4186336_-|oxidoreductase
MRWITGLTALALALAVPATALAQTAPTWTLSSTTVDARLRGLSAVNGQIAWVSGSKGTVLRTEDAGRTWLSVPPEGTAALDFRDIQAFDEHRALALSIGPGDQSRIYRTTDGGKHWATVRTNTDPAAFYDCMAFFDERHGLVVGDPVNGRIQVLATDDGGRSWQVLPAEGMPAAQPGEAQFAASGQCVSTDGDRDAWIGTGGGAHARVLHSGDRGRTWTAVDTPLASSQSAGVFSVAFRDWRHGLAIGGDYATPTATGTALALTSDTGAHWRVPAQAPHGYRSGASWARGNSVVAVGPTGSDLSRDGGRHWQQFDTGSFDTVDCQQLTVCWAAGEHGRIGRLRLA
>NZ_CP007155.1|WP_025357232.1|4186362_4186929_-|nucleotidyltransferase-family-protein
MTVVAGLVLAAGAGRRYGKPKALVRHNGRLFVQSAAEVLRAAGCEPVIVVLGAAAEQVRAADLGTAVLVDNPDWATGMGSSLRAGLAAAEEVAADAVVVLPVDLPGVTAEAVRRVVDLAAVDALAAASYDGVRGHPVLLGRAHWPGVREVAVGDAGARAYLRAHRVLDVPCGDVASGLDVDRPSDLPR
>NZ_CP007155.1|WP_025357233.1|4186939_4188091_-|glycoside-hydrolase-family-88-protein
MLSPRTRLVLTALVSFALLLPSTSQATAAAPPTDWSKAVVDSTMKRFTPAKLGGWGYQTGLYLYGQYLVYKRTGDKAYLDYIRSWVDRFVDGKGGISNSFNNLDSMQSGNLLVLLYQETKDPRYRTAATKIRNRLNSYPRTADGGFWHATSREHQLWLDGTYMVLPFLERYGHAFEDAAYSDAEAGKQLTVYGSHLADSSGLLYHAYDESGTQSWADPKTHHSPEFWCRSIGWYGMASVDVLDYLPSTSPYRAKIVNYVRNLAQAVRTYQDPKTGRWFQVPEKGSLSGNFTETSCSAMFTYMLSKSVQKGYLDPSYQAVADKGYQGVLAKVSLGSDGLTTISDICIGTNVGDTKFYLDRPRATNDFHGLGAFLIMNEQLAKHT
>NZ_CP007155.1|WP_030109208.1|4188178_4188877_-|MgtC/SapB-family-protein
MGLFGEATGQGWTQVGELLAALVLTTLIGLEREVRQKSAGLRTHTLVGLGAALIMLISKYGFTDVLTSGEIVLDPSRVAAQIVSGIGFIGGGLIFVRRDAVRGLTTAAVVWTSAAVGMACGAGLVLLATVVTAMHFVILFGYPPLVRWLTRSRQRASSVRVAYQDGRGVLRQLLSAATGQGFVVAEADTHRRQDEHVVDLELRVIGAGSPAQLAAAFSELDGVLTVHTGDGE
>NZ_CP007155.1|WP_025357235.1|4188891_4189527_-|TetR/AcrR-family-transcriptional-regulator
MAAADTRDRLIAGALETVRELGVTGVSARTVATRAGVNQALVFYHFDSVDNLLAQACLAESAARVAVYRERFARTGSLRELLAVGRDLHAREQQGGNVVVLAHMLAASHANDTLRAATAQALRMWTAEIEPVLARVLAAGPLKDLFDPAALAHAVAASFIGLELYGDVDPAAGALAMGELDRLGALAEALDGLGPVARKAARAKLGKVLRG
>NZ_CP007155.1|WP_025357236.1|4189534_4190218_-|DUF4166-domain-containing-protein
MTSIFERAMGTAEFGRLHPMVRERFSVGLSSGTASIATGVMSQVWCGAAFTKPFLHLGKTRHILFPETGTDVPFTMENWPYLDRAGREVVTFTRTFELPGVRRRFDATMVVEQHTNRLIDYLGTHQHVGVQLHLRAGADGALVIRSGEQRFRMGRLDFRVPAMLTGTAAVREWFDEDTERFGIEVRVVNRRFGPLFGYQGGFTARYLDTGVIPTPASVKPTKEETRT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_9

4267690-4267838

Orphan

Consensus_repeat	Method
CATGAAGGTGCCGTTGCGGACGTTGAACGTCATGAACGGCACCTTCCTGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_9

>merge|NZ_CP007155|9|4267690-4267838|CRISPRCasFinder
CATGAAGGTGCCGTTGCGGACGTTGAACGTCATGAACGGCACCTTCCTGACACCGGTGGCGGGCCAGTGGGGCGCGGCAGCACGGGGCGCGGCGCCGTCATGAAGGTGCCGTTGCGGACGTTGAACGTCATGAACGGCACCTTCGTGAC

>NZ_CP007155|9|8|4267690-4267838|CRISPRCasFinder
CATGAAGGTGCCGTTGCGGACGTTGAACGTCATGAACGGCACCTTCCTGAC	ACCGGTGGCGGGCCAGTGGGGCGCGGCAGCACGGGGCGCGGCGCCGT
CATGAAGGTGCCGTTGCGGACGTTGAACGTCATGAACGGCACCTTCGTGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025357307.1\|4270337_4270928_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
NZ_CP007155.1\|WP_025357311.1\|4273565_4273760_+\|ferredoxin	unknown	unknown	gnl\|CDD\|284351
NZ_CP007155.1\|WP_030108154.1\|4274607_4275567_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|184853
NZ_CP007155.1\|WP_025357298.1\|4260436_4261834_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|312032
NZ_CP007155.1\|WP_081789915.1\|4259140_4259848_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP007155.1\|WP_025357314.1\|4275643_4276327_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP007155.1\|WP_148309529.1\|4265943_4267140_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_148309528.1\|4262003_4262375_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025357309.1\|4271553_4272189_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007155.1\|WP_025357306.1\|4269267_4270272_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223566
NZ_CP007155.1\|WP_025357310.1\|4272338_4273553_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP007155.1\|WP_042220544.1\|4271033_4271540_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379209
NZ_CP007155.1\|WP_025357301.1\|4264088_4265270_-\|sugar-hydrolase	unknown	unknown	gnl\|CDD\|185755
NZ_CP007155.1\|WP_081789916.1\|4262295_4263309_-\|DUF4157-domain-containing-protein	unknown	unknown	gnl\|CDD\|379338
NZ_CP007155.1\|WP_025357302.1\|4265360_4266011_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025357312.1\|4273813_4274611_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_051912925.1\|4267204_4267633_-\|nitroreductase-family-deazaflavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|281995
NZ_CP007155.1\|WP_025357300.1\|4263350_4263959_-\|phosphoribosylanthranilate-isomerase	unknown	unknown	gnl\|CDD\|238237
NZ_CP007155.1\|WP_025357305.1\|4267839_4269195_-\|DUF2252-family-protein	unknown	unknown	gnl\|CDD\|313268
NZ_CP007155.1\|WP_025357297.1\|4259912_4260275_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025357307.1\|4270337_4270928_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.79004e-15
NZ_CP007155.1\|WP_025357311.1\|4273565_4273760_+\|ferredoxin	gnl\|CDD\|284351	pfam06902, Fer4_19, Divergent 4Fe-4S mono-cluster. Members of this family contain three highly conserved cysteine residues. This family includes proteins containing divergent domains which are most likely to bind to iron-sulfur clusters.	1.39396e-09
NZ_CP007155.1\|WP_030108154.1\|4274607_4275567_-\|nitroreductase-family-protein	gnl\|CDD\|184853	PRK14851, PRK14851, hypothetical protein; Provisional.	4.43843e-16
NZ_CP007155.1\|WP_025357298.1\|4260436_4261834_-\|alpha/beta-hydrolase	gnl\|CDD\|312032	pfam08386, Abhydrolase_4, TAP-like protein. This is a family of putative bacterial peptidases and hydrolases that bear similarity to a tripeptidyl aminopeptidase isolated from Streptomyces lividans. A member of this family is thought to be involved in the C-terminal processing of propionicin F, a bacteriocidin characterized from Propionibacterium freudenreichii.	2.44025e-14
NZ_CP007155.1\|WP_081789915.1\|4259140_4259848_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	2.49153e-46
NZ_CP007155.1\|WP_025357314.1\|4275643_4276327_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.25212e-64
NZ_CP007155.1\|WP_025357309.1\|4271553_4272189_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.11076e-10
NZ_CP007155.1\|WP_025357306.1\|4269267_4270272_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	1.86319e-52
NZ_CP007155.1\|WP_025357310.1\|4272338_4273553_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	3.04931e-85
NZ_CP007155.1\|WP_025357301.1\|4264088_4265270_-\|sugar-hydrolase	gnl\|CDD\|185755	cd09216, GH64-LPHase-like, glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain.	3.96026e-171
NZ_CP007155.1\|WP_081789916.1\|4262295_4263309_-\|DUF4157-domain-containing-protein	gnl\|CDD\|379338	pfam13699, DUF4157, Domain of unknown function (DUF4157). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. This domain contains an HEXXH motif that is characteristic of many families of metallopeptidases. However, no peptidase activity has been shown for this domain.	2.22299e-28
NZ_CP007155.1\|WP_051912925.1\|4267204_4267633_-\|nitroreductase-family-deazaflavin-dependent-oxidoreductase	gnl\|CDD\|281995	pfam04075, F420H2_quin_red, F420H(2)-dependent quinone reductase. This family of proteins is found in the genera Mycobacterium and Streptomyces. Member protein Rv3547 has been characterized as a deazaflavin-dependent nitroreductase. Rv1558 is an F420H(2)-dependent quinone reductase involved in oxidative stress protection.	1.16883e-14
NZ_CP007155.1\|WP_025357300.1\|4263350_4263959_-\|phosphoribosylanthranilate-isomerase	gnl\|CDD\|238237	cd00405, PRAI, Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP). Most PRAIs are monomeric, monofunctional and thermolabile, but in some thermophile organisms PRAI is dimeric for reasons of stability and in others it is fused to other components of the tryptophan biosynthesis pathway to form multifunctional enzymes.	3.07658e-70
NZ_CP007155.1\|WP_025357305.1\|4267839_4269195_-\|DUF2252-family-protein	gnl\|CDD\|313268	pfam10009, DUF2252, Uncharacterized protein conserved in bacteria (DUF2252). This domain, found in various hypothetical bacterial proteins, has no known function.	1.05387e-68
NZ_CP007155.1\|WP_042220544.1\|4271033_4271540_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379209	pfam13474, SnoaL_3, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	8.43072e-08

>NZ_CP007155.1|WP_051912925.1|4267204_4267633_-|nitroreductase-family-deazaflavin-dependent-oxidoreductase
MVTGSQEAARRRARTRLLQKYLINPPSKLLTTLGLLRGHIILETTGRRSGKRRRTVLGAQRAGSVLWVVAEQGRHAGYVRNLISQPRVRVRVDGRWHDARATVLDQDDVDARLASFEDQKHVAMVRRFGTSLLTVSIELDGH
>NZ_CP007155.1|WP_148309529.1|4265943_4267140_-|hypothetical-protein
MVGVLVRMKLNLVRHSMTSPRARLLVLGAVLGLLLAAGTLAVGATALFSTTVAADLIAAALAVWAVGWLLGPLFAGGGEGDLRPEQFALLPVSPRRLATGLLGARLGALPVLVALPAVLAQLVIVVLASRVVVGLLGEVMRSRLGAALVAVPWAVIIAAVCDGGVLLYALGQNSVLTRGFDPWLGSLLRALPSGWGLVSVETAGGTAWPLAFGVLAGMGVLVLALLAVWSVLLGRRTTGALAARARVGGTALGRGLPRTPLGAVVAKELRTWSRDMLRSYYWFFALAFSLALCLLPLVAGLTIYLPWAGSLVAIMAAAVGVNLYSADGSALWISLMTPGVLRADLRGRQLAWLLVVAPTSLVITVLGLALGADPQRRGDRRGRGPHGPAGGVRAAAPA
>NZ_CP007155.1|WP_025357302.1|4265360_4266011_-|hypothetical-protein
MAIGAGVGHMALLAVFAPPRLPDAHRRSPNPAVDGGNLTGLAWAMIGLIAATSVPPALIVLAGTLLDSPALRWAGVPAGVAVGALAAWWLGRIAYRRLETGGPELLLRLRSGTTVKAPPVVAPAKPARAKLARARAPRLVIALCLGSGWIPLLAGVLSLVKAFSGQSSQTGWTFVLALPRPLWIPVSAGLIALWLLLYSIAGWTALRLRRRRSSDH
>NZ_CP007155.1|WP_025357301.1|4264088_4265270_-|sugar-hydrolase
MSALRKALTLLAVTTALAAGLPAAADAAVPATIPLKITNNSGRSDPVYLYDLGTLLANGRQGWADANGTFHAWPAGGNPPTPAPDASIPGPANGQSITIRMPKFSGRLYFSYGQKLVFKLTTGGLVQPAVQNPSDPNRNILFNWTEYTLNDAGLWINSTQVDMFSAPYAVGVQPTGGATRTTGHLKPGGYNGFYSALRGQPGGWANLIQTRSDGTVLRALAPGHGIEAGALPRTVMDDYVNRVWSKYSGSTLTVTPFGDQPNTKYYGRVSGNTMNFTNGSGAVVTSFQKPDADSIFGCYKLLDAPNDLVRGPISRTLCAGYNRGTLLVNPNQPDSNPGGFYKDAVTNHYARKIHAQMADGKAYAFAFDDVGNYESLVHDGNPAQAFITLDPFS
>NZ_CP007155.1|WP_025357300.1|4263350_4263959_-|phosphoribosylanthranilate-isomerase
MFVKVCGLRTEGDVATAVSAGADAVGFVFARSPRQVDPDLARELVAGVPSQVLTVGVFAGVEAAEAARIALDTGIGAVQLHGDYPPEAFAELAGLPVRLVRATTLTADTDVRTGAYGEDLLLLDSPVAGSGERWDLTTLDQARPRGQWLLAGGLNPDNVAGAIAAAQPWGVDVSSGVESSRGVKDHGLIREFVAAARGATVR
>NZ_CP007155.1|WP_081789916.1|4262295_4263309_-|DUF4157-domain-containing-protein
MTPGRAGGMARTGAPEERAEHVRHSTSSSGTPLPEPIRGPMERAFGADFSGVRLHTGPAADAAAREIGALAFTSGRDIVLRSGALQLGTPAGTRLIAHELTHVLQQGRGSGQGGSRVSHPDDPSEREAAATAEHVLAGETAQPVRESAGAGLVQRAGEDLCGGPRTCASTTCADPDPGHGGDGHLVDPAGDDRHRGTLSGGGHREHDRPHLRRIQRLHRPPLHLRLLPRRFQHARSDVPPAGQRLRRAPGHGTRAVHGLPRELRADQGGVRGSTRPRPTPLHGSAQVRPAHLQLHDLRAPHRREGRQEPATDARQGRRLHRHSRGQPQHAVRGPEQA
>NZ_CP007155.1|WP_148309528.1|4262003_4262375_-|hypothetical-protein
MRGKVGGSTGIVADNPNTLYEGLSRRDTGPTYRLDSDTELRTTIAATPAPELGRMPTSERIRVVNRLLDGWVSEGDMWAIEQVCASITGQAEMKALREAVGGRESALWNDGHKRRFHLAVNRL
>NZ_CP007155.1|WP_025357298.1|4260436_4261834_-|alpha/beta-hydrolase
MRRVLTFALATAVTATVAAAVPAQAASLTWQACGNSGAECASLKVPLDWAHPSGPQITLAASRVRAADPQHRIGTLFVNFGGPGGPAMPIVRDGAAMVFPQQLRDRFDIVGIDPRGVGDSTPTIACELPTSDPRVSRFPSSRAEYDRLVAYNREVGEGCRRATGPLIDHVDTISAARDFEAARIALGESKVSWLGLSYGTLLGATYAQFYPNRVRSAVLDGAVDHTIGSWRLASDEAKSAEGVFAKFADWCRTTDSCAMHGRDLTGEYRALLNRASHKPVPAQGFPAGANAEQIGFVTYSTLATPPARWAELAQGISDAVAATPNAAFFAGPSASEAAYRVIGCHDFPSDVRGYADLAARIREVNRIAPNIGGYTEGWDVQAGCLGWPVPPANPWASTPVRGASNVLVVTGSNDPSTPRPWALGLVSQIQGAKLLEWNGVGHTGYFNDGPTKQREVDHLLTSLGR
>NZ_CP007155.1|WP_025357297.1|4259912_4260275_+|hypothetical-protein
MNEKVRVNWHGVLGVALVLAAVGIAFVRRWDVPWLYFLAAIVGYVVAVLALTFALRGSRGQYAELDSFDLMRVMYGAHLGFLFLVGGLLIPFGSFWVGLGVFIASIAAGMAIPFLLVRKA
>NZ_CP007155.1|WP_081789915.1|4259140_4259848_+|F0F1-ATP-synthase-subunit-A
MLPGLTKPVLQILLAVLLIGVVSVLVSGRLKFVPSRVQFGAEFLYEFVRNGIGREQIAKADMLRYLPLLLTMFTFILVNNLFGFLPFFQLPTMAHIAFPAGLAGLVYVLFIAVGIRRHGVLHYFGKTLFPPSVPKLVWLIYAPFEVLSTFILRPITLALRLFATMFAGHIMLLVFVTGGVYFLEQSVIGLKLLSPVAFLLAVGLSFLELLIQVLQAYVFTMLTAHYIGAALAEGH
>NZ_CP007155.1|WP_025357305.1|4267839_4269195_-|DUF2252-family-protein
MRRTATATAAVLALLACTAPHAGAAPLLTRDPVSVIYDHDHALHLLNNGATDDELQYRTGVLAGSAWAFFRGTSPLYYRDLGELAPSAYATAAGDVWITGDAHLENTGADRGADNTEQFAITDTDDAWRGSWTWELRREAVSIVLAERANGRSASQITTDLNTFVAEYAQWIGKFHGNDEELSWRLTSGNTSDLVKQLIADSHSDKRADLLSKWTTVSGSTRTFKSDSKLQAVSATTRADVVNAVAAYRSTAGAPLSASQAVVKDVRRRLDAGTGSLGRYRWYALIEGDTSSTSDDRILEIKQQVDPAPKQLAPSATTLTGGQRSALALRWLANQSDPLAGWASVGQVPVLVKEKSPFAEDLAIGDLTSSATWDDTVRDVARLLAAAHSRADKDIAGTGVTYSADAAIDGAITSVPGLQSETRTFATSYADQVTTDWQAYVTAKNNGRPLF
>NZ_CP007155.1|WP_025357306.1|4269267_4270272_-|NAD(P)/FAD-dependent-oxidoreductase
MHETQKLYDVVVVGGGAAGLAGALSLGRARRSVLVVDGGQPRNAPAAHMQNYLGSDGLPPAELLARARAEVTGYGVRIAPTEVVGARRSADGRFTIDLADGSTVRARRLLIATGVTDELPAVPGVAQRWGRDVLHCPYCHGWEVRDQPIGVLGTGPMATHIALLMRQWSADVVLFRHTAPELSTEQAAQVAARGVSVVDGEVRGLEVHEDRLTGVRLRSGELVERQAVVVTPRISPRLTGLDGLGLVPSENPAGTHLAADASGATAVPGVWAAGNVTDPMAQVIIAAAAGSKAGAMINADLITEDIDLAMAPEFSARAEAQVCERVLADSRHGL
>NZ_CP007155.1|WP_025357307.1|4270337_4270928_+|helix-turn-helix-transcriptional-regulator
MTEQNEQTDLDGVGPRLRALRRRRRVTLVQLAKDTGISVSTLSRLESGGRKPTLELLMPLARVHQVTLDDLVGAPATGDPRVYARPIQRGQITMIPLTRRPGGVQAYKMIYPPSAASGKPEQQVHEGYEWLYVLSGQVRLLLGQHDLTLGAGEAAEFDTRTPHWFGNAGPAPLEILSLFGPQGERLHVRARSTRKS
>NZ_CP007155.1|WP_042220544.1|4271033_4271540_-|nuclear-transport-factor-2-family-protein
MVVQHSGGRTVIQQTERRYGLDSTDRLTEATAPGPEGARAALESFYYALNSRDGAVLSQVWADNPLVQLNNPVGGILHGRQAVDELYARIFRGALRVRVTFSEVVEYLGERHAVFAGRELGSYGDGVPLAIRTTRYLRYDQGRWSQFHHHGSIDDPAALLAYQRAVSG
>NZ_CP007155.1|WP_025357309.1|4271553_4272189_-|TetR/AcrR-family-transcriptional-regulator
MTADPQAPLRADAQRNRDLIIAAARAIFTEHGPEVPMEDIARAAKVGIGTLYRRFPDRDALIRAVAVDSFARLLAEVRAAAVEEPTAWDALVRIMHHSTDLQLTAQLAMLSAKALQILKEDEAVCEQREELLVELERLMVRAQAAGQLRPDVGAGDIAVLIAMALRRPPAKTPEIGRLSTDRCIAIMIDGLRAHPGTPLPGRPLVRDDLRR
>NZ_CP007155.1|WP_025357310.1|4272338_4273553_+|cytochrome-P450
MTTTEEPALQFPLVRECPFSPPAEYRQIREEAPVTKVRTPEGKQMWVVTRHEDVRQVLNDRRFSANRFHPDFPVLVEGGNALRNRPESERSMIAMDAPEHGPARRAVLGEFTVRRMEQLRPRIQQIVDELIDNLLAGPRPADLVEALSLPVPSLVICELLGVPYADHEFFQEHTSRLIKRTTSAEGRREAFETVRAYMGDLLAKKEAEPTDDLLGRQIVKLREEGTYRRDALVSLGFLLLVAGHETTANMISLGTLALIENPEQAAAVKADPGRTLDAVEEMLRYFTIVDAATARLCVEDVEIGGVTIRAGEGVLAVGLAANRDPEAFPDPDEFDIERGGRHHVAFGFGPHQCLGQNLARMELQIVFDTLLRRIPDLKLAVPVDELPFKDDASIYGLYRLPVTW
>NZ_CP007155.1|WP_025357311.1|4273565_4273760_+|ferredoxin
MKIIADTGKCVGAGQCVLTESELFDQSEEDGTVIVLNDTPEGELVEKARQAVHICPSQALSLAE
>NZ_CP007155.1|WP_025357312.1|4273813_4274611_-|hypothetical-protein
MTDTVLAGMTLPHHPPAMVMWAAEYAARTGNPLRVILSRAGRCNPDPAMRAVRSAVAGVGARYPAPPLRLTLDPRPLFSAFADVPDAGLVLVDRDAHRWSAIRGLATRRAGPVAAVGADSWWTQKVQPLLVGTDGTASSEPALEWAFAAADCIGCGVRVVFSPAAATESAKLRESMLTTVTALTAHHRALDVRLHSRDSSLLEALSWHSQSASMTVLGPRNGTVTAATERVLLRSNCAIVLVPQRGAAPTANRSTMDSRVLPRHA
>NZ_CP007155.1|WP_030108154.1|4274607_4275567_-|nitroreductase-family-protein
MSSSVPGSLRLTPEEVMTALLAAGRAPSLHNTQPWRFRVLSSRIELHADTRRSLPVTDPHDRELRIACGAALLNLRLAIEALGVESVLTLAPSTREQGLLAVVRHTTRNLATSKALWHFDLIGRRRTCRGPFKDVPVPAEHVLALARAARAERCWLHVVTDPSQRREVLSLVREAHQRQVTDPAYITEMAGLSALNGASGPETQNERTRRDYHGASTRAQPSPREPLLLVLCSYLDDQLGELQAGQAMQRVLLAATELDMRAAFLSQPTEVPELRARLRRAVDPTLTPQVVLHIGYGEPAPPTQRRPVADLVMDTGGAP
>NZ_CP007155.1|WP_025357314.1|4275643_4276327_-|response-regulator-transcription-factor
MTTRVFLVDDHEIVRRGIADLLRGEEGLVVVGEAASVQETMVLLPAARPDVAVLDVRLPDGNGVELCRDLLAAHPALRCLMLTSYSDDEALFDSILAGASGFVLKQVLGVDLVHAVRTVAAGQSLLDTRTTKALLDKLRRDNETADPLRQLSAQQRAVLDLIGEGMTNREIAEHLFLAEKTVKNYVTQIFAKLGVQRRTQVVALATTQRRPGTRNSPQSDVEQGPVQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_10

5022466-5022672

Orphan

Consensus_repeat	Method
GGACCACCCCCGCGTACGCGGGGA	CRISPRCasFinder

3 spacers

csa3

The CRISPR arrays of NZ_CP007155_10

>merge|NZ_CP007155|10|5022466-5022672|CRISPRCasFinder
GGACCACCCCCGCGTACGCGGGGAAGACACTGAGCCCGATTCCGCAGAGCGTCGGCGGGCCGGACCACCCCCGCTGTACGCGGGGAGACGCCCCGGTGGCGCCCCTGGCGATCCACGCTGCCGGACCACCCCCGCGTGTGCGGGGAAGACCCCTATAGCCAGCGCCAACAGCCAGTGTCTCAAGGACCACCCCCGCGCATGCGGGGA

>NZ_CP007155|10|9|5022466-5022672|CRISPRCasFinder
GGACCACCCCCGCGTACGCGGGGA	AGACACTGAGCCCGATTCCGCAGAGCGTCGGCGGGCCG
GACCACCCCCGCTGTACGCGGGGA	GACGCCCCGGTGGCGCCCCTGGCGATCCACGCTGCC
GGACCACCCCCGCGTGTGCGGGGA	AGACCCCTATAGCCAGCGCCAACAGCCAGTGTCTCAA
GGACCACCCCCGCGCATGCGGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_051913410.1\|5023063_5023531_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|238260
NZ_CP007155.1\|WP_025357902.1\|5021646_5022207_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007155.1\|WP_025357899.1\|5019348_5019672_+\|hydroxyisourate-hydrolase	unknown	unknown	gnl\|CDD\|376352
NZ_CP007155.1\|WP_081789930.1\|5018529_5018817_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379117
NZ_CP007155.1\|WP_025357900.1\|5019674_5020538_+\|urate-oxidase	unknown	unknown	gnl\|CDD\|274554
NZ_CP007155.1\|WP_025357908.1\|5029157_5029958_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235628
NZ_CP007155.1\|WP_025357910.1\|5030711_5032277_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP007155.1\|WP_030108589.1\|5030054_5030645_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007155.1\|WP_081789448.1\|5014876_5016571_-\|glyoxylate-carboligase	unknown	unknown	gnl\|CDD\|183066
NZ_CP007155.1\|WP_025357898.1\|5018872_5019352_+\|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase	unknown	unknown	gnl\|CDD\|184333
NZ_CP007155.1\|WP_025357906.1\|5024471_5028002_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226715
NZ_CP007155.1\|WP_025357901.1\|5020568_5021609_-\|epoxide-hydrolase	unknown	unknown	gnl\|CDD\|377658
NZ_CP007155.1\|WP_025357893.1\|5013809_5014877_-\|glycerate-kinase	unknown	unknown	gnl\|CDD\|376844
NZ_CP007155.1\|WP_025357895.1\|5016570_5017440_-\|prephenate-dehydrogenase/arogenate-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|224995
NZ_CP007155.1\|WP_148309568.1\|5033545_5034310_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_081789929.1\|5017436_5018219_-\|TIM-barrel-protein	unknown	unknown	gnl\|CDD\|163190
NZ_CP007155.1\|WP_025357905.1\|5024004_5024367_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP007155.1\|WP_025357907.1\|5027998_5029168_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP007155.1\|WP_025357911.1\|5032283_5032973_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP007155.1\|WP_025357904.1\|5023565_5024036_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176868

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_051913410.1\|5023063_5023531_+\|AAA-family-ATPase	gnl\|CDD\|238260	cd00464, SK, Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.	4.57975e-06
NZ_CP007155.1\|WP_025357902.1\|5021646_5022207_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.07138e-11
NZ_CP007155.1\|WP_025357899.1\|5019348_5019672_+\|hydroxyisourate-hydrolase	gnl\|CDD\|376352	pfam00576, Transthyretin, HIUase/Transthyretin family. This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyze the conversion of 5-hydroxyisourate (HIU) to OHCU. HIU hydrolysis is the original function of the family and is conserved from bacteria to mammals; transthyretins arose by gene duplications in the vertebrate lineage. HIUases are distinguished in the alignment from the conserved C-terminal YRGS sequence.	3.42153e-49
NZ_CP007155.1\|WP_081789930.1\|5018529_5018817_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379117	pfam13309, HTH_22, HTH domain. This domain is a helix-turn-helix domain that is likely to act as a DNA-binding domain.	7.24109e-23
NZ_CP007155.1\|WP_025357900.1\|5019674_5020538_+\|urate-oxidase	gnl\|CDD\|274554	TIGR03383, Structure_Of_Uricase, urate oxidase. Members of this protein family are urate oxidase, also called uricase. This protein contains two copies of the domain described by the uricase model pfam01014. In animals, this enzyme has been lost from primates and birds. [Central intermediary metabolism, Other].	4.42134e-147
NZ_CP007155.1\|WP_025357908.1\|5029157_5029958_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|235628	PRK05855, PRK05855, SDR family oxidoreductase.	7.71984e-129
NZ_CP007155.1\|WP_025357910.1\|5030711_5032277_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	2.18652e-65
NZ_CP007155.1\|WP_030108589.1\|5030054_5030645_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	7.68518e-14
NZ_CP007155.1\|WP_081789448.1\|5014876_5016571_-\|glyoxylate-carboligase	gnl\|CDD\|183066	PRK11269, PRK11269, glyoxylate carboligase; Provisional.	0
NZ_CP007155.1\|WP_025357898.1\|5018872_5019352_+\|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase	gnl\|CDD\|184333	PRK13798, PRK13798, putative OHCU decarboxylase; Provisional.	5.94321e-46
NZ_CP007155.1\|WP_025357906.1\|5024471_5028002_+\|hypothetical-protein	gnl\|CDD\|226715	COG4264, RhbC, Siderophore synthetase component [Secondary metabolites biosynthesis, transport, and catabolism].	7.45379e-66
NZ_CP007155.1\|WP_025357901.1\|5020568_5021609_-\|epoxide-hydrolase	gnl\|CDD\|377658	pfam06441, EHN, Epoxide hydrolase N-terminus. This family represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (EC:3.3.2.3) comprise a group of functionally related enzymes that catalyze the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarization of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites which arise during the biotransformation of foreign compounds. This family is often found in conjunction with pfam00561.	2.17834e-22
NZ_CP007155.1\|WP_025357893.1\|5013809_5014877_-\|glycerate-kinase	gnl\|CDD\|376844	pfam02595, Gly_kinase, Glycerate kinase family. This is family of Glycerate kinases.	1.602e-136
NZ_CP007155.1\|WP_025357895.1\|5016570_5017440_-\|prephenate-dehydrogenase/arogenate-dehydrogenase-family-protein	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	8.25004e-91
NZ_CP007155.1\|WP_081789929.1\|5017436_5018219_-\|TIM-barrel-protein	gnl\|CDD\|163190	TIGR03234, OH-pyruv-isom, hydroxypyruvate isomerase. This enzyme interconverts tartronate semi-aldehyde (TSA, aka 2-hydroxy 3-oxopropionate) and hydroxypyruvate. The E. coli enzyme has been characterized and found to be specific for TSA, contain no cofactors, and have a rather high Km for hydroxypyruvate of 12.5 mM. The gene is ofter found in association with glyoxalate carboligase (which produces TSA), but has been shown to have no effect on growth on glyoxalate when knocked out. This is consistent with the fact that the gene for tartronate semialdehyde reductase (glxR) is also associated and may have primary responsibility for the catabolism of TSA.	4.11989e-84
NZ_CP007155.1\|WP_025357905.1\|5024004_5024367_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	4.9666e-18
NZ_CP007155.1\|WP_025357907.1\|5027998_5029168_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.3511e-50
NZ_CP007155.1\|WP_025357911.1\|5032283_5032973_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	6.97177e-15
NZ_CP007155.1\|WP_025357904.1\|5023565_5024036_-\|SRPBCC-family-protein	gnl\|CDD\|176868	cd07826, SRPBCC_CalC_Aha1-like_9, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.03273e-63

>NZ_CP007155.1|WP_025357902.1|5021646_5022207_+|TetR/AcrR-family-transcriptional-regulator
MTSRNAAATRQRILEHAQRQFAQHGYAAVTVKGVADAAGVSPNLITRYFGGKDGLFLAATQVEIPVADSFDGDRSALGSRLAASIVQRWFGAPGEDPLLALQRAAGERPEAAEALATFLDTNSLEPLHRYLRDSGLDDADARSRAAAIDAFVLGVSTRRRILRSELGDPADLQAWLSATIQRLADG
>NZ_CP007155.1|WP_025357901.1|5020568_5021609_-|epoxide-hydrolase
MNDDLRERLQQTRRVRTPWSADGTRGISGTRLDELLERWANGYDWGVHERRIGECPWVTVRAGDTELRVIHQRSVDPGAPVVVLLHGWPDSVLRFERVLPLLADIHVVVPALPGFPFAAPLTVAGMSANRIAGIVADALDELGYSRYTVSGGDVGGTIAELLAAEHPDRVVALHLTNIAPQRALSADPAKLAPDAAAYLDRSARWFRAEGGYIAEQSTRPNTLAVALGDSPAGLAAWIIEKLESWSEESAFTADELLTWVTAYWVTGTIGTSFATYVEPVALPDRIDTPTVLSVFPRDIKPEPRSYAEVFLNVCDYVEHQAGGHFAAWEQPEAYVGDVHRAIKLGG
>NZ_CP007155.1|WP_025357900.1|5019674_5020538_+|urate-oxidase
MGITLGANQYGKAENRLVTVSRQGSRHEIRDLTVSTALRGDLADTHLTGDNSKVLATDTQKNTLYAFAKQQPPGQIEEFGLRLARHFTGSFEQITGARVIIDEHAWQRIDDHDHSFARSGEEKRTTTVTVHNGQEWVVSGLRDLVVLKSTGSEFHGFPRDRYTTLPETTDRILATAVTARWRFAHLDVPWDKSFAEARQAMLAAFADTHSLSLQQTLYAMGKAVLEAREEIAEVRLSLPNKHHFPVDLSKFGLDNDNEVFYAADRPYGLIEGTVLREEAPEPGPAWD
>NZ_CP007155.1|WP_025357899.1|5019348_5019672_+|hydroxyisourate-hydrolase
MSAITTHVLNTTSGLPAAEVAVRLECDGQVIGEGVTDADGRCRELGPDRVQAGVYRLVFDTDGYFARTATEAFFPEVVITFRITDPDRHHHVPVLLSPFSFTSYRGS
>NZ_CP007155.1|WP_025357898.1|5018872_5019352_+|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase
MDLNSAPEMDLAERLTTCLAVPRWVREVLAGRPYADEQAVLVTAERAAAELTDEELTAALAGHPRIGERAASADLGAAWSRSEQSGVDGSAAEEFVAANEVYERRFGRIYLVCASGRSGPELLADLRSRLDNDPVTELAVTKDELRKIALLRLRKVLES
>NZ_CP007155.1|WP_081789930.1|5018529_5018817_+|helix-turn-helix-domain-containing-protein
MRGGATRVTLRLNVLPAQEVPARHGLASALEQLLGEVAAELGGDLADLTRADKQRAVRLLEERGAFSLRKSVPAVAEALGVTRFTVYNYLNREDT
>NZ_CP007155.1|WP_081789929.1|5017436_5018219_-|TIM-barrel-protein
MNLSILFTELPLLVRPEAAARLGFRAVEFWWPFATATPADAEVDRFVAAVSGAGLRLAALNFYAGDMAAGERGIVSAPGRCDELADSVSIAVGIADRLGCRTFNALYGNRIAGVDPSEQDETALLNLSAAAKSVAAIGGTIVLEPLSAAPDYPLRTAADALAVADRVGADNVRLLADLYHLTVNGDDLDALATALTHRVGHVQIADAPGRNQPGSGVIDLRGHLEALHRNGYRGHVGVEYRPSGASADSFGWLDTFWRKP
>NZ_CP007155.1|WP_025357895.1|5016570_5017440_-|prephenate-dehydrogenase/arogenate-dehydrogenase-family-protein
MTTIGFVGLGIMGSPMAAHLAAAGHTVRGYDRSAPAVEKLVAAGGIAAANTAEAVRGAEVVITMLPADEQVREVGGEVIAEAEPGLLLIDMSTVRPDTATWLAESAHRKGIRVLDAPVSGGQAGAERAALSIMVGGSAADFTAARGLFEVLGATIVHVGPTGSGQVVKAANQLVVGGILGLVSEAIVLLEATGVDPVAGLDVLAGGLAANRVLDLKRAAMIARQFQPGFRIDLHHKDMGIALAAARQAEVALPLTALVAQLVAAARAMGHGGLDHSALLTVVEALSGRS
>NZ_CP007155.1|WP_081789448.1|5014876_5016571_-|glyoxylate-carboligase
MPKVPVMQAVVDVLASEGVTTVYGCPGAAILPFYAALEHSPIEHLIVRHEEGATHMADGWARTTGNVGVAVGTSGPAGTNMITGLYTAQADSVPILCVTGQAVSTKLHQEAFQAVDIVRIAEPVTKWAVQVREAAQAPWIFREAFRLARSGRPGPVLIDLPLDVQRQEIEWDASIDAPLPVEVPAPHPPRVERALDLLLAAERPLILAGGGVILSEAAEPLRQLAEHLGVPVQVTLMGKGALPENHELFAGMAGIQTSQRWANAAFLESDLVLAVGARFGDRHTGELSVYRGRRKFVHVDVEPTQLGRVFGPDLGIVSDAKLFLHALLDAARHRAQRPDHAVWVRRIGQLRRELPRREDFDTTPIKAPRVFRELNRTFGPDTYFVTAIGLYQIWSGQFQTVHRPRHYQVCGQAGPLGWEIPAAIGVRTARPDAEVVAVVGDYSFQFLVEELAVAAQYEIPFVLVMLNNEYLGLIRQAETGYGMNCEVDIHYDEHGTDNVRIMQAYGCSGRRVVEPGEIAGALEWARGQARRTSRPVLVEVMIDRAANASMGSALDSVVEFEPVS
>NZ_CP007155.1|WP_025357893.1|5013809_5014877_-|glycerate-kinase
MRVLLAPDKFKGSLTASAVADHLAAGLRRAAPGLDLRELPIADGGEGTVDAACAAGYHRVTATVTGPLGLPVRAALAVRGPTAVIELAQAAGLSHGTAPLTATSYGVGELIRLALDRGCGRIVLGVGGSASTDGGAGMVHALGARLINARGPGGAALRELTGVDLSGLDPRLRTTRFVLASDVDNPLREAAPVYAPQKGATALEVSLLADGLRRWAEVLGGDPLAPGSGAAGGVGFAALTVLRAERRPGVQVLLDLLGFADAVRGAALVVTGEGALDEQSLHGKAPVGLARAARGVPVVAVTGRCELSTAQLRGAGFAAAYALTDLEPDRSRCLSAPGPLLEIIAGRIVEDHLCC
>NZ_CP007155.1|WP_051913410.1|5023063_5023531_+|AAA-family-ATPase
MSGTGKSTALNQLEQRGYRVVDTDFGGWIEEVPSPDGSGGEPQWREDRIEALIADHERSGEPLFIAGTVCNQHRFHSRFDEIVLLSAPLAVVLDRIANRDNNPFGKTAGERDRIVADTAEIEPLLRSSATVEIDTRTPLTEVVDQLAALAGPPAP
>NZ_CP007155.1|WP_025357904.1|5023565_5024036_-|SRPBCC-family-protein
MGKAVVTLPGDTEVLITREFEVPAHLVYRAWTTPELIKRWWGGDRGEVTSVEVDLRVGGRWRYVMTANGGFEVGFHGVYREIVPNELIVSTEVFEGAPDGESLNTLTLTEKEGRTTLEILVRHAKREHRDAHINSGMEVGMQESMDHLEAVAKSLR
>NZ_CP007155.1|WP_025357905.1|5024004_5024367_-|winged-helix-turn-helix-transcriptional-regulator
MARAATTTDAFNAVAEPRRRQILDLLVTGERAVSELVEQLGLAQPLVSKHLRVLREVGLVQVREEGRNRLYRLNPQPLKPLHEWLSTYERLWDERFTRLDVVLAELQEDEDGQGSGDAPR
>NZ_CP007155.1|WP_025357906.1|5024471_5028002_+|hypothetical-protein
MSTSTPPDVLANHEARVAEELSQQDAELAAQFRAQLPGARRSVLNRLVSALVRERLLSSDRLKPTVRQVTATGRLVADGPVVFEDRTVEDPVDLLRLIAEHGLGTGAPGEWLRVAEEIGHSVTGQALAMVAAEHRRRPSEVDAPFSALDAALRAAGGHGCLAVAFEQLVVDGHPMHPGAKIKIGMSAVDAVRYGPEFGVSFDLGLIAVRQDCAVGSPIARAVLREAFPRAVTEAEAELRAAGHDPDGYVFVPIHPHQREHAMPQLHSDALADGTVLPLRARIPAEPLMSVRTLAVREPGSPVGLHVKTALEVRVTGAVRGVSQAAIHNGPKVSELVERIAAGDLDLSRTTQDGRRRFAICRELAGVGYVPPEARGEGWDTGDSEKALARQRSLCSVLREDVAAGVAPGELAMPVAALLATSPVTGNSVVADLLTELHGEVGGTLDEVAQEWLGQHVELCVPAALTLLVRYGIALEPHPQNAVLVLADKRPQRVLVRDLGGARLLPQRLARRGFEIELLPGSALLAEDPELLRAKLFFPLFGNHLGELIAAVAEGTGCPEDQLWAVVRRCVLRTFTRLTAAAVSQDEVDDARADAEALLHKPWRYKTMLAMRLASLVTDQRYVDAPNPLRDSEPPAMPEDLSLPEEQMYHQLRESDPELLRGWLTELPGARLSTVYRALGAMEREDVVGTNRPVHTIDELVDLVHPAQVRADLADSARNLALSRAGVARRRRRLSADQSVSDLILDLDAMCAEGHLLHPFGRSRGEFTPADSLAYAAETADTVGVQLVAVRRELTMLTPDESGRSVGDLIAEHYPEVAARARAGLERRGHDPGRYELVPVHPWQAARALPREYAAELASGEVVPIPEAQLACRPTVSLRSLVTAAPGRHGRRLTVKTALDVLITSTRRTISPASTRNGPAQSALLTRLVGNNDRVRVVAELAGVAFAGAADTPGRKRGLSALLREDPADQVGRGEWAFSACALRATSPATGRPLLADLLETQSPQEFLTEYADLLFSATLPLMWRHGIALEAHLQNTVLVVREGRPVRLLLRDFSGMRGHRERMRLSGAEFTPHEGSVTITEDLAEVRAKLAHAVVLANLADVVDLLTTVAEVRAESLWELVREVLRRVHEGIDSPWAEEEYAALLAPTLSQKALARMRMAPVDGVVHCPRPNPLLS
>NZ_CP007155.1|WP_025357907.1|5027998_5029168_+|MFS-transporter
MSGRKPLTLFLTGTLASRIGDNADLLALNWYVLERTHSATMLGLVNVLRLAPILFCTAPTGWLADRFDRRRLLAGTRLALFVSTLAVAAAVVGEGPMWVLCGAVLVRAVAGCAEPVLRQSMLPLLCGGRPLAKVVAMHSACLNLAMVLGPAIGSVLLATTPLVTVFWFNVACSVLSLCCLTILPENSRRAERGPSTPLWPFVRENPVVRAQLALAVGPMLFAFPYTSLMPLLAKDLVGGDAGTTGLLLTSGAVGALAASLSLSRRAPARPGVLAAVTGVALGVMLLGLLVFRSFGVEAAVAMMLLVGVVGQCYRTSNRSALQLALPDELRGRVLGIANTDRALIPAGTALLSPIAELFGTATMLLVMGVGCVLVTLLAAQLGTRERVMA
>NZ_CP007155.1|WP_025357908.1|5029157_5029958_-|SDR-family-NAD(P)-dependent-oxidoreductase
MAARLVVVTGAGSGIGRATALAFARRGAEVIASDQDGDTARATADSGGSGVHAYRLDVSDEQSVWSFAAEVSTAHGVPDVLVNNAGISHVGGVLDTSTEQWARVLEVNLWGVIHMCRAFGVRMVASGGPAHIVNVASGAAYVPARSLGAYATSKAAVYMLSDCLRAELSAAGIGVSTICPGLVSTNIVQVMTFSGQDAQQQERQRARAVRLHRRRDFPPERVAEQILRAVRRNRPIVPVTAEARLALVLSRLCPGVLRAMARLVTP
>NZ_CP007155.1|WP_030108589.1|5030054_5030645_-|TetR/AcrR-family-transcriptional-regulator
MTGRAGTKGVPREERERQILDEAAAEFGTHGYAHASVAEIANRAGISKPLVYSYFESKDGLFLACLHRAGPPLVQAVAAAQHPVPGRQRAADTLAAIFTTLEPRPHDWSIVYDPTVPAGSPIEQQARKYRRALNRLGAVGVSEVLADVGGYDAKDESLLTQVWFGVVTAMVRWWQQHPAQTASDMIARSQRVIAAL
>NZ_CP007155.1|WP_025357910.1|5030711_5032277_+|FAD-binding-oxidoreductase
MTRSWWGWGNTQDAVAGQELAELTARVSALLPDRDPTVHEPPEVAALDLPTPRVTPPAALAHLCSVEPEDRAAHSHGKAYRDVVRNLAGDLRHVPDLVARPRTEQDVVDLLDWCTRESVAAIPYGGGSSVVGGVEPRFDGEYAGAVTLDLGRLDQVLEVDRVSRAARIQAGVLGPHLEQQLRPHGLTLRHYPQSFEFSTLGGWLATRAGGHFATLHTHIDDLTESMRVITPTGVSESRRLPGSGAGPSPDRLWLGSEGALGVITEAWLRLQDRPQWRSRASVHFGEYGRAVAATRAIAQSGLYPANCRLLDAGEAFLNAGASVGGAVLVLAFESADHPVRAWLDRALQLCRDHGGTVHDDAEDPGTAWRASFLRMPYQRDALARQSVLVETFETACTWDRFEQLHAAVLAAAHGALRRVTGGGLVTCRFTHVYPDGPAPYFGVYAPGRWGSLVAQWDEVKAAVSEALIANGGTITHHHAVGRDHRPWYDRQRPEPFAAALAAVKSTVDPARILNPGVLLPG
>NZ_CP007155.1|WP_025357911.1|5032283_5032973_-|response-regulator-transcription-factor
MVKVAVIADDPLTADGTVSYLNGFDQVRAYCGAEAAERCQVVVALGGDLSPELLTSLRAAATLARPRRLPALLVVNQIELAQAEQAVHAGVVTVLWRQETSLEQVYEAVLRIQRPNSVQGNLIAQIRGIESRNRELALLRSGALSEREIQLLQLLSEGTPTTVVARVLGYSERSVKGFISDLKARLGLRGRVHAVAYAARHDLLARYRDLNCPPEEAAQFAASRAVTSR
>NZ_CP007155.1|WP_148309568.1|5033545_5034310_+|hypothetical-protein
MERNRTVRAHKLLELWGYLLTRPEPEDVEEIRTATGATLGLATRQSFHLYVRALAELEMVVILESTSGAPRKLYSGAFPRTLSELDRTMLRSWTATLPCRPCRGEVQLRLTGGCPADAADHRALPPLPVSARELLSGLDGLYEPRVRAIWAEMLSIDEDYSLFQILGLARNSMPISSSQTVGRYLRGMRKAGLIRSSDYLHGTGKVYQGCFPRAVTDEDYLRLQPWLRTLPQERARVVLHRWSTRPRPGVPITT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_11

5121424-5121502

Orphan

Consensus_repeat	Method
AGCGCCAGCACGCCCTGGTTGGTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_11

>merge|NZ_CP007155|11|5121424-5121502|CRISPRCasFinder
AGCGCCAGCACGCCCTGGTTGGTCTGGTCCAGTTCGCTGGACAGCTCCGAGTACAGCGCCAGCACGCCCCGGTTGGTCT

>NZ_CP007155|11|10|5121424-5121502|CRISPRCasFinder
AGCGCCAGCACGCCCTGGTTGGTCT	GGTCCAGTTCGCTGGACAGCTCCGAGTAC
AGCGCCAGCACGCCCCGGTTGGTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_051913363.1\|5115729_5116332_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP007155.1\|WP_169743531.1\|5123486_5123900_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP007155.1\|WP_025357995.1\|5128503_5130153_-\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|238832
NZ_CP007155.1\|WP_030111312.1\|5118735_5120301_-\|fused-response-regulator/phosphatase	unknown	unknown	gnl\|CDD\|369272
NZ_CP007155.1\|WP_030111316.1\|5124844_5125522_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133035
NZ_CP007155.1\|WP_025357991.1\|5123076_5123490_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340411
NZ_CP007155.1\|WP_030111315.1\|5123899_5124757_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP007155.1\|WP_169743562.1\|5125518_5126739_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225031
NZ_CP007155.1\|WP_025357982.1\|5112068_5112629_+\|hemerythrin-domain-containing-protein	unknown	unknown	gnl\|CDD\|213983
NZ_CP007155.1\|WP_158510785.1\|5118378_5118534_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025357983.1\|5113789_5115733_-\|YhgE/Pip-domain-containing-protein	unknown	unknown	gnl\|CDD\|274414
NZ_CP007155.1\|WP_081789934.1\|5109561_5110686_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP007155.1\|WP_025357994.1\|5128058_5128511_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025357980.1\|5110755_5111361_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP007155.1\|WP_025357985.1\|5117066_5117588_+\|ANTAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|198080
NZ_CP007155.1\|WP_025357981.1\|5111395_5111995_-\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP007155.1\|WP_025357996.1\|5130152_5131943_-\|thiamine-pyrophosphate-requiring-protein	unknown	unknown	gnl\|CDD\|181344
NZ_CP007155.1\|WP_025357993.1\|5127788_5127974_+\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|283241
NZ_CP007155.1\|WP_042220675.1\|5117591_5118368_+\|GAF-and-ANTAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|377145
NZ_CP007155.1\|WP_025357990.1\|5122033_5123071_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340411

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_051913363.1\|5115729_5116332_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.45168e-12
NZ_CP007155.1\|WP_025357982.1\|5112068_5112629_+\|hemerythrin-domain-containing-protein	gnl\|CDD\|213983	cd12108, Hr-like, Hemerythrin-like domain. Hemerythrin (Hr) like domains have the same four alpha helix bundle and a similar, but slightly different active site structure than hemerythrin. They are non-heme diiron binding proteins mainly found in bacteria and eukaryotes. Like Hr, they may be involved in oxygen transport or like human FBXL5 (F-box and leucine-rich repeat protein 5), a member of this group, play a role in cellular iron homeostasis.	6.10769e-05
NZ_CP007155.1\|WP_025357995.1\|5128503_5130153_-\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|238832	cd01662, Ubiquinol_Oxidase_I, Ubiquinol oxidase subunit I. Ubiquinol oxidase, the terminal oxidase in the respiratory chains of aerobic bacteria, is a multi-chain transmembrane protein located in the cell membrane. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits in ubiquinol oxidase varies from two to five. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme and a copper ion. It also contains a low-spin heme, believed to participate in the transfer of electrons from ubiquinol to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from ubiquinol on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. It is generally believed that the channels contain water molecules that act as 'proton wires' to transfer the protons. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are believed to be transferred directly from ubiquinol (the electron donor) to the low-spin heme, and directly from the low-spin heme to the binuclear center.	0
NZ_CP007155.1\|WP_030111312.1\|5118735_5120301_-\|fused-response-regulator/phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	4.20097e-40
NZ_CP007155.1\|WP_030111316.1\|5124844_5125522_-\|glycosyltransferase	gnl\|CDD\|133035	cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	9.18768e-13
NZ_CP007155.1\|WP_030111315.1\|5123899_5124757_-\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	1.24464e-42
NZ_CP007155.1\|WP_169743562.1\|5125518_5126739_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|225031	COG2120, COG2120, Uncharacterized proteins, LmbE homologs [Function unknown].	3.34022e-26
NZ_CP007155.1\|WP_042220675.1\|5117591_5118368_+\|GAF-and-ANTAR-domain-containing-protein	gnl\|CDD\|377145	pfam03861, ANTAR, ANTAR domain. ANTAR (AmiR and NasR transcription antitermination regulators) is an RNA-binding domain found in bacterial transcription antitermination regulatory proteins. The majority of the domain consists of a coiled-coil.	1.65881e-08
NZ_CP007155.1\|WP_025357983.1\|5113789_5115733_-\|YhgE/Pip-domain-containing-protein	gnl\|CDD\|274414	TIGR03062, hypothetical_protein_lp_1332, YhgE/Pip C-terminal domain. This family contains the C-terminal domain of a family of multiple membrane-spanning proteins of Gram-positive bacteria. One member was shown to be a host protein essential for phage infection, so many members of this family are called "phage infection protein". A separate model, TIGR03061, represents the conserved N-terminal domain. The domains are separated by regions highly variable in both length and sequence, often containing extended heptad repeats as described in model TIGR03057.	7.73225e-66
NZ_CP007155.1\|WP_081789934.1\|5109561_5110686_-\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	9.53354e-33
NZ_CP007155.1\|WP_169743531.1\|5123486_5123900_-\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	3.91048e-30
NZ_CP007155.1\|WP_025357980.1\|5110755_5111361_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.02018e-09
NZ_CP007155.1\|WP_025357985.1\|5117066_5117588_+\|ANTAR-domain-containing-protein	gnl\|CDD\|198080	smart01012, ANTAR, ANTAR (AmiR and NasR transcription antitermination regulators) is an RNA-binding domain found in bacterial transcription antitermination regulatory proteins. The majority of the domain consists of a coiled-coil.	1.0338e-07
NZ_CP007155.1\|WP_025357991.1\|5123076_5123490_-\|ATP-binding-protein	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	4.37775e-32
NZ_CP007155.1\|WP_025357996.1\|5130152_5131943_-\|thiamine-pyrophosphate-requiring-protein	gnl\|CDD\|181344	PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional.	0
NZ_CP007155.1\|WP_025357993.1\|5127788_5127974_+\|CsbD-family-protein	gnl\|CDD\|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	4.68596e-08
NZ_CP007155.1\|WP_025357981.1\|5111395_5111995_-\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	2.6357e-14
NZ_CP007155.1\|WP_025357990.1\|5122033_5123071_-\|ATP-binding-protein	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	9.32141e-28

>NZ_CP007155.1|WP_030111312.1|5118735_5120301_-|fused-response-regulator/phosphatase
MSADLPARILVVDDNEASRYITASWLRRDRHEVVEAADGTSALAVLREQAVDLVVLDVNLPDISGFEVCERIKEDPATAVLPVIHVSATLVDPAERAQGLTRGADAFMSEPVDPTELLATVTAALRYYRARSAAERLARRLNQLTRSSLLVNAATTFSALITAAVRGAATIFDSGTSVLLALSDGREWQATTEGPDQRVSTHEEQSGLLERLAEQAFDGQVGAALVTLAAADSPTGDQAVAVVVRTKLDQPPCCIALPAEAAALPEDHDLLLQLGQATAVAAQGLRAYAAEHTLALTLQRSLLPRGLPHREDLLMAARYVPASDAAEIGGDFYEVTELGDRLLVAIGDVTGHSIEAATVMGEVRHALRAYAVDGHGPAEILLRLDAMLRRFHPTGFTTVCLMVVDPGAGTVEIANAGHIPPLFVDADGARYVPLPGALLGIGVPRPPSTVLPLPPGTSVVLMTDGLVERRGVPLDEDLEVLRAGMLGDESPDALCGRLLAQFGQGKDDDIAVLVLQRPGSP
>NZ_CP007155.1|WP_158510785.1|5118378_5118534_-|hypothetical-protein
MGILQVWQSCGQQQARADMHALHSQGTEAIRMIGAVDAAAEGLSDPDAGWE
>NZ_CP007155.1|WP_042220675.1|5117591_5118368_+|GAF-and-ANTAR-domain-containing-protein
MTALREPRAAPHADLVRTAPEVFSDCVAAITARLAARHDRLSVLDAVITAYGDLLAPAVSGTLIADPRGGYALLSASDDRVRFIELPQIQFDQGPCLDSITGNTLVDSLDLEADRVRWPRFAKAAANEGIRSAYAFPLSLDGRAVGGINLFFTRRTELVGWQLRLGQSLANLATLGLTQERDPRRVERLAEQTMTALNDRVHIGQAIGVLAGDLGLTPEVARHWLYEYSSRTGRSPRELAQALTDGSLAPADLVAQDG
>NZ_CP007155.1|WP_025357985.1|5117066_5117588_+|ANTAR-domain-containing-protein
MDGQRRDRLWQRVAERAGDRDFSGWAGGGVRCRADQISVDAVAIGTGLAAAFAFPLRGGAIQLGTLSLYRRLPGPLAQDELADAAVLAELATTALLTDAAEEAADQAEWIKQDNPGHYDAVNIATGMLAAQLHISMEDAFLRLRAHAFSHNRPLLEVAQDVLNRSLHFETPQE
>NZ_CP007155.1|WP_051913363.1|5115729_5116332_-|ATP-binding-cassette-domain-containing-protein
MFDGVDLDLPAGGLLAVHGPGGSGRTSLLLALSGRMRLAAGAIAVGKHRLPGDERAVRELVGVARAEPAVALEERLRVDELVRERCWTGREVTPARVHEAMDLVGVRAPGRDLVEDLPPWTATLFAVALALAERPRALVIDDVDRDCPREQVTEVWQALDRLRHNGCTVLAGCCDPPGPGGEPVLVELPRRSVDRLEVRR
>NZ_CP007155.1|WP_025357983.1|5113789_5115733_-|YhgE/Pip-domain-containing-protein
MTAIRLALLELRRFRGPLRRLVPVALCLIPLLYGAMYLWANWDPYGKLKQIPVAVVNHDRVAHSKQGQRVDAGNQFVQQLKVAGTFDWHFVDDHEARDGLEHGRYYFTITVPEDLSGKLATAANTQPEQASITIQLNDANNYVIGVMSEAVQPELQDQVNSAAHAAYVRAIYGELSQVRDKLGVASDGAHRLVDATATAQQGTRALSSGTSALRSGTAQLAEGARQISQATSTLDNAVSKAATAVADKLPGAAATLVTAANLTAQGLSALHTGTSQVKQGTARAVTDLNQLGDAAPQLRGNPVYQRAVHDAEQVDAVAGQIDGQAAAADANAQQVLSEARQLQANVGDARQGVLAATAPVRLIDAGARDVSGGAATLSQATDAADQGAQSLKSAADQAHSGAAEIAGTVDDGLRQIPATSPDEVSHAAEVLGTPVRIYRDNLNPAGVYGRGFAPFFFGIALWVFGLFAYLLLRPVNPRALASRISPLTVAVAGWLPAAVLGVAGALLLFTVVDLGLGLDPVNPVLTVALLALGAATFVAVDHFLRTTLGAPGDVLSLVLLILQLTSSGGLYPMPTTPGLFQVLNPVLPMTYLIDGLRITTSGGLTANLVRDFLVLAGVLVLFLGLTSLTVRRQRMWTPARLHPDVEL
>NZ_CP007155.1|WP_025357982.1|5112068_5112629_+|hemerythrin-domain-containing-protein
MADITSLILDDHDRFRREFARMDDVVDNEELGRIWRALGDLLDVHAAAEEAIFYPQRMRRGSEAEDETLDAVGDHNDIRDGVHDAALHPVGSTAWRAAVHRARMANSEHMAEEEDGALADFRRHADPGLREELGRRFLEFKQEHAGTRGLDVSDVDPEQYVEQLARARKRDPEPDPSLRIGGLKER
>NZ_CP007155.1|WP_025357981.1|5111395_5111995_-|mechanosensitive-ion-channel
MTRTEDLKAKLPLRLVCWLLVAVAGVVVANTVLEDKLLTKGLSLGGTALFAIGGIAATRSAATEVATRLRGKGFGAAGSVLSTVLTATGYCVVVLTVLSLIAVPLQQLVVGGAVTGVILGIAAQQTLGNVFAGMMILLVRPFRIGDTIEVRSGALNGPFTGRVRALGLTYVTLAAENGTLLLPNAGVLAAGVTVGLEPE
>NZ_CP007155.1|WP_025357980.1|5110755_5111361_-|NAD(P)H-dependent-oxidoreductase
MTTLKALALVCTLTPSPAVSSSHVLAEQVLSELDGHGVRGEAIRLVDLDVKPGVQADMGSGDAWPEVRRRVLGADILLLATPIWLGHPSSVAQRALERLDAELSETDENGKPLTYGKVATVAIVGNEDGAHKVSADLFQALNDCGFTIPAGGATYWVGEAMGSTDYKDLDGAPDSVASTTKTLASNAVHLANLLRDAPYPA
>NZ_CP007155.1|WP_081789934.1|5109561_5110686_-|alpha/beta-hydrolase
MLVVTVLWAVLLSVAVLVYVLPLVPWQPWLLVSLLINPYGPYLVLAAVFGVLLAVLAGRHGARHSAVGSGLASAICVVLAVVPIAAVLGAAESRGVTISPWDYSAVKDNETFPDSRRSTTYATVDGQQLRLDVWQPQGEGSHPAVVWVHGGGFATGQRGEAAKWYQWLNQRGFAVFSIDYRLTPPARWRQAPGDVKCAVGWVRSNAERLHVDPNRLVLAGGSAGGNLALVAAYSAGDDRLPPSCPARDTSVRAVLALYPGTDPTDLSGSLTENAGDSLAYTGGDPNAEPLVKPMTFVSPTSPPTYLAAGTHDVVVRYEQSLKLDRVLTSSGVPHTLVGIPYADHIFDFRWGTYASQLARATMGEFLDSVPGLRR
>NZ_CP007155.1|WP_025357990.1|5122033_5123071_-|ATP-binding-protein
MTEPTRATGCLPTVQDEAWLPVEDPAAVGAVRRRVSALAQRLGFPPSRVAEIGIVATELATNLCKHAVRGVVLLRSVQADQPLVELLAVDSGPGMIDPETCLRDGQSTTGTLGIGLGAVTRLADSFAVLSEVGLGTGFATRFHATRHPVDPGTTAAGLTRALAHEPVCGDAYAVRQDGDQLTLMLCDGSGHGPMAATASQRAVAVFCEGDPCAPEVAVQRIHTALVGTRGGAVSVARIDQAAGTVRFAGIGNVVGSVLSEQGRRGMVSLPGIAGYQARTFRGFDYEAPPGSLVVLHSDGLTDRWSVDGRERLLAAPPLLVAGALLREAGVRRDDACVLVARVGQP
>NZ_CP007155.1|WP_025357991.1|5123076_5123490_-|ATP-binding-protein
MTAPTGERDELVIAGDEDVVRVRQVVRGFALRAKLSLVDQTKLVTAASELARNAVNYGGGGQAVVELVGNGRRVGVRARFADDGPGISDVELALTDGWTSGSGLGLGLSGARRLVDEFELETEVGRGTAVTITKWAR
>NZ_CP007155.1|WP_169743531.1|5123486_5123900_-|STAS-domain-containing-protein
MDRIPILKIGQVLLVSIQIDLQDQSVLALQEDLAEQISATGAHGVIIDISAVEIVDSFIGRMFATIAATSRLFDADTVVVGMRPAVAITLVELGLTLGQVRTALNLEKGLAILGKLAAERELAEGLDDLDEPVQANS
>NZ_CP007155.1|WP_030111315.1|5123899_5124757_-|STAS-domain-containing-protein
MSVDAGDTDSLAVLLSKDADVLIARWVALTSAPLRGKVSEAELTRECRELFDTLVAAVSTGSRDFQDPAFVEVRAALEELSRNRARLGFTPSETVVGVFALKRAMLETSGQRTGDTGLREVIEFTLLLDTLGLWTFECYARAREEVIAQQAEQLLELTTPVVRLWDGVLAVPLVGTLDSARTQVVMEKLLEALVETGAEQAIVDITGVLAVDTQVAQHLLKTVMAARLMGAECTISGIRPQIAQTIVELGIEFGDITTKASLADALLYAMRRSGVDVVRKRAQVG
>NZ_CP007155.1|WP_030111316.1|5124844_5125522_-|glycosyltransferase
MIRGVAVVVPARDEQDTIAACLDAIRVALPGEVRSAVCVVLDRCTDDTERIARRSAPWARLLVNRADLPLGTLRDLGARAALAALGVPARRSWLLSTDADSVVRPGWVRDHLAQAARGVCGYAGATEITDWAGHTERTRLRYLAVAGDPSREHVYGANLGVRADAYLAVGGFAALATGEDQDLWDRLRLAGHILVTGVAAPVLTSSRRHGRATGGVADLLAGLIS
>NZ_CP007155.1|WP_169743562.1|5125518_5126739_-|methyltransferase-domain-containing-protein
MFDPTGYRRVTAVAAHPDDETLGAGGVLRQLHELGASIRLVVASDGEAAFPELEAEDRAELGRRRRRELAEALAELGVHDAEVHWLGLPDSGLAHHEAELTERLRELLADADCCLLPWPGDPHPDHRAVAGAALAAAPVTAHRWSYPIWMWHWMSTTDPAIPWQRAHRVPLTDPVRQGKSAALRAFDSQLVRGPNGEPPILPPEVLAHFERDEEVLFREPRRESAPLARFSALYAADPDPWRTATSPYEQRKRALVLAALPRQHYEFAVEPACGAGALTRELAARCTRVDAFDPVAEAVAAARRHSGVAVRQATLPEGFGPERADLVVLSEILYYLSDDELDRTLDAVTEVLEPGGDLLLVHWRPWAPEAVRDGAAAHERVAARPGLVKVVSHVDDQFLLDVLRRR
>NZ_CP007155.1|WP_025357993.1|5127788_5127974_+|CsbD-family-protein
MSTGDKFENKAEELKGKAKEAAGNATGNEQLQAEGKADQAAGGLKQAGEKVKDAVKNVFNK
>NZ_CP007155.1|WP_025357994.1|5128058_5128511_-|hypothetical-protein
MSEPEASEQRRLARNLNELLQELRVAQTGVQVLFGFLLSLAFTERYAHADGFLHIVHITTVMLAAVAVCLLIAPVAWHRVLFRRGRREAVVNRGSVLTVLGLTALALAMAGAVLLIGYTIFGGLVGGLLSAAIALLYLLLWFGVPLWARR
>NZ_CP007155.1|WP_025357995.1|5128503_5130153_-|cytochrome-c-oxidase-subunit-I
MATSTAPTVLGFGRPPRGSALGEYFRTTDHKRIGMLYLATTFGFFLVGGVLALLMRTELAAPGLQFLSQEQYNQLFTMHGTIMLLLYATPNVFGFANLVLPIQIGSPDVAFPRLNALSYWLYLLGGLIVLAGFATPGGAADFGWFAYAPLNDLAHSPGVGGDLWAAGLIVSGLSSILGAVNMITTVVCLRAPGMTMFRMPIFTWNILFTSFLVLMAFPILTSALFGLEADRHLGAHVFDPANGGAILWQHLFWFFGHPEVYIVALPYFGIVSEIFPVFSRKPQFGYRGLVFATIAIAFLSVTVWAHHMFATGAVLLPFFSLTSYLIAVPTGIKFFNWIGTMWQGQLTFESPMLWSIGFLLTFLFGGLSGVLLASPVLNFHVTDSYFVIAHLHYVLFGTIVFSTFAGVYFWFPKFTGRMLDERLGRLHFWLTFVGFHTTFLVQHWLGAEGMPRRYGDYLPTDGFTTLNTISTIGSYVLGLSMLPFIWNVMRSYRFGERVTVDDPWGYGNALEWATSCPPPRHNFQALPRIRSERPAFDLHYPHVRSAARE
>NZ_CP007155.1|WP_025357996.1|5130152_5131943_-|thiamine-pyrophosphate-requiring-protein
MSETVGDYLLRRLRDWGVEQVFGYPGDGINGIVAAFGKAGDQPRFIQARHEEMAAFQAVGYAKFSGEVGVCMATSGPGAIHLLNGLYDAKLDHVPVVAIVGQTARSAMGGSYQQEVDLQSLFKDVASEYLVEVNVSEQLPNALDRAIRVAQAERAPTALIIPNDLQEEPYNPPRHVFKHVPSSPPSTVHSVTTADPAEIERAAEVLNAGERVAILVGQGARRAADQVVQVAELTGAGVAKALLGKDVLPDDLPFVTGSIGLLGSRPSYELMEGCDTLLIVGSNFPYSQFLPSFGKARGVQIDIDGKFIGMRYPTEVNLVGDAASTLDALIPLLERKSDRSWRERVERGVRRWWEVMEREAMVPADPINPMRITWELSARIPDNAIVTADSGSAANWYARTLRMRGNMRGSLSGTLATMGPGVPYAIGAKFAHPDRPAIALVGDGAMQMNGLAELITLKRYYPRFSDPRCVICVLHNNDLNQVTWELRAMGGAPKFEESQVLPDISYADFARSLGLGGVTVTDPERMGAAWDEALAADRPVLLDVHCDPNIPPIPPHATFEQIKSAAESVLKGDPDAWNLLTKGVRTKVQEFLPGRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_12

6136056-6136204

Orphan

Consensus_repeat	Method
GGACCACCCCCGCTCACGCGAGGAAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP007155_12

>merge|NZ_CP007155|12|6136056-6136204|CRISPRCasFinder
AGACCGCCCCCGCGTGCGCGGGGAAGACTGGATGCGCGAGCCGGTCGGCGTGTGGGGCGGCGGACCACCCCCGCTCACGCGAGGAAGACGATCGCTTTCGCGTCCTCCAGGGTGTCGCGCTGGGACCACCCCCGCTCACGCGAGGAAGA

>NZ_CP007155|12|11|6136056-6136204|CRISPRCasFinder
AGACCGCCCCCGCGTGCGCGGGGAAGA	CTGGATGCGCGAGCCGGTCGGCGTGTGGGGCGGC
GGACCACCCCCGCTCACGCGAGGAAGA	CGATCGCTTTCGCGTCCTCCAGGGTGTCGCGCTG
GGACCACCCCCGCTCACGCGAGGAAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025358842.1\|6133937_6134612_-\|M15-family-metallopeptidase	unknown	unknown	gnl\|CDD\|379247
NZ_CP007155.1\|WP_025358844.1\|6135042_6135753_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025358840.1\|6132004_6132403_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP007155.1\|WP_025358854.1\|6146385_6146817_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133382
NZ_CP007155.1\|WP_030110637.1\|6138772_6139690_+\|phosphoenolpyruvate-mutase	unknown	unknown	gnl\|CDD\|274077
NZ_CP007155.1\|WP_025358837.1\|6127048_6127435_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_148309681.1\|6125874_6126807_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP007155.1\|WP_081789538.1\|6137099_6137981_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223377
NZ_CP007155.1\|WP_148309683.1\|6131535_6131757_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_148309684.1\|6145803_6146145_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340394
NZ_CP007155.1\|WP_042220837.1\|6139788_6140937_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183341
NZ_CP007155.1\|WP_025358855.1\|6146813_6147542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_158510826.1\|6134658_6135030_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_030110635.1\|6129466_6130912_-\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341066
NZ_CP007155.1\|WP_025358852.1\|6144618_6145551_-\|phospholipase-D	unknown	unknown	gnl\|CDD\|176518
NZ_CP007155.1\|WP_148309682.1\|6127690_6127906_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025358841.1\|6132494_6133334_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187578
NZ_CP007155.1\|WP_025358845.1\|6136664_6137084_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP007155.1\|WP_025358851.1\|6142311_6144618_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227922
NZ_CP007155.1\|WP_025358850.1\|6141025_6142234_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025358842.1\|6133937_6134612_-\|M15-family-metallopeptidase	gnl\|CDD\|379247	pfam13539, Peptidase_M15_4, D-alanyl-D-alanine carboxypeptidase. This family resembles VanY, pfam02557, which is part of the peptidase M15 family.	1.04262e-06
NZ_CP007155.1\|WP_025358840.1\|6132004_6132403_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	5.11016e-28
NZ_CP007155.1\|WP_025358854.1\|6146385_6146817_+\|hypothetical-protein	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	0.000652107
NZ_CP007155.1\|WP_148309681.1\|6125874_6126807_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	6.89083e-12
NZ_CP007155.1\|WP_030110637.1\|6138772_6139690_+\|phosphoenolpyruvate-mutase	gnl\|CDD\|274077	TIGR02320, Phosphoenolpyruvate_phosphomutase, phosphoenolpyruvate mutase. This family consists of examples of phosphoenolpyruvate phosphomutase, an enzyme that creates a C-P bond as the first step in the biosynthesis of natural products including antibiotics like bialaphos and phosphonothricin in Streptomyces species, phosphonate-modified molecules such as the polysaccharide B of Bacteroides fragilis, the phosphonolipids of Tetrahymena pyroformis, the glycosylinositolphospholipids of Trypanosoma cruzi. This gene generally occurs in prokaryotic organisms adjacent to the gene for phosphonopyruvate decarboxylase (aepY). Since the PEP phosphomutase reaction favors the substrate PEP energetically, the decarboxylase is required to drive the reaction in the direction of phosphonate production. Most often an aminotansferase (aepZ) is also present which leads to the production of the most common phosphonate compound, 2-aminoethylphosphonate (AEP). A closely related enzyme, phosphonopyruvate hydrolase from Variovorax sp. Pal2, is excluded from this model.	1.39028e-137
NZ_CP007155.1\|WP_081789538.1\|6137099_6137981_+\|SDR-family-oxidoreductase	gnl\|CDD\|223377	COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only].	7.71973e-79
NZ_CP007155.1\|WP_042220837.1\|6139788_6140937_+\|hypothetical-protein	gnl\|CDD\|183341	PRK11858, aksA, trans-homoaconitate synthase; Reviewed.	4.21764e-150
NZ_CP007155.1\|WP_030110635.1\|6129466_6130912_-\|M1-family-metallopeptidase	gnl\|CDD\|341066	cd09603, M1_APN_like, Peptidase M1 family similar to aminopeptidase N catalytic domain. This family contains mostly bacterial and some archaeal M1 peptidases with smilarity to the catalytic domain of aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease belonging to the M1 gluzincin family. APN preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and, in higher eukaryotes, is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation, thus considered a marker of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. APNs are also present in many pathogenic bacteria and represent potential drug targets. Some APNs have been used commercially, such as one from Lactococcus lactis used in the food industry. APN also serves as a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs have also been extensively studied as putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	1.37371e-110
NZ_CP007155.1\|WP_025358852.1\|6144618_6145551_-\|phospholipase-D	gnl\|CDD\|176518	cd08576, GDPD_like_SMaseD_PLD, Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase-like domain (GDPD-like) present in sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.4) from spider venom, the Corynebacterium pseudotuberculosis Phospholipase D (PLD)-like protein from pathogenic bacteria, and the Ajellomyces capsulatus H143 PLD-like protein from ascomycetes. Spider SMases D and bacterial PLD proteins catalyze the Mg2+-dependent hydrolysis of sphingomyelin producing choline and ceramide 1-phosphate (C1P), which possess a number of biological functions, such as regulating cell proliferation and apoptosis, participating in inflammatory responses, and playing a key role in phagocytosis. In the presence of Mg2+, SMases D can function as lysophospholipase D and hydrolyze lysophosphatidylcholine (LPC) to choline and lysophosphatidic acid (LPA), which is a multifunctional phospholipid involved in platelet aggregation, endothelial hyperpermeability, and pro-inflammatory responses. Loxosceles spider venoms' SMases D are the principal toxins responsible for dermonecrosis and complement dependent haemolysis induced by spider venom. Due to amino acid substitutions at the entrance to the active-site pocket, some members lack activity. The typical GDPD domain consists of a TIM barrel and a small insertion domain named as the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. Although proteins in this family contain a non-typical GDPD domain which lacks the GDPD-I, their catalytic mechanisms are based on Mg2+-dependent acid-base reactions similar to GDPD proteins. They might be divergent members of the GDPD family. Moreover, this family does not belong to phospholipase D (PLD) superfamily, since it lacks the conserved HKD sequence motif that characterizes the catalytic center of the PLD superfamily. It belongs to the superfamily of PLC-like phosphodiesterases.	8.93054e-74
NZ_CP007155.1\|WP_148309684.1\|6145803_6146145_-\|hypothetical-protein	gnl\|CDD\|340394	cd16917, HATPase_UhpB-NarQ-NarX-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli UhpB, NarQ and NarX, and Bacillus subtilis YdfH, YhcY and YfiJ. This family includes the histidine kinase-like ATPase (HATPase) domains of various histidine kinases (HKs) of two-component signal transduction systems (TCSs) such as Escherichia coli UhpB, a HK of the UhpB-UhpA TCS, NarQ and NarX, HKs of the NarQ-NarP and NarX-NarL TCSs, respectively, and Bacillus YdfH, YhcY and YfiJ HKs, of the YdfH-YdfI, YhcY-YhcZ and YfiJ-YfiK TCSs, respectively. In addition, it includes Bacillus YxjM, ComP, LiaS and DesK, HKs of the YxjM-YxjML, ComP-ComA, LiaS-LiaR, DesR-DesK TCSs, respectively. Proteins having this HATPase domain have a histidine kinase dimerization and phosphoacceptor domain; some have accessory domains such as GAF, HAMP, PAS and MASE sensor domains.	5.56162e-24
NZ_CP007155.1\|WP_025358841.1\|6132494_6133334_+\|NAD(P)H-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.62592e-53
NZ_CP007155.1\|WP_025358845.1\|6136664_6137084_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	2.25256e-16
NZ_CP007155.1\|WP_025358851.1\|6142311_6144618_+\|hypothetical-protein	gnl\|CDD\|227922	COG5635, COG5635, Predicted NTPase (NACHT family) [Signal transduction mechanisms].	8.4893e-06
NZ_CP007155.1\|WP_025358850.1\|6141025_6142234_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.30884e-29

>NZ_CP007155.1|WP_025358844.1|6135042_6135753_-|hypothetical-protein
MFDEPVKGFGLDVEFDMSQKAAMLKDAQTYLESINVPETGGPGTDIGQPNSTTFSFETMLTHDVRITNLARNLRIRKSLIQCPLMWEIRKYNLDDPVADQLVKDHYQGTGISTKNDSSTGLGQIFAATAIRARNHCINQGIISGPIMDPGKESDLWPVWQNLHNDANYNISTIPLVLIEGAHAVGLGRPGLDFSEDDSRKTLARYNGTGDKAKQYGRQLIGLYRVFEKYNAALRRR
>NZ_CP007155.1|WP_158510826.1|6134658_6135030_-|hypothetical-protein
MSSTATPAVASRRWWVWPLMVVLNAVLGYFGVIPFGFLAGALGTAVGWAEPDPTMNDGVLVVVLTGAVLSMLVLAVFAAVNYPLARIGRAPARWYWPLSVLVLLIPVVVVQIWPHLWSLIRWY
>NZ_CP007155.1|WP_025358842.1|6133937_6134612_-|M15-family-metallopeptidase
MTKANNGLSRRTVLRSGAAAVAAVGLSTVFATTARATDSKPSASTAADQARARVLTGEHSANGWAIEKGADIGGSIWTRPIPGSPVTAALRIGDVAVVLVHVVRRFHYEIGTLNRGEVVGYKSPSTVTGYETNHASGTAVDIRPGWYPPGVRGGFLPHELTALRDVLGDCEGVVGWGGDRSHPDEGHFQIEVGPGDPRLAKVAAKIRGWNNSPGKGAGVLIAIS
>NZ_CP007155.1|WP_025358841.1|6132494_6133334_+|NAD(P)H-binding-protein
MIVVTGATGNVGRPLTQALAEAGQQVTAVSRHAAAVPDGVRHVAADLAEPAGLEPALTGAKALFLLLSGDLHAAGASPADIIGKAAASGVRRVVLLSSQGVATRPFGTTRIAMRALEDVLRESGLDWAILRPGGFASNALWWAESVRARQLVAAPFGDVGVPIIDPADIAEVAAACLLDDRHTGGVYELTGPEVITPREQAEAIAAALGSPVRFHELTREEAKAGMAQSMPAELADDTLDILGSPSPAEQRVSPDVQRVLGRAPRSFADWAARNVAAFR
>NZ_CP007155.1|WP_025358840.1|6132004_6132403_-|helix-turn-helix-transcriptional-regulator
MTGGVQFTQADTGARYEVFHTDCPARDVVDHVTSRWGIWVLISLQSNDLRFYELRESIQGISEKMLAQTLRALVQDGLVWRRVEPTTPPQVTYGLTEFGRDIGESLAELFGRITRRLSPRSAEQGRERRPGS
>NZ_CP007155.1|WP_148309683.1|6131535_6131757_+|hypothetical-protein
MAEAVDILAALAPDITATIRSAARKAFVILDGTPLPIDRIATDRRYYSGCEDVGVSPRSRFDPYSGWPSVPCV
>NZ_CP007155.1|WP_030110635.1|6129466_6130912_-|M1-family-metallopeptidase
MLLLTGPAATTATAATPSPGASGIGDPIWPTTGNGGYCVERQWLSFDFAADLGSYNATSRLRLRASQTLSQFDLDLLGPEVRAVEVDGKPAAWQTTPEGKLVITPPTPVREGATFTTTVTVFNTAPDLIKNPPTPENLHNGLFHMGDFIELHNQPAGARRVLAVDDHPSAKAPTSVAITTSGAVNSVANGRLASTTTAGDRTTRVFDEPRPLATELLQVGVGPFTVTHRRGPGGIDLRYALPSTQSATILPQLDTTFPAAIEFLERQLGPFPGRIAGTYATPTGGALETQGLTWLNSGQLTPEGFPRNGTDSIIAHEITHEWFGDSVSPARWSDLWLNEGHARFYEWQWDEAHGHSTVDEQMREAYRTHRSWLGKFGPIAAPDPASFNNSEGRPFASGAYEGGALALYALRQHVGAETFQRIERAWVTENHDKVADTSKFIGTASRVAGQDLGPFLRSWLYAAGTLPAMPGHLDWHADPTT
>NZ_CP007155.1|WP_148309682.1|6127690_6127906_+|hypothetical-protein
MTRCARGRPRARTPTPYRAPPPDGHTYLAFTDDGWARLYAPDGEYITDPVDQEWRTTAVDRREIMLVLTSP
>NZ_CP007155.1|WP_025358837.1|6127048_6127435_+|hypothetical-protein
MSSPYDQVREPCLPPQHPGSLPPDAEAARTALESLGKAADETWLAAYSDYNPLLDALASAHNVGIALGILIGLADLQAGFLIPGSEETRHRGQVGIEVVLGTRTIPAAALTRSLETAVDAGQVEADNP
>NZ_CP007155.1|WP_148309681.1|6125874_6126807_+|helix-turn-helix-transcriptional-regulator
MMLVEPDWGPARLAEHLRVTGNEIREALDTLVDLALMRESVERPGTLRPVDPHSALQALILRQQQDIQRQQQQMRESQLAFSRLVAEVAGRQPDTKSDKVETIIGLDNVHQRLERLSSEAESSVCTLAPAAMRSVELAGAALHNDRSALVRGVSIRTVFPDSVRTDETTLDYARRLTEFGGEVRTAPALPLRMLIVDATTALVPMDTSGPRKGAAVARLPGVITGLVALFEMIWTSSCPLGAECARDDGLTTQDRQILQLVSQGLTDAATGNRLGLSLRTVRRAMAGIMKRLGARSRFEAGMKASQRGWL
>NZ_CP007155.1|WP_025358845.1|6136664_6137084_-|winged-helix-turn-helix-transcriptional-regulator
MTAPDLTAAVAATYDIWMRTVDLTGPALARNRLTPATFQVLWAIDPDEPPPSMKVIAERLYCNAPNLTFMTNQLVDRGLVERAVDPADRRSRVLVLTAKGRRVRAEVVRATLEKTPLAALTDGELRQLIALLNRALHPG
>NZ_CP007155.1|WP_081789538.1|6137099_6137981_+|SDR-family-oxidoreductase
MLRDSKDRASVGTSRLELSEGPVRDGYRGVTALVTGASKGLGRAYALELARRGARVILLARSAGDLKRLAAQIREQHGGPDVEVIAADLAAADGPERILRELRDRGLTIDLLLNNAGAGSAGPFLDRPLEPQLSSVGLNVNGLLALTHAIGAELVARGRGGIINVSSTAAFQPMPYQASYAATKAFVLSFTEALAEELRGTGVHVMATHPGAIATGFFEGTSATINPAIADAPATVAARTLDDYARRRAVSYPGRGVTRAMTWPARLLPRTVVARATGALNRRLGLHEVVDLA
>NZ_CP007155.1|WP_030110637.1|6138772_6139690_+|phosphoenolpyruvate-mutase
MHIDSVTNDIRRARLGELVATRQCIRIIEAHNPISAIIAENASVSLGSSLGVEEFDGLWSSSLTDSTLHGLPDIEVLDPQTRLANIRDIFAVTTKPLIMDGDTGGKVEHFEFFVRNMELAGVSAVIIEDKTGLKRNSLLGTTVKQVSTDVGEFTAKIRRGKAAQRTPEFMIIARIESLILDLGMADALTRADAYVAAGADGIMIHSRKSNPGEVLEFAREFRRIHPSVVLISAPTTYNSIHAKELQSAGFNVIIYANHMLRAAVKAMQDVSMDILRHGRTAEAERRCVGLEHILHIGPASASTRN
>NZ_CP007155.1|WP_042220837.1|6139788_6140937_+|hypothetical-protein
MRDDIILEDTTLRDGEQAPGVAFSRDTKIAIFNALVDAGVRWIEAGIPAMGGQDVEAMKVMLERRDEVNLIGWNRGVLDDLKYTISLGFKAIHLGLPTSNIHLDKSVKKDRGWLLSTAQDMVKFAKDQGCFVSISAEDVGRTNLNFLQEYAGKVAEAGADRLRLSDTIGILDTAGYAERVAAVVAAADIDTQTHCHNDFGLAVANTLGGLQAGARYFHVTVNAIGERAGMPDLAQMVLALSQFHGKDLGIDTTKLVALSQLVAEACGTPIQPWQPVVGMNVFAHESGIHTKGMLSDANTFEPFMPELVGGTRRLVVGKHSGRAVIKHQLEQDGVEVNESVLGECLTQVRGYAIEHRGEVPATALRQIYRTALAGASSHKATQ
>NZ_CP007155.1|WP_025358850.1|6141025_6142234_+|MFS-transporter
MKLLPPPGPKRWLVVSWLIKNVGSGLYLPTSTLYFTRVAGFGVHEVALGLTVAGLVTFAGSLPLGVLADRFGPRRLYTMLLTTQFIVLAGLALVRSFPFFFCAITVFLLAEQGSTAARGALVATVGEGSERVQFRVYLRIVASIAVTIGAGLAALAIQADTTAAYTVLLLVTATTYLAAAAPLRGLPLETPAGSTTPRSRPTRVFRDGRYVVITFICGVLSLHAQVLSFAVPLWVTGHTTAPPVLVSVLVVVNTVLVIFLQARASKGAEDNPTAARLCRCAGLALLAACCVVAPTGSLPQWHAVALLLIFAVLLTAGELWTSGGSFGLSFTLAPDGAHGQYQGFFALGRGLATAVAPGLLTVLCLGSGYGWLILGLCFAGAGALAPLVVTGTRSAGRQDTRS
>NZ_CP007155.1|WP_025358851.1|6142311_6144618_+|hypothetical-protein
MPRHRPKYHNEISGHVEGHAIMAGTIDHLTLHDREAELEGRLFTARDRLIGSAAVLAVALVVRTAAPTVFPDALVIAVAAAGAGCVRFGFALAQSFARLRAFRKMDAAGTQARLNAALRLLVDQERSHANQELSLVDWTSTMPVRLATAPEGLGDHWANIHGSTGGSGPLDLDGTVEGVSEVFTRVPSGRLVVLGPAGAGKSVAAWLFVRGAPDDRAAVVVPVANWNAERGLQRWLVDELVDRCGELGAVEPDGRTRAEKLVLAGRVLPVFDGLDELPKPARPVFLRQLNKARSVLPQLVLTSRTAEYQGCGLVVSGAAAVELQHLSLADLTEYLSRTTSPVRDGGTKWDLLIGKLRPTNSRKQPHRLTRVLESPLMAYLAWVAYSDTEAAPEELLDRKRFANSEEVKAQLLDGFVDARFEGSAPQVKRWLAFLATHLDATGSTQIAWWRLWHAVPRWVLGIALAVPYAGTFAALMLGDFFGPTTDFVRQVSPLPSLAVMVVVQYLTAWKALTSEDATPVRLSAHSRGRRLLAVTATGLGYYLLVFIADRLGLFAYLTGGLPWFAISAVVGLGSVALTLLSEPGDAAVTVTPRVLLRTDRAAAWFGWCAMMPYQRDPLARSALFLLLPVIMTYVWLGGDWMTTQRWIVALGVTGAAMLWYGLLASAWGRFTVARLYLALTDRMPLSVMGFLAEAHRRGVLHQVGGAYEFRHDLLRARLLERAPEFGVAWYPSPQPRYQASVVLRGANVGFLVVCLLETLLAYTELGLR
>NZ_CP007155.1|WP_025358852.1|6144618_6145551_-|phospholipase-D
MAAVVAALGSVVLGAPTAVAAGQRPVYAIAHRVDTLDGVHAAIKHGANAIEIDMCSWWNPNEWRAYHDCSSAGENRRGPSVDSMFDLIVSEARAGRRLSLVWLDIKDPNYCGEQPNRTCAVAGLRDKAQKLTAAGIQVLYGFFEYHPGNTPDVGGRGWQSLQGRLGPLEGITTTGSLSTVQGVYAKHGSGLPNGHRAMDYGDSDIRKGFGNCTEASYNTCAELKKAAGYRDSGSLGATFSWTTDYNDPWYVDKLLGEAGVNGIIAGWAKDQVTEYNDTWQCSQSIAAIRDWVGKHGGTHRMANPGDRLFR
>NZ_CP007155.1|WP_148309684.1|6145803_6146145_-|hypothetical-protein
MVAVVLVGASTELPAELPGSIARAVYGMVCEYLVNTAKHAPGAEVTVTLYELAESVDVRVSNTAGEPTAPAPRSGFGLLGMRERVLLSGGSLSVGPTPAGGFAVSATYPKESR
>NZ_CP007155.1|WP_025358854.1|6146385_6146817_+|hypothetical-protein
MVRLLRIKRLADLGLPLPQVAQLGNADEHPEQALRVLDGELAATIEQLERTRTVVGRLLCHGTGIDLPRLLAQPLAEAGVTEADRLVSECGGVRYRSLLLVPFRDLFEVLTGPGTDTPPVITRRRLHGVPAMAEHATSPVKPL
>NZ_CP007155.1|WP_025358855.1|6146813_6147542_-|hypothetical-protein
MKVITTSERPDLKGGAMAPLYVGWPTFIRHDPVSRTHRRAVESYFPRFDVLLVDDAEVLARAVAVALRWDGTTDTLPDGYDGAVVTAVAEHESRVEPDTLCIVAATVRPDRTGGGLAGAALTALRDRAADAGLRRVIVPVRPTLKASYPLTSMADYLRWTREDGLHLDPWIRTHQRLGATILAPAPDSMVVSGTVAQWEEWTGMAFPQTGRYVIPGGLDLVEIDREHDQGLYRETDVWMRHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_13

6148517-6148858

Orphan

I-C,I-E,II-B

Consensus_repeat	Method
GGACCATCCCCGCGTGCGCGGGGAAGAC	CRT
GGGACCATCCCCGCGTGCGCGGGGAAGAC	CRISPRCasFinder
GGACCATCCCCGCGTGCGCGGGGAAGAC	PILER-CR

5 spacers

The CRISPR arrays of NZ_CP007155_13

>merge|NZ_CP007155|13|6148517-6148858|CRT,CRISPRCasFinder,PILER-CR
CGCGTGCACTCGGGTGCGCGGCGTCCTCGCCGTCCAGAGGTGATGACCGAGGCGAAGTCGGTCGCGGTCAGGACCATCCCCGCGTGCGCGGGGAAGACCGCAGGATCGGGGCGAACAACAACCCGATGTGGGGACCATCCCCGCGTGCGCGGGGAAGACGCCGCCTTGACGAACGTGAGGTTGTGGCGGCCGGGACCATCCCCGCGTGCGCGGGGAAGACTCCTGGTGCGGGTCCTTGTTAGCGCGATGACCGGGACCATCCCCGCGTGCGCGGGGAAGACCGACATCCAGGGGGCATTCGCCGTCGATCGCAGGGACCATCCCCGCGTGCGCGGGGAAGAC

>NZ_CP007155|13|2|6148517-6148858|CRT
CGCGTGCACTCGGGTGCGCGGCGTCCTC	GCCGTCCAGAGGTGATGACCGAGGCGAAGTCGGTCGCGGTCA
GGACCATCCCCGCGTGCGCGGGGAAGAC	CGCAGGATCGGGGCGAACAACAACCCGATGTGG
GGACCATCCCCGCGTGCGCGGGGAAGAC	GCCGCCTTGACGAACGTGAGGTTGTGGCGGCCG
GGACCATCCCCGCGTGCGCGGGGAAGAC	TCCTGGTGCGGGTCCTTGTTAGCGCGATGACCG
GGACCATCCCCGCGTGCGCGGGGAAGAC	CGACATCCAGGGGGCATTCGCCGTCGATCGCAG
GGACCATCCCCGCGTGCGCGGGGAAGAC

>NZ_CP007155|13|12|6148586-6148858|CRISPRCasFinder
AGGACCATCCCCGCGTGCGCGGGGAAGAC	CGCAGGATCGGGGCGAACAACAACCCGATGTG
GGGACCATCCCCGCGTGCGCGGGGAAGAC	GCCGCCTTGACGAACGTGAGGTTGTGGCGGCC
GGGACCATCCCCGCGTGCGCGGGGAAGAC	TCCTGGTGCGGGTCCTTGTTAGCGCGATGACC
GGGACCATCCCCGCGTGCGCGGGGAAGAC	CGACATCCAGGGGGCATTCGCCGTCGATCGCA
GGGACCATCCCCGCGTGCGCGGGGAAGAC

>NZ_CP007155|13|1|6148587-6148858|PILER-CR
GGACCATCCCCGCGTGCGCGGGGAAGAC	CGCAGGATCGGGGCGAACAACAACCCGATGTGG
GGACCATCCCCGCGTGCGCGGGGAAGAC	GCCGCCTTGACGAACGTGAGGTTGTGGCGGCCG
GGACCATCCCCGCGTGCGCGGGGAAGAC	TCCTGGTGCGGGTCCTTGTTAGCGCGATGACCG
GGACCATCCCCGCGTGCGCGGGGAAGAC	CGACATCCAGGGGGCATTCGCCGTCGATCGCAG
GGACCATCCCCGCGTGCGCGGGGAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025358863.1\|6157300_6158164_-\|dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|239204
NZ_CP007155.1\|WP_025358864.1\|6158213_6158732_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377443
NZ_CP007155.1\|WP_025358861.1\|6155211_6156525_-\|NtaA/DmoA-family-FMN-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|274819
NZ_CP007155.1\|WP_030110637.1\|6138772_6139690_+\|phosphoenolpyruvate-mutase	unknown	unknown	gnl\|CDD\|274077
NZ_CP007155.1\|WP_025358857.1\|6149496_6150621_+\|lactonase-family-protein	unknown	unknown	gnl\|CDD\|378416
NZ_CP007155.1\|WP_025358856.1\|6147927_6148491_+\|snapalysin-family-zinc-dependent-metalloprotease	unknown	unknown	gnl\|CDD\|280248
NZ_CP007155.1\|WP_042220837.1\|6139788_6140937_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183341
NZ_CP007155.1\|WP_081789538.1\|6137099_6137981_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223377
NZ_CP007155.1\|WP_025358855.1\|6146813_6147542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025358859.1\|6152268_6153858_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|223952
NZ_CP007155.1\|WP_158510828.1\|6159724_6159865_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025358858.1\|6150702_6152238_-\|salicylate-synthase	unknown	unknown	gnl\|CDD\|132533
NZ_CP007155.1\|WP_158510827.1\|6159093_6159279_+\|transposase	unknown	unknown	gnl\|CDD\|290319
NZ_CP007155.1\|WP_025358852.1\|6144618_6145551_-\|phospholipase-D	unknown	unknown	gnl\|CDD\|176518
NZ_CP007155.1\|WP_148309684.1\|6145803_6146145_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340394
NZ_CP007155.1\|WP_025358860.1\|6153854_6155186_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380456
NZ_CP007155.1\|WP_025358862.1\|6156521_6157301_-\|creatininase-family-protein	unknown	unknown	gnl\|CDD\|275241
NZ_CP007155.1\|WP_025358854.1\|6146385_6146817_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133382
NZ_CP007155.1\|WP_025358851.1\|6142311_6144618_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227922
NZ_CP007155.1\|WP_025358850.1\|6141025_6142234_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025358863.1\|6157300_6158164_-\|dihydroorotate-dehydrogenase	gnl\|CDD\|239204	cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass its homodimeric interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue.	1.83179e-58
NZ_CP007155.1\|WP_025358864.1\|6158213_6158732_-\|hypothetical-protein	gnl\|CDD\|377443	pfam05014, Nuc_deoxyrib_tr, Nucleoside 2-deoxyribosyltransferase. Nucleoside 2-deoxyribosyltransferase EC:2.4.2.6 catalyzes the cleavage of the glycosidic bonds of 2`-deoxyribonucleosides.	0.00320327
NZ_CP007155.1\|WP_025358861.1\|6155211_6156525_-\|NtaA/DmoA-family-FMN-dependent-monooxygenase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	1.40596e-141
NZ_CP007155.1\|WP_030110637.1\|6138772_6139690_+\|phosphoenolpyruvate-mutase	gnl\|CDD\|274077	TIGR02320, Phosphoenolpyruvate_phosphomutase, phosphoenolpyruvate mutase. This family consists of examples of phosphoenolpyruvate phosphomutase, an enzyme that creates a C-P bond as the first step in the biosynthesis of natural products including antibiotics like bialaphos and phosphonothricin in Streptomyces species, phosphonate-modified molecules such as the polysaccharide B of Bacteroides fragilis, the phosphonolipids of Tetrahymena pyroformis, the glycosylinositolphospholipids of Trypanosoma cruzi. This gene generally occurs in prokaryotic organisms adjacent to the gene for phosphonopyruvate decarboxylase (aepY). Since the PEP phosphomutase reaction favors the substrate PEP energetically, the decarboxylase is required to drive the reaction in the direction of phosphonate production. Most often an aminotansferase (aepZ) is also present which leads to the production of the most common phosphonate compound, 2-aminoethylphosphonate (AEP). A closely related enzyme, phosphonopyruvate hydrolase from Variovorax sp. Pal2, is excluded from this model.	1.39028e-137
NZ_CP007155.1\|WP_025358858.1\|6150702_6152238_-\|salicylate-synthase	gnl\|CDD\|132533	TIGR03494, Isochorismate_synthase/isochorismate_lyase, salicylate synthase. Members of this protein family are salicylate synthases, bifunctional enzymes that make salicylate, in two steps, from chorismate. Members are homologous to anthranilate synthase component I from Trp biosynthesis. Members typically are found in gene regions associated with siderophore or other secondary metabolite biosynthesis.	3.71101e-131
NZ_CP007155.1\|WP_025358857.1\|6149496_6150621_+\|lactonase-family-protein	gnl\|CDD\|378416	pfam10282, Lactonase, Lactonase, 7-bladed beta-propeller. This entry contains bacterial 6-phosphogluconolactonases (6PGL)YbhE-type (EC:3.1.1.31) which hydrolyze 6-phosphogluconolactone to 6-phosphogluconate. The entry also contains the fungal muconate lactonising enzyme carboxy-cis,cis-muconate cyclase (EC:5.5.1.5) and muconate cycloisomerase (EC:5.5.1.1), which convert cis,cis-muconates to muconolactones and vice versa as part of the microbial beta-ketoadipate pathway. Structures of proteins in this family have revealed a 7-bladed beta-propeller fold.	1.28249e-134
NZ_CP007155.1\|WP_025358856.1\|6147927_6148491_+\|snapalysin-family-zinc-dependent-metalloprotease	gnl\|CDD\|280248	pfam02031, Peptidase_M7, Streptomyces extracellular neutral proteinase (M7) family.	6.17732e-58
NZ_CP007155.1\|WP_042220837.1\|6139788_6140937_+\|hypothetical-protein	gnl\|CDD\|183341	PRK11858, aksA, trans-homoaconitate synthase; Reviewed.	4.21764e-150
NZ_CP007155.1\|WP_081789538.1\|6137099_6137981_+\|SDR-family-oxidoreductase	gnl\|CDD\|223377	COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only].	7.71973e-79
NZ_CP007155.1\|WP_025358859.1\|6152268_6153858_-\|AMP-binding-protein	gnl\|CDD\|223952	COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	0
NZ_CP007155.1\|WP_158510827.1\|6159093_6159279_+\|transposase	gnl\|CDD\|290319	pfam13586, DDE_Tnp_1_2, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	4.97232e-06
NZ_CP007155.1\|WP_025358852.1\|6144618_6145551_-\|phospholipase-D	gnl\|CDD\|176518	cd08576, GDPD_like_SMaseD_PLD, Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase-like domain (GDPD-like) present in sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.4) from spider venom, the Corynebacterium pseudotuberculosis Phospholipase D (PLD)-like protein from pathogenic bacteria, and the Ajellomyces capsulatus H143 PLD-like protein from ascomycetes. Spider SMases D and bacterial PLD proteins catalyze the Mg2+-dependent hydrolysis of sphingomyelin producing choline and ceramide 1-phosphate (C1P), which possess a number of biological functions, such as regulating cell proliferation and apoptosis, participating in inflammatory responses, and playing a key role in phagocytosis. In the presence of Mg2+, SMases D can function as lysophospholipase D and hydrolyze lysophosphatidylcholine (LPC) to choline and lysophosphatidic acid (LPA), which is a multifunctional phospholipid involved in platelet aggregation, endothelial hyperpermeability, and pro-inflammatory responses. Loxosceles spider venoms' SMases D are the principal toxins responsible for dermonecrosis and complement dependent haemolysis induced by spider venom. Due to amino acid substitutions at the entrance to the active-site pocket, some members lack activity. The typical GDPD domain consists of a TIM barrel and a small insertion domain named as the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. Although proteins in this family contain a non-typical GDPD domain which lacks the GDPD-I, their catalytic mechanisms are based on Mg2+-dependent acid-base reactions similar to GDPD proteins. They might be divergent members of the GDPD family. Moreover, this family does not belong to phospholipase D (PLD) superfamily, since it lacks the conserved HKD sequence motif that characterizes the catalytic center of the PLD superfamily. It belongs to the superfamily of PLC-like phosphodiesterases.	8.93054e-74
NZ_CP007155.1\|WP_148309684.1\|6145803_6146145_-\|hypothetical-protein	gnl\|CDD\|340394	cd16917, HATPase_UhpB-NarQ-NarX-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli UhpB, NarQ and NarX, and Bacillus subtilis YdfH, YhcY and YfiJ. This family includes the histidine kinase-like ATPase (HATPase) domains of various histidine kinases (HKs) of two-component signal transduction systems (TCSs) such as Escherichia coli UhpB, a HK of the UhpB-UhpA TCS, NarQ and NarX, HKs of the NarQ-NarP and NarX-NarL TCSs, respectively, and Bacillus YdfH, YhcY and YfiJ HKs, of the YdfH-YdfI, YhcY-YhcZ and YfiJ-YfiK TCSs, respectively. In addition, it includes Bacillus YxjM, ComP, LiaS and DesK, HKs of the YxjM-YxjML, ComP-ComA, LiaS-LiaR, DesR-DesK TCSs, respectively. Proteins having this HATPase domain have a histidine kinase dimerization and phosphoacceptor domain; some have accessory domains such as GAF, HAMP, PAS and MASE sensor domains.	5.56162e-24
NZ_CP007155.1\|WP_025358860.1\|6153854_6155186_-\|hypothetical-protein	gnl\|CDD\|380456	cd19533, starter-C_NRPS, Starter Condensation domains, found in the first module of nonribosomal peptide synthetases (NRPSs). Condensation (C) domains of nonribosomal peptide synthetases (NRPSs) catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. While standard C-domains catalyze peptide bond formation between two amino acids, an initial, ('starter') C-domain may instead acylate an amino acid with a fatty acid. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). There are various subtypes of C-domains such as the LCL-type which catalyzes peptide bond formation between two L-amino acids, the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity.	8.46632e-115
NZ_CP007155.1\|WP_025358862.1\|6156521_6157301_-\|creatininase-family-protein	gnl\|CDD\|275241	TIGR04448, creatininase, creatininase. Members of this family are creatininase (EC 3.5.2.10), an amidohydrolase that interconverts creatinine + H(2)O with creatine. It should not be confused with creatinase (EC 3.5.3.3), which hydrolyzes creatine to sarcosine plus urea. [Central intermediary metabolism, Nitrogen metabolism].	5.1036e-65
NZ_CP007155.1\|WP_025358854.1\|6146385_6146817_+\|hypothetical-protein	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	0.000652107
NZ_CP007155.1\|WP_025358851.1\|6142311_6144618_+\|hypothetical-protein	gnl\|CDD\|227922	COG5635, COG5635, Predicted NTPase (NACHT family) [Signal transduction mechanisms].	8.4893e-06
NZ_CP007155.1\|WP_025358850.1\|6141025_6142234_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.30884e-29

>NZ_CP007155.1|WP_025358856.1|6147927_6148491_+|snapalysin-family-zinc-dependent-metalloprotease
MSLRTLAIGAASVALLATPLLAPTAVAATDSSALRTTTVYYDTSGAPTFRDAIRAGAANWNAAVRNVQLKESSSGATLRYTEGNDSRGSYANTNGHGRGTIFIDYTQAKQYDKVRITAHETGHALGLPDHYSGPCSELMSGGGPGTSCHNSRPNSAEAARVEQNWANGLTVDYAPSRIYADSFPVLR
>NZ_CP007155.1|WP_025358855.1|6146813_6147542_-|hypothetical-protein
MKVITTSERPDLKGGAMAPLYVGWPTFIRHDPVSRTHRRAVESYFPRFDVLLVDDAEVLARAVAVALRWDGTTDTLPDGYDGAVVTAVAEHESRVEPDTLCIVAATVRPDRTGGGLAGAALTALRDRAADAGLRRVIVPVRPTLKASYPLTSMADYLRWTREDGLHLDPWIRTHQRLGATILAPAPDSMVVSGTVAQWEEWTGMAFPQTGRYVIPGGLDLVEIDREHDQGLYRETDVWMRHA
>NZ_CP007155.1|WP_025358854.1|6146385_6146817_+|hypothetical-protein
MVRLLRIKRLADLGLPLPQVAQLGNADEHPEQALRVLDGELAATIEQLERTRTVVGRLLCHGTGIDLPRLLAQPLAEAGVTEADRLVSECGGVRYRSLLLVPFRDLFEVLTGPGTDTPPVITRRRLHGVPAMAEHATSPVKPL
>NZ_CP007155.1|WP_148309684.1|6145803_6146145_-|hypothetical-protein
MVAVVLVGASTELPAELPGSIARAVYGMVCEYLVNTAKHAPGAEVTVTLYELAESVDVRVSNTAGEPTAPAPRSGFGLLGMRERVLLSGGSLSVGPTPAGGFAVSATYPKESR
>NZ_CP007155.1|WP_025358852.1|6144618_6145551_-|phospholipase-D
MAAVVAALGSVVLGAPTAVAAGQRPVYAIAHRVDTLDGVHAAIKHGANAIEIDMCSWWNPNEWRAYHDCSSAGENRRGPSVDSMFDLIVSEARAGRRLSLVWLDIKDPNYCGEQPNRTCAVAGLRDKAQKLTAAGIQVLYGFFEYHPGNTPDVGGRGWQSLQGRLGPLEGITTTGSLSTVQGVYAKHGSGLPNGHRAMDYGDSDIRKGFGNCTEASYNTCAELKKAAGYRDSGSLGATFSWTTDYNDPWYVDKLLGEAGVNGIIAGWAKDQVTEYNDTWQCSQSIAAIRDWVGKHGGTHRMANPGDRLFR
>NZ_CP007155.1|WP_025358851.1|6142311_6144618_+|hypothetical-protein
MPRHRPKYHNEISGHVEGHAIMAGTIDHLTLHDREAELEGRLFTARDRLIGSAAVLAVALVVRTAAPTVFPDALVIAVAAAGAGCVRFGFALAQSFARLRAFRKMDAAGTQARLNAALRLLVDQERSHANQELSLVDWTSTMPVRLATAPEGLGDHWANIHGSTGGSGPLDLDGTVEGVSEVFTRVPSGRLVVLGPAGAGKSVAAWLFVRGAPDDRAAVVVPVANWNAERGLQRWLVDELVDRCGELGAVEPDGRTRAEKLVLAGRVLPVFDGLDELPKPARPVFLRQLNKARSVLPQLVLTSRTAEYQGCGLVVSGAAAVELQHLSLADLTEYLSRTTSPVRDGGTKWDLLIGKLRPTNSRKQPHRLTRVLESPLMAYLAWVAYSDTEAAPEELLDRKRFANSEEVKAQLLDGFVDARFEGSAPQVKRWLAFLATHLDATGSTQIAWWRLWHAVPRWVLGIALAVPYAGTFAALMLGDFFGPTTDFVRQVSPLPSLAVMVVVQYLTAWKALTSEDATPVRLSAHSRGRRLLAVTATGLGYYLLVFIADRLGLFAYLTGGLPWFAISAVVGLGSVALTLLSEPGDAAVTVTPRVLLRTDRAAAWFGWCAMMPYQRDPLARSALFLLLPVIMTYVWLGGDWMTTQRWIVALGVTGAAMLWYGLLASAWGRFTVARLYLALTDRMPLSVMGFLAEAHRRGVLHQVGGAYEFRHDLLRARLLERAPEFGVAWYPSPQPRYQASVVLRGANVGFLVVCLLETLLAYTELGLR
>NZ_CP007155.1|WP_025358850.1|6141025_6142234_+|MFS-transporter
MKLLPPPGPKRWLVVSWLIKNVGSGLYLPTSTLYFTRVAGFGVHEVALGLTVAGLVTFAGSLPLGVLADRFGPRRLYTMLLTTQFIVLAGLALVRSFPFFFCAITVFLLAEQGSTAARGALVATVGEGSERVQFRVYLRIVASIAVTIGAGLAALAIQADTTAAYTVLLLVTATTYLAAAAPLRGLPLETPAGSTTPRSRPTRVFRDGRYVVITFICGVLSLHAQVLSFAVPLWVTGHTTAPPVLVSVLVVVNTVLVIFLQARASKGAEDNPTAARLCRCAGLALLAACCVVAPTGSLPQWHAVALLLIFAVLLTAGELWTSGGSFGLSFTLAPDGAHGQYQGFFALGRGLATAVAPGLLTVLCLGSGYGWLILGLCFAGAGALAPLVVTGTRSAGRQDTRS
>NZ_CP007155.1|WP_042220837.1|6139788_6140937_+|hypothetical-protein
MRDDIILEDTTLRDGEQAPGVAFSRDTKIAIFNALVDAGVRWIEAGIPAMGGQDVEAMKVMLERRDEVNLIGWNRGVLDDLKYTISLGFKAIHLGLPTSNIHLDKSVKKDRGWLLSTAQDMVKFAKDQGCFVSISAEDVGRTNLNFLQEYAGKVAEAGADRLRLSDTIGILDTAGYAERVAAVVAAADIDTQTHCHNDFGLAVANTLGGLQAGARYFHVTVNAIGERAGMPDLAQMVLALSQFHGKDLGIDTTKLVALSQLVAEACGTPIQPWQPVVGMNVFAHESGIHTKGMLSDANTFEPFMPELVGGTRRLVVGKHSGRAVIKHQLEQDGVEVNESVLGECLTQVRGYAIEHRGEVPATALRQIYRTALAGASSHKATQ
>NZ_CP007155.1|WP_030110637.1|6138772_6139690_+|phosphoenolpyruvate-mutase
MHIDSVTNDIRRARLGELVATRQCIRIIEAHNPISAIIAENASVSLGSSLGVEEFDGLWSSSLTDSTLHGLPDIEVLDPQTRLANIRDIFAVTTKPLIMDGDTGGKVEHFEFFVRNMELAGVSAVIIEDKTGLKRNSLLGTTVKQVSTDVGEFTAKIRRGKAAQRTPEFMIIARIESLILDLGMADALTRADAYVAAGADGIMIHSRKSNPGEVLEFAREFRRIHPSVVLISAPTTYNSIHAKELQSAGFNVIIYANHMLRAAVKAMQDVSMDILRHGRTAEAERRCVGLEHILHIGPASASTRN
>NZ_CP007155.1|WP_081789538.1|6137099_6137981_+|SDR-family-oxidoreductase
MLRDSKDRASVGTSRLELSEGPVRDGYRGVTALVTGASKGLGRAYALELARRGARVILLARSAGDLKRLAAQIREQHGGPDVEVIAADLAAADGPERILRELRDRGLTIDLLLNNAGAGSAGPFLDRPLEPQLSSVGLNVNGLLALTHAIGAELVARGRGGIINVSSTAAFQPMPYQASYAATKAFVLSFTEALAEELRGTGVHVMATHPGAIATGFFEGTSATINPAIADAPATVAARTLDDYARRRAVSYPGRGVTRAMTWPARLLPRTVVARATGALNRRLGLHEVVDLA
>NZ_CP007155.1|WP_025358857.1|6149496_6150621_+|lactonase-family-protein
MAAGPEIARTRFGRRPFLGMVGLAVSARPAGGVAAYIGNFTKAIGLARLGDTGTLTATGTVNGLDNPAFLTLAARGTTLYAVNDTDSGRVTALAVGAGGGLTVLGGQPTGGAMPTHLTIHPSGRFLLVANYGAGSTAVFPINSDGTLGARTDLVQYTGSGPDPTRQDGPHAHMVAFDPAGRYLYVPDLGTDQVHVHALDLGTGRLRSIGDTALPSGAGPRHLAFHPTTPAVYVADELDSTVAVCAQDPTSGLLTPGQVLPAAPPGGARNYPAEILVSQDGRFVYVSNRGHNSVAVFAIEADGRRLRAVGTTPCGGNWPRHITIDRSGRFLFASNQYSNSVTAFSVDQATGRLSPIGRPLSTPSPVCLLLGQPVP
>NZ_CP007155.1|WP_025358858.1|6150702_6152238_-|salicylate-synthase
MSVQRYHESVVPTSNDPLLVMAALARTFHAEDHIVYENTSGYTFALGRLAEVTVDRDCVLVRHNGVESREPWTDSPYPVLDRVLAGLPVADWRAYGVADFELSYVGGDLHGTLGDRPLLRLVVPEAEVSLRAGQAAVRAVDRERLDRILGLLSGTVPDQVVESMPVAVEQEGVAEYARAVNRAIRDINEGKLQKVILSRVVPVPAAVDLVATYVEGRRNNTPVRSFLIRLAGQEAVGFSPEIVVEVDAQRQVTAQPLAGTRALHRDAEQNARVRAELLADSKEIFEHAISVKVAHDELAAVCGAQAPLIAEFMAVKERGSVQHLGSEVRAELPEDKGVWDAFAALFPAVTVSGVPKDAAYRCIREYESGPRGWYGGAVLAVGQDGSLDAALVLRTVFRANDRTWLCAGAGIVAQSTAAREVQETSEKLRSVALHVVPAVSDDRLDMRRAIADHLGVDPGEVGDHEDLMMRGLSSLAVMTLANSWSSNGSIVRYTDLLERPTLAYWSSLVKR
>NZ_CP007155.1|WP_025358859.1|6152268_6153858_-|AMP-binding-protein
MMEGFVSWPAELAERYRHEGYWRGEVLGDIPRRTARGHGDRIALVDERRSWTYAELDDEADRMAAGLRQLGIQAGDRIVVQLPNVGEFVVLCLAAYRAGVIPVLALPGHRRSEIAYLCELSGAVGYVIPSRHGGFDFLGLAREVVAEVPRVRHVLVLGDSGEFTALASVTAEPEPLPALDPAGVAMLLLSGGTTGLPKLIPRTHDDYAYNVRASAELCAVDENTSYLVVLPVSHNFAWGCPGVLGVLRSGGKVVLAGNGSPAEVFPLVQREQVSMVALVPPLLALWSDARYRFDADLSSLRLLQVGGSKLAEPQAREALGTFGCTLQQVFGMAEGLLNFTHLDDPEDVVVTTQGRPLSPADEVLVADQDRSGRGELLTRGPYTLRGYYRAAEHNRFAFTPEGYYRTGDLVRLTAEGNLVVEGRIKDQINRGGEKIAAAEIEGHLAEHPSIQEAAVVGAADPVLGETICAFVRVSGPAPSLAEIRRFVQARGVAAYKAPDSVEVVDSWPLTSVGKIDKKALARSLAERGR
>NZ_CP007155.1|WP_025358860.1|6153854_6155186_-|hypothetical-protein
MRRPTVELLELTGAQQGIWQELADRPHSPAFNSAEYVELTGDLDLAAFLLAVDQVVEEAEAMRVAFVQTPDGPRQKICSPEDQPLGFVDLSGCADPHAEALSRMRADLDQKVDLINGPLASQLLFRLGEQQFIWYQRVHTLLVDGFSLSKMTSRVTDRYVALTTGAEERAPVFRPLGDLLASEAAYRSSDRFTADRTFWTQQLAAQPRPFSLSTAWPSVASETFLRASVVLPPALMSLVRRAERALGANWPVLFTSCAAAYLSAAREAEAVVLGLFATGRYGTDAANVPAMVSNVLPLHLAVLRTWTTERYVAQVLESMVRVLGHQRFRQEEMRHCREPGEVSAPLYGPLVNIMPFPREFEFAGVRGRTHNLSTGPIDDLMLAVWEVQDSSGETTLAVNVDTNPELYSQNETTGHAEGIAAFLEAFVSADSSARLSDVLGMVV
>NZ_CP007155.1|WP_025358861.1|6155211_6156525_-|NtaA/DmoA-family-FMN-dependent-monooxygenase
MTRKFHLAFIFDFAADEWQGPFGNGGSPWNGKFHTEVAVALERACFDFVVVEDKLMVPESYGGSRQAALSQAMIVPKHDPVPLAVSMGLATSRLGIVTTLSTLAYPPFMTARLASTMDNMLGGRYGWNIVTSAEDLAAQNFGMKKLPPRQERYERAEEYVQVVRALFESWDKDAVVLDRDNGIYADHTKVRPINFEGKYFSVRGPLNTVPSPQHRPAFVQAGASPQGRDFAARNADSIIAIANGVQSMKDFRDDIRLRAEKADRDPDEIKVLFCVTPTLGDTERDAQDKQQRMVSSTRFVKDILAQMSALTEIDFAQFDVDKPLPHRLETNGEKGTLDKFQQWGSGKTLRELVIDGAGGLVSSVPLVGTPDQVAERMGEVMEQVGGDGFMLTTPLLRMNRRYIAEVTDGLVPALQRRGLTRAAYTAGHTLRENLLEF
>NZ_CP007155.1|WP_025358862.1|6156521_6157301_-|creatininase-family-protein
MPRELADLTSAQVLDRVAGGTVVWPLGATEQHGPHLPLSVDSVLAEAFAGPIAEAFQGFTLPVQAIAARSLPQSGGGLSFPGTVHVGGDTLVRFLREALQSLFRLPLGRLVVVNGHFENEPFLFEALDQVRQEGLIGDREVFAFSWWSLVQDSWLATETTDFPGWHAEHAGVTETSLMLHLRPDLVTDLRPDHDRPPRAGVYLHPVDVDQITEQGVLSSTSGSSAELGEKLFSHVIEQAVAMIRDGAGLLSRKAGKKEQ
>NZ_CP007155.1|WP_025358863.1|6157300_6158164_-|dihydroorotate-dehydrogenase
MPDFRILGLRTTNPVIVGSGLLTDQTSNIRKLLARGAGAVITKTIHPSPPQGLDERIVRLPVGMLNSTTYSKRPVGYWLKMLRACAEEGLPVIANVHADTPAELGALAHEVEATGCPALELGISCINEEAGADEDADRVYAYTVETRRRVAIPFSVKLAVGEGLAGRVHAAVEAGADAITLSDTIPGAAVSPRTGELELDGVFGYSGPGIKPLVLAAIWGLRKRGFDLPIMGSGGVASGRDVVDYLQAGADVVQVYTALHTDMYATLDAIVTGAEHILADTGVRVSS
>NZ_CP007155.1|WP_025358864.1|6158213_6158732_-|hypothetical-protein
MLAGLNVFVGGPIQHAILEDSFFVPLQEAIEAAIGTVRDHGGEVFSAHVVEKFGLDTAAYTPKDVSARDFQWMKACDVFVPVLPALPDGTLYRTDGTHIELGWATALERPVVLITEQPFAEGASHLLKGLNWVGRVQAIDFTTFTENPALLVDAVLAAVRPQREAAEVGMTA
>NZ_CP007155.1|WP_158510827.1|6159093_6159279_+|transposase
MRARDDLCRHRWSVERSLAWLLGCHRLPPRYERNPRNYLAFLTLAAALVSFTLVGVMPFGG
>NZ_CP007155.1|WP_158510828.1|6159724_6159865_+|hypothetical-protein
MLRCTVLANRAFKVSKQYLADINHCLGFATVRRHSVVDRELDGLRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_14

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_14

6803553-6803713

Orphan

Consensus_repeat	Method
CCGACACACCATCCCGCAACGTCCGACAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP007155_14

>merge|NZ_CP007155|14|6803553-6803713|CRISPRCasFinder
GGGACACACCGCACCGGAACGCCGAACACGCCGCACCGGAACGTCCGACACGCACCCCCGGAACCACCGACACACCATCCCGCAACGTCCGACACACCACCCCAGAACACCGAACACGCGACACCCCAACGTCCGACACACCGCACCCCAACCGCCGACAC

>NZ_CP007155|14|13|6803553-6803713|CRISPRCasFinder
GGGACACACCGCACCGGAACGCCGAACAC	GCCGCACCGGAACGTCCGACACGCACCCCCGGAACCA
CCGACACACCATCCCGCAACGTCCGACAC	ACCACCCCAGAACACCGAACACGCGACACCCCAACGT
CCGACACACCGCACCCCAACCGCCGACAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025359372.1\|6800981_6802103_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|224090
NZ_CP007155.1\|WP_025359378.1\|6808453_6810361_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|223540
NZ_CP007155.1\|WP_025359381.1\|6814000_6816142_-\|putative-baseplate-assembly-protein	unknown	unknown	gnl\|CDD\|274051
NZ_CP007155.1\|WP_025359374.1\|6804143_6805082_-\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143588
NZ_CP007155.1\|WP_025359371.1\|6800271_6800862_-\|C39-family-peptidase	unknown	unknown	gnl\|CDD\|372083
NZ_CP007155.1\|WP_025359367.1\|6798007_6798427_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359380.1\|6811979_6814001_-\|phage-tail-protein-I	unknown	unknown	gnl\|CDD\|274050
NZ_CP007155.1\|WP_025359362.1\|6793135_6793780_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP007155.1\|WP_025359377.1\|6807173_6808457_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359370.1\|6799474_6800266_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_042220947.1\|6805099_6805792_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226156
NZ_CP007155.1\|WP_025359363.1\|6793880_6795365_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NZ_CP007155.1\|WP_025359365.1\|6796397_6797252_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359379.1\|6810429_6811983_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237057
NZ_CP007155.1\|WP_052360497.1\|6802107_6802935_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|367155
NZ_CP007155.1\|WP_025359383.1\|6816614_6817826_+\|DUF4157-domain-containing-protein	unknown	unknown	gnl\|CDD\|379338
NZ_CP007155.1\|WP_025359376.1\|6805827_6807177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359382.1\|6816161_6816548_-\|GPW/gp25-family-protein	unknown	unknown	gnl\|CDD\|377431
NZ_CP007155.1\|WP_025359368.1\|6798404_6798866_-\|heme-degrading-domain-containing-protein	unknown	unknown	gnl\|CDD\|179430
NZ_CP007155.1\|WP_030109226.1\|6798979_6799426_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025359372.1\|6800981_6802103_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	2.03884e-133
NZ_CP007155.1\|WP_025359379.1\|6810429_6811983_-\|hypothetical-protein	gnl\|CDD\|237057	PRK12323, PRK12323, DNA polymerase III subunit gamma/tau.	0.00295743
NZ_CP007155.1\|WP_025359382.1\|6816161_6816548_-\|GPW/gp25-family-protein	gnl\|CDD\|377431	pfam04965, GPW_gp25, Gene 25-like lysozyme. This family includes the phage protein Gene 25 from T4 which is a structural component of the outer wedge of the baseplate that has acidic lysozyme activity. The family also includes relatives from bacteria that are also presumably lysozymes.	1.51895e-25
NZ_CP007155.1\|WP_025359374.1\|6804143_6805082_-\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143588	cd07564, nitrilases_CHs, Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases). Nitrilases (nitrile aminohydrolases, EC:3.5.5.1) hydrolyze nitriles (RCN) to ammonia and the corresponding carboxylic acid. Most nitrilases prefer aromatic nitriles, some prefer arylacetonitriles and others aliphatic nitriles. This group includes the nitrilase cyanide dihydratase (CDH), which hydrolyzes inorganic cyanide (HCN) to produce formate. It also includes cyanide hydratase (CH), which hydrolyzes HCN to formamide. This group includes four Arabidopsis thaliana nitrilases (Ath)NIT1-4. AthNIT1-3 have a strong substrate preference for phenylpropionitrile (PPN) and other nitriles which may originate from the breakdown of glucosinolates. The product of PPN hydrolysis, phenylacetic acid has auxin activity. AthNIT1-3 can also convert indoacetonitrile to indole-3-acetic acid (IAA, auxin), but with a lower affinity and velocity. From their expression patterns, it has been speculated that NIT3 may produce IAA during the early stages of germination, and that NIT3 may produce IAA during embryo development and maturation. AthNIT4 has a strong substrate specificity for the nitrile, beta-cyano-L-alanine (Ala(CN)), an intermediate of cyanide detoxification. AthNIT4 has both a nitrilase activity and a nitrile hydratase (NHase) activity, which generate aspartic acid and asparagine respectively from Ala(CN). NHase catalyzes the hydration of nitriles to their corresponding amides. This subgroup belongs to a larger nitrilase superfamily comprised of belong to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 1.	4.97985e-113
NZ_CP007155.1\|WP_025359371.1\|6800271_6800862_-\|C39-family-peptidase	gnl\|CDD\|372083	pfam12385, Peptidase_C70, Papain-like cysteine protease AvrRpt2. This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes. Papain-like cysteine proteases play a crucial role in plant-pathogen/pest interactions. On entering the host they act on non-self substrates, thereby manipulating the host to evade proteolysis. AvrRpt2 from Pseudomonas syringae pv. tomato DC3000 triggers resistance to P. syringae-2-dependent defense responses, including hypersensitive cell death, by cleaving the Arabidopsis RIN4 protein which is monitored by the cognate resistance protein RPS2.	1.78713e-12
NZ_CP007155.1\|WP_025359380.1\|6811979_6814001_-\|phage-tail-protein-I	gnl\|CDD\|274050	TIGR02242, putative_secreted_protein, phage tail protein domain. This model describes a region of sequence similarity shared by a number of uncharacterized proteins in bacterial genomes, including Geobacter sulfurreducens PCA, Mesorhizobium loti, Streptomyces coelicolor A3(2), Gloeobacter violaceus PCC 7421, and Myxococcus xanthus. In all cases, the genomic region resembles a phage tail region, based on tentative identifications of neighboring genes. A region of this domain resembles a region of TIGR01634, another phage tail protein model. [Mobile and extrachromosomal element functions, Prophage functions].	2.75903e-14
NZ_CP007155.1\|WP_025359362.1\|6793135_6793780_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.10638e-13
NZ_CP007155.1\|WP_025359378.1\|6808453_6810361_-\|ATP-binding-protein	gnl\|CDD\|223540	COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones].	3.85362e-35
NZ_CP007155.1\|WP_025359363.1\|6793880_6795365_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	9.95158e-138
NZ_CP007155.1\|WP_042220947.1\|6805099_6805792_-\|hypothetical-protein	gnl\|CDD\|226156	COG3629, DnrI, DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms].	9.5214e-16
NZ_CP007155.1\|WP_025359381.1\|6814000_6816142_-\|putative-baseplate-assembly-protein	gnl\|CDD\|274051	TIGR02243, hypothetical_protein_SCD8A.17c, putative baseplate assembly protein. This family consists of a large, conserved hypothetical protein in phage tail-like regions of at least six bacterial genomes: Gloeobacter violaceus PCC 7421, Geobacter sulfurreducens PCA, Streptomyces coelicolor A3(2), Streptomyces avermitilis MA-4680, Mesorhizobium loti, and Myxococcus xanthus. The C-terminal region is identified by the broader model pfam04865 as related to baseplate protein J from phage P2, but that relationship is not observed directly. [Mobile and extrachromosomal element functions, Prophage functions].	5.92906e-76
NZ_CP007155.1\|WP_052360497.1\|6802107_6802935_-\|HNH-endonuclease	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	8.78708e-25
NZ_CP007155.1\|WP_025359383.1\|6816614_6817826_+\|DUF4157-domain-containing-protein	gnl\|CDD\|379338	pfam13699, DUF4157, Domain of unknown function (DUF4157). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. This domain contains an HEXXH motif that is characteristic of many families of metallopeptidases. However, no peptidase activity has been shown for this domain.	7.71202e-35
NZ_CP007155.1\|WP_025359368.1\|6798404_6798866_-\|heme-degrading-domain-containing-protein	gnl\|CDD\|179430	PRK02487, PRK02487, heme-degrading domain-containing protein.	4.84153e-68
NZ_CP007155.1\|WP_030109226.1\|6798979_6799426_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	6.05194e-19

>NZ_CP007155.1|WP_052360497.1|6802107_6802935_-|HNH-endonuclease
MIDRVLRELPPHVGAADREQAVEVLAAAAQSLDASNLVPLGREIVNRLDPDGALPSEDELAHPRREFRYDTRRDGSVRFQGCLDAETGALLGAVLSPLAKPHDASDTRTLPERQGDAFAELLETSTTPTEGGERPHIAVTIDWHTLKTGTGKAELAPSAIRRLACDAKILPVVLGSNSEPLDVGRISYTVPPHLRRALIVRDKHCAFPGCRRRPSTCHVHHIIHWANGGDTALSNLVLLCGMHHRLIHHSGWTVRITNGRPEFTGPEFLRCRQVC
>NZ_CP007155.1|WP_025359372.1|6800981_6802103_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MSNPLSAFDLVQLRQRRSVKWAEYGPEVLPVWVAEMDTPLAEPVAAALTAAIGRGDTGYAKPGGLLEAFAGFAERRYGWRADPAGMRLVPDVMTGIVEALGQVTAQGDAVVVNSPGYPPFFYWLERIGREVVRSPGLDLDRLERDFAAGAKAYLLCNPHNPTGRVYTAEQLRAVAGLADRYGVRVVVDEIHAPLTYPGERHVPFATIDAESAARSITLVSASKAWNLAGLKAALAVPGPQARAEVAAIHEEVSEGAGLFGVIASEAAFTQGEPWLDALLTGLDENRRLLARLLAEHVPAVGYEVPQATYLAWLDCRGLGIEGDPAELFLERGEVALSPGPRYGVPGFARFNFATAPERVTEAVLRMAKALTDR
>NZ_CP007155.1|WP_025359371.1|6800271_6800862_-|C39-family-peptidase
MHSTSACRAAVLAAGLLAVAAIGLPAAAAPAAPAAPAASKQLNISQQVQEQDQWCWVGSGLTIAQFLGKDQGIDQNTFCDIAQGYPQGSQCPNQAGQLEYVQTAYQALGMNPGQVSNPLSFSTVQSQINAGKPIETGIYWTAGGGHAQVIYGYDSSTSSIFYGDPWPASPRYSQMAYNSYVSNGEFQWGQALYGMG
>NZ_CP007155.1|WP_025359370.1|6799474_6800266_-|hypothetical-protein
MKKTTQVLGCSAVVGFALLLGATGAQAAPSAPTDLSAAQQAASQAQTRDFVARFFVNVDQHSAGKVSALSAQAESAAAQAKAPQVVGEPLAVYTLSPDFVAGKSAEVAKFGYVAVHAKSATGQDASVWMVREGQTWSAMNVTTGTEEITYPARAGADTVFTEPQINAWYKVHEGRVLPLNEVARTSVGQGVSLAAYQKQVHDKYGDKLAGSAYQANKLLGGYSPSSASPAPAADTTDWTLLSAGAAIVLAAAGGVLALRRKLG
>NZ_CP007155.1|WP_030109226.1|6798979_6799426_+|L,D-transpeptidase
MSSIRARASAVTALAMTAFGLVATPALASAARTPCDTAARACVDLNTQQAWLQHNGIIDYGPVPVRTGRPEAPTDPGTFRVTFKDLHHVSTIFNNAPMPYSVFFNGGDAFHEGSLTDPSHGCVHLSTAAAQTFFSTLQPSDEVQVVTG
>NZ_CP007155.1|WP_025359368.1|6798404_6798866_-|heme-degrading-domain-containing-protein
MSDLLTELTEQEERLQFDRFDNDTALDLGEHLLRAARERGLPVTISVRRNGQRLFHAALAGTSADNDAWIDRKSRVVDRYGHSSMLVGATFHAAGGTFEQQSRLDPDRYAAHGGVFPVIVRGVGPIGTVGVSGLPQAEDHAFVVEQLTGFLAR
>NZ_CP007155.1|WP_025359367.1|6798007_6798427_+|hypothetical-protein
MDDNDRLLRLISWVGWAEPDQNRCGLRYGSETDQARLNEREKMAAHTMCAYYSGALRYRVRGDEGDALDREQLPDYALEFATGLSARATGLMGELVARSLDLRADVQDLGRLWVEDVKSTAWRLVVANHPDRLSAPGIP
>NZ_CP007155.1|WP_025359365.1|6796397_6797252_-|hypothetical-protein
MWLAGDQPLVCTFARSSVLVSDPAAEPLPSAAAQVRLRAATPDGVLVGTLAKPELRSTVVPPDRLAKDELATRGPAFALVGEWSSPETPVELGGTPVKAPTGYGLLRVVDRPVAQGDRDSETGRALGACMARRAATGYPVADAEAWQPGPSLPVPAGTRFLLGYYGDSVGSCLRSADGTGDFLASSEESAPGRISVVYGSALAPDVRTTSAPTCEFLWGRLTGAARQVVFTGPNGETAQAHAGVDGLFVAAVPVRRTLPDNGIRFGVSVRDGEGKQIEYYQVLQ
>NZ_CP007155.1|WP_025359363.1|6793880_6795365_+|NAD(P)/FAD-dependent-oxidoreductase
MTYEHVDVLIIGAGISGIGAACHLRAGSPGKSFLILESRAAMGGTWDLFRYPGIRSDSDMFTLGYAFQPWRSAKAIADGPSIREYVRETAREHRVEDRIRYHHKVVHAEWSSADARWTVRVQRTDTGETLHLTCGFLFTCTGYYRYDQGYSPEFPGAQDFAGQVVHPQHWPEDLDYAGKRVVVIGSGATAVTLVPAMAERAEHVTMLQRSPTYVISRPSKDPVADRLRGLLPAKLAYPLVRWKNVLLFQLSYTLSRKLPALVKSVIRKGVQRAMPPGYDVDRHFRPSYDPWDQRLCVVPDGDLFRAVRRGRASVVTDRIERFTEQGIRLASGEELPADVIVTATGLNLLLLGGMTLTVDGEPVDLGKTVGYKGMMLSGVPNLALAIGYTNASWTLKVDLVGQYVTRLLQHMDRNGFQQCTPRAPGPDQELTPLIDLKSGYVLRSVDVLPKQGARVPWRLRQNYSRDVLQLRFGSVDDEGMRFSRRPSLVPSSTR
>NZ_CP007155.1|WP_025359362.1|6793135_6793780_-|TetR/AcrR-family-transcriptional-regulator
MSPTPSTERPVRGRRAPRVSGDDRERAILATAERLLEQRPYHEISTDDLARGAGISRPTFYFYFASKDAVLLALFDRIIEQAEAGRIEVLGRDRDDPAARWREAIGVFYETFGAHRAVTLAAAEVQLSNSEVRELWSKVMEGWASDTAALIEAERERGAAPPGAPARDLAIALIRMNERMLHATFAGESPSVSEQDVVEVLATIWLSTIYGPAR
>NZ_CP007155.1|WP_025359374.1|6804143_6805082_-|carbon-nitrogen-hydrolase-family-protein
MRVAAAQLRCPLLDPATGVRKVLDSLRSAAARDVHLVAFPEAFLSGYPVWPMITDGARFEAAVQKAAYAAYLDAAVELDGPELRQVAEAVSDLGVFTYLGITERGTGPGRGTVYCTLVALAPGRGVVSAHRKLMPTYEERLVWGTGDGHGLRVHEVAGMRVGGLSCWENWMPLARHALYAGGSDLHVSTWPGGPALTRDITRFIALEGRMYSLAVGAIIDYADVPAGFPLRQQMLDSGETSPYTGGSAIAGPDGKWIVEPVDGEERLLVADLDPAAVRGARQNFDPTGHYARPDVFQVTVNRTRLTAAHFQD
>NZ_CP007155.1|WP_042220947.1|6805099_6805792_-|hypothetical-protein
MAAAVMVHLFRGPYVTQGTRRVEVPEASKRLLAFVALHRRRLERRFAAGHLWPCADDARAAANLRSTLWRLRRIGVDLISADKWSLALRPEVLVDIEVAGDWAGRLIDGSAGTEDLVLHPWWTEALDLLPGWYEDWAIGERERLRQRTLHALEALSRRFAALGRCAEAVETALAVVGADPLRESAQRALIDARLAHGDDVAARRGYELYRELLGRELGLAPAADLLPRTA
>NZ_CP007155.1|WP_025359376.1|6805827_6807177_-|hypothetical-protein
MTTPSSTEQDTPTVGGAIARLNAQDGLFLRAEHLTLMQDYSEDLAKALGTACGPGVVHGFPVTLAKDKVVVGPGLAVDPSGTVLESKKTDAKVSFPKEPLPADGFYVVQLLEGKWFYGTDSVYGNPCDDTCSGATALHPNEGRGITVMLTPATLSGFDGQASDKRRNWLASHYFERERGYAKPWLQQPAPGRVVSPLQSLAWSTGLDAPATSGVPIAVLFTVNGKWQVDTWTARRDLSGSTALRGWQWRLAGRPWDVFLAQVLQFQDQLSTRSAAQVTSLDQVVQWLDAARADVTGGASASSVDLLNSAIGALSGAQAPAAQAVSLVERGFQDLPPAGFLPVDPKGNVAEQVTALFPATVPLTFYTCRFDYTPQVLESAQHSDRIPLDGSEAGLGVDVFIPSGQPDWVVFARNNEPVPLGGGTAIGARATTRAPKAAARRGDAGVTRRA
>NZ_CP007155.1|WP_025359377.1|6807173_6808457_-|hypothetical-protein
MTTCDDTAAPCASCCAADLPVNPFVALRVAFGMLLGEDDFRTLMGNSRGKQMLHSAWLHGSGVVWGMRARLDGEFLLRVSPGLALDGHGRELHAETGWCLDLRDWLTRNQHTADSANEGDTKVIHTRLLAEFSCRPSNLVPTLADPCDVTRKRDDYSRVLETVHFTLSADPVEPVPVPYRRVRALLGLGEADTEVDSASCLPPEQRAAELLHKLRVLAAADSAELAPPSAEEPFPVTELNAPVLLAEVAITVRVADGAMTIVKVDLSPEVRTTLLPTWLIQELTCGLAPGLLGPDTQPDAGGPRLDPGSLKWSANGDQLTFEVTAALNPRSLRRAVRVTSLSADRGWVDEDIDAVRVDEESGTHVTVELAGRLSNELVRLTVRGTGPEPAFGVHPAVPLAGVRGGPPGSRHDGHDAALTFTFGRTQA
>NZ_CP007155.1|WP_025359378.1|6808453_6810361_-|ATP-binding-protein
MSERTSHDLTARAADLAVRVADLLDQRCSVESGAAQTAEFLRAWGKQAQADRCEEQPFDLVAARFGLTEQEQQVLLLAGLAEEHEGIAGTFRALHPRGEPHPTTGLAALLLGGDRAAVRRLLTEGAAVRAGLLRFGAEGTFFERSITVADRLWEALHGHEGWPASIERVPVEPAPGGLDRWLAWPQVRRVAVSLLAADDRTVLVATPEEEIALSRCAAVADAAGTPLVAGRVAAQDPHGIALLAAHAAARGAIPVLVLAAHAEGTPPATLRIAAPGPVLVVSGGPVRAVGHRPLLTLPTGPLDGTDHRATWAAALPRHGELAPALAARHAVDPAHTTQIAADLREPVDLAQVASAIRARAGAVLPAGVDLSTPDVPWHRLVLPQDQAGQLRAAVDRLEQAATVLDDWGFRARANASGGTRLLFTGPPGTGKSLAAQAVSSAAGTDLLTVDVSRVVSKWIGETEKNLASVFEVAQRTQAVLFMDEADALFGTRTEIGDAHDRYANLETAYLLQRLDRFDGVVLLASNLRHNIDPAFLRRMDLVVEFPQPDESCRHRLWDLHLPERVRGPDVDLAVLSRLYPVAGGWIRNAVIAAGFAAAPAGPVRQHHLVAAMRREYAKAGQPFPGEPTNLMETRT
>NZ_CP007155.1|WP_025359379.1|6810429_6811983_-|hypothetical-protein
MTALTVDRLSSTVHGADRAQASRVRRLLGELAERRLDEALRAAELPTGLWCLRRLDVSVRMDFGRGDLALARDWADTLVGALRAALAQRPGEVAHFVDLRHALADLVGSVALGRTDRGWAWRRVDLLGANDPEPADAPREAIVAALRRHPRYALAALLAALREAGPAALQRVLGATGWTAVAQALLAAGGVPPGGLRAVAGSVRGLSAAGEPPGAGRSPGVGGSAASREVSPGVGGLAAVSREALPGGGRSLSGDGSPEVDRPLPAEDSPAVDPRDRAAAAILARSAAAGALVRSRLRPDPDTVAAWAVLVLAEAEPGAFARADAPAVLARVAAQLAPGAMKVPLLAFNASNGTFMAPVPTEWAGLPFLLATAQDAGVPARLLADPVLAARPLRWVLHGLATRLVPLSEDDPAALAFCGLDPAQVPPTVDASPASRAEHEALTAHACRWAAVTEERLDPGTQVAHIARRHGCVQGEPGWLELVLPLHEVDLAVRRAGLDVDPGWVPWLGAVVRFRYE
>NZ_CP007155.1|WP_025359380.1|6811979_6814001_-|phage-tail-protein-I
MDGDRGYSQLVRPEQWALCVREHTALLPGGGVTLDWVDDTPRHTGRCRTAPAGLVFDRWCRAYRSRPERGLVEVIPAGASSSGTHDPGILRSPLGLAVDSAQRLYIAESGTGLVHVVDLWGRRLLRKIPLRCKDKRRPIDIAARCCGALVLAADPYGIVLVDGRRGPLPGPKLVTPPCSDGMLPSRIALSARGPLLLWRHPRAARALVSTVDGEVLVEVPGGTDIELTRDGTLVVARQPGQSFRRFAADGLELEPLGAPGYDGGALAVAPNGRIAFTTAEGLAWTTGSSAVHATSGTVLSYRLDSGTYRTRWGRLFLDACAPTGTNLAVRFATSDEDTATEPPAPRRALSPLLRRPTGREAPWAQIAADDQFETYESPVTAEPGRYLWITLTLTGTRRLSPKVRALRVERPGHQLLRALPRAWSREESDADFLQRFLGPAEGLLHELDQRAAARSVLVDPRVTPQEALPWLASFAGLVLDRRWPERARRQLIARAYPLYRARGTKRALTEILGIYLGYQPVIVERWQLRGLGGTVLGTSATGPRAPEVGAATGALGTFTVGGTLPGQNSYSLAAHRFSVLIPGELTAEQLSVVQDVLAEHRPAHTEYELCELSSGMRVGQRLHLRLTSYVGPGANWAPAVVDHTLIGGDGVIGVPSVGSRLGDTSVAGQVRVG
>NZ_CP007155.1|WP_025359381.1|6814000_6816142_-|putative-baseplate-assembly-protein
MALTGPILDDRTYQQLREELVRRIPVYAPEWTDHNESDPGIALLELFAYLGESLLYRFNQIPDTTKIEFLRLLGVRPRPARPARVLLTASTELPQGVQVLRDSVAQAGAVAFQTEDEVYAWPLDVLAAGKGKLPPARTAAEVERRAVASAMAGLGPNDAHEHYRTVLAPADPMDAEAVPLTVSGTWDNTLWIALLRKKATDPQQLAGRTLFLGLAFDETVPADFALQDLDGHGQDYRSTGLGIEAPPMIWQLWAGSDRDRKSYYTTVEVLGDSTGGLVSTGVVKLGLPKQLPVFDPARTNPQGDPGCPPVLIDEKQAALVVGWLRVARPATSGDSIRPVRWTGVNAVSAVQSRTAAAELLGTGTGDPDQDHPLTQRPVLTGTARVQVEEADGWRDWTEVEDFVASAPDDRHYTIDLTAGVVRFGAPRVPQPGQRIRVLSYRYGGGLVGNVPAGAIGQLGQVRAANPLPAVGGADAVSLAEALDAIPAELHRRDRAVVAQDFRDLACEVTGVVRAEVLPLLHPDTPTVRAAGVVTVVVWPGEDLRTPDAPMPDRGLLRRVAAYLDQRRLLTTELYVVPPTYQRIVLAAGVRVRAGYQVDAVRRWVELILRQYLAPVPPYGPEGGGWPLGRTVRRAELEAVAVQVDGVEYLEDLTLGRVDAKGVITEADTVELARWEVPRLVEITVVQGKPLRLGEKYTPPSSDLIVLPTLPEVC
>NZ_CP007155.1|WP_025359382.1|6816161_6816548_-|GPW/gp25-family-protein
MTVHTWLGRGLRFPVRPDSSGAIGALSGLELVRQSIEAILDTEPGERVMLPAFGCGLRRYLMAPNTVTTRAALREAVTLALGQWEPRISVTNVAVTPGEDPSLVWIEIAYVLLADLRPDNLVYPFYLR
>NZ_CP007155.1|WP_025359383.1|6816614_6817826_+|DUF4157-domain-containing-protein
MRQYRQRPVQRCGIGSTCECDPRTKAAAVQHDIQRCTASGGSPLPEHTRRHMEGALAADFSGVRVHTGPTAQQAASALRAHAFTSGTDIMFGAGEYRPGTLSGDRLIAHELTHVVQQRQGVHLDPIDGGRSDPHEVEAEQTAARVVDVDVNAPEHSTSSDMLRSLGIYAATKLFGGRIPAAVMIPLNCLLRIAMTMEWPSLLLYRAIQTLYDLYLLGQHTGDHDLPDAQGRRPRTNLVIDSLFGGLPDLLADCLTLFIVAEVQMAFDQTEPAGRTLRHYRDGTGTDLSYSAEDLFGDPGFRHLVAGVNQVGVPTRLTMLTDDWKTDNLHYTFGEVDHLTITILDRTDPSKARVHVLLADRYQWHPDELRVSRVFHAAMENMKMAGAREFWQRVDQVVEVDLTR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_15

6967319-6967473

Orphan

Consensus_repeat	Method
CGGGACTCGGCTGCGGCAGAGCGGGACTC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP007155_15

>merge|NZ_CP007155|15|6967319-6967473|CRISPRCasFinder
CGGGACTCGGCTGCGGCAGAGCGGGACTCGCCAACCTGAGGTCGGGACTCGCGTGCGGGAGAGCGGGACTCGGCGACCCGAGAACGGGACTCGGCTGCGGCAGAGCGGGACTCACGCACGGCTGGACAGGACTCGCGCGCCCCAGAGCGGGACTC

>NZ_CP007155|15|14|6967319-6967473|CRISPRCasFinder
CGGGACTCGGCTGCGGCAGAGCGGGACTC	GCCAACCTGAGGTCGGGACTCGCGTGCGGGAGAG
CGGGACTCGGCGACCCGAGAACGGGACTC	GGCTGCGGCAGAGCGGGACTCACGCACGGCTGGA
CAGGACTCGCGCGCCCCAGAGCGGGACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025359461.1\|6957129_6958638_+\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|341259
NZ_CP007155.1\|WP_025359476.1\|6973849_6975307_-\|adenosylhomocysteinase	unknown	unknown	gnl\|CDD\|377487
NZ_CP007155.1\|WP_025359475.1\|6972512_6973856_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP007155.1\|WP_081789988.1\|6951156_6954873_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238121
NZ_CP007155.1\|WP_025359460.1\|6954938_6955586_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP007155.1\|WP_148309977.1\|6964692_6967287_+\|phosphoenolpyruvate-synthase	unknown	unknown	gnl\|CDD\|235751
NZ_CP007155.1\|WP_081789608.1\|6960511_6961708_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236173
NZ_CP007155.1\|WP_025359473.1\|6970893_6971859_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP007155.1\|WP_025359469.1\|6967519_6968407_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359478.1\|6976028_6976373_-\|Lsr2-family-protein	unknown	unknown	gnl\|CDD\|378714
NZ_CP007155.1\|WP_025359465.1\|6961756_6962737_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|225070
NZ_CP007155.1\|WP_025359466.1\|6963277_6963721_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP007155.1\|WP_158510848.1\|6968625_6970116_-\|carboxylesterase-family-protein	unknown	unknown	gnl\|CDD\|365897
NZ_CP007155.1\|WP_025359470.1\|6968403_6968601_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_158510847.1\|6964098_6964254_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359474.1\|6971835_6972429_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP007155.1\|WP_030111724.1\|6975535_6975973_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP007155.1\|WP_051913253.1\|6955605_6956583_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP007155.1\|WP_025359462.1\|6958630_6959800_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173840
NZ_CP007155.1\|WP_025359472.1\|6970130_6970766_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238241

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025359460.1\|6954938_6955586_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.24115e-46
NZ_CP007155.1\|WP_025359476.1\|6973849_6975307_-\|adenosylhomocysteinase	gnl\|CDD\|377487	pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase.	0
NZ_CP007155.1\|WP_025359475.1\|6972512_6973856_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.60238e-35
NZ_CP007155.1\|WP_081789988.1\|6951156_6954873_+\|hypothetical-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	4.21966e-55
NZ_CP007155.1\|WP_025359461.1\|6957129_6958638_+\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|341259	cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD. This subfamily of the AMP-forming adenylation family contains Escherichia coli FadD and similar prokaryotic fatty acid CoA synthetases. FadD was characterized as a long-chain fatty acid CoA synthetase. The gene fadD is regulated by the fatty acid regulatory protein FadR. Fatty acid CoA synthetase catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, followed by the formation of a fatty acyl-CoA. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions.	0
NZ_CP007155.1\|WP_148309977.1\|6964692_6967287_+\|phosphoenolpyruvate-synthase	gnl\|CDD\|235751	PRK06241, PRK06241, phosphoenolpyruvate synthase; Validated.	0
NZ_CP007155.1\|WP_081789608.1\|6960511_6961708_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|236173	PRK08177, PRK08177, SDR family oxidoreductase.	4.02621e-62
NZ_CP007155.1\|WP_025359478.1\|6976028_6976373_-\|Lsr2-family-protein	gnl\|CDD\|378714	pfam11774, Lsr2, Lsr2. Lsr2 is a small, basic DNA-bridging protein present in Mycobacterium and related actinomycetes. It is a functional homolog of the H-NS-like proteins. H-NS proteins play a role in nucleoid organisation and also function as a pleiotropic regulator of gene expression.	1.31675e-50
NZ_CP007155.1\|WP_025359465.1\|6961756_6962737_-\|amidohydrolase-family-protein	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	1.39375e-30
NZ_CP007155.1\|WP_158510848.1\|6968625_6970116_-\|carboxylesterase-family-protein	gnl\|CDD\|365897	pfam00135, COesterase, Carboxylesterase family.	7.92578e-120
NZ_CP007155.1\|WP_025359472.1\|6970130_6970766_-\|hypothetical-protein	gnl\|CDD\|238241	cd00421, intradiol_dioxygenase, Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates. This family contains catechol 1,2-dioxygenases and protocatechuate 3,4-dioxygenases which are mononuclear non-heme iron enzymes that catalyze the oxygenation of catecholates to aliphatic acids via the cleavage of aromatic rings. The members are intradiol-cleaving enzymes which break the catechol C1-C2 bond and utilize Fe3+, as opposed to the extradiol-cleaving enzymes which break the C2-C3 or C1-C6 bond and utilize Fe2+ and Mn+. Catechol 1,2-dioxygenases are mostly homodimers with one catalytic ferric ion per monomer. Protocatechuate 3,4-dioxygenases form more diverse oligomers.	4.48193e-28
NZ_CP007155.1\|WP_025359466.1\|6963277_6963721_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	8.64473e-12
NZ_CP007155.1\|WP_025359474.1\|6971835_6972429_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.05968e-07
NZ_CP007155.1\|WP_030111724.1\|6975535_6975973_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.11222e-09
NZ_CP007155.1\|WP_051913253.1\|6955605_6956583_-\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	9.3384e-37
NZ_CP007155.1\|WP_025359462.1\|6958630_6959800_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	0
NZ_CP007155.1\|WP_025359473.1\|6970893_6971859_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.6582e-27

>NZ_CP007155.1|WP_148309977.1|6964692_6967287_+|phosphoenolpyruvate-synthase
MTLTVDFTEIDGSMLASVGGKAANLGVLSRAGLPVPQGFCVTTAAYRQVAETAGVRALVDRPHLAREALLGAEVPEHIAEAVLARYAELGADVPVAVRSSATAEDLPFASFAGQQDTYLNVVGGQAVLDAVRRCWASLWTDRAHAYREANNIDQDAVELAVVVQHMVDSQVAGVLFTANPVTGRRREAVIDANPGLGETVVSGSVNPDHFVVDTASGEIRQRRLGDKKHAIRSLAGGGTEQVALDHQGACLSDEQVRELARLGDRVERHYGSPQDTEWAIDPGGRLWLTQARPITTLFPVPDSPSNTGPGRRAYLCLSVAQGLYRPITPMGMAAFRLIGAGMARMVGVPVANPLAGPRVFAEAGQRAFVDITPVLRSRLGRDVVPRVFDLMEARSAVVFRSLYQDPDMSLVDSSRLPGLRRLLRVVLRLGLPWRFVEAVLRPEAARRRVTRIGSHLQEAIALRGNPSSRERLDHVQRFLSTSLVPMLPSLLPVAGAGFVMLALVGKLLGDKLEPGQLEAVLRGLPHNVTTEMDLELWALATRIREHGELFDTLSPAELSERYLAGELPEVVRRELAGWLARFGHRAVAEIDLGMPRWSERPEHILGVLANYLRLADPQAAPDVQFARGRAEAERTVRALVAKAGPLRGWLVGRALSRVRALAGLRETPKFFLIQALAEMRRQLGQVGVELAAAGRIERAEDVFFLTVAEALAALDGRDCRDLVAERRESYERELRRRKVPRVLLSDGSEPEASAPAATGDAMVGTSASSGRVTGTARVVLDPVGARLEPGEILVAPSTDPGWTPLFLTAGGLVMEMGGANSHGAVVAREYGIPAVVGVAEATHRIATGDRITVDGAAGTVSAAD
>NZ_CP007155.1|WP_158510847.1|6964098_6964254_-|hypothetical-protein
MRELENTIRIYANQIQVLTLRNAELEDKLHRRAGHDVSTIRVGPAHVVSRP
>NZ_CP007155.1|WP_025359466.1|6963277_6963721_+|MarR-family-transcriptional-regulator
MDDEQASRLFELADLILAVGRHIHASKEFAAESWTPLESAVMRFIDRNPGTSASAAAEATQLISSNFSRALRGLEKKGLVRRDVDPHDGRRSHLYPTARANDHLRQLREVWSGLLDGIVPDPDEIDAMNSTLRRIEAQLVTRARRGT
>NZ_CP007155.1|WP_025359465.1|6961756_6962737_-|amidohydrolase-family-protein
MPLIAIEEHWIMPDLTSALRAMPEDVRDESLAFNEMGDHQQRLEDLGAGRIAAMDAQGIDVSILALTPPGTQPLPARDALRLSRAANDVAAEAVRSNPSRFRSLCTLPMSSPPDVAGELERAAGLGHVGAMVYGRAGGLLLDDPAYNDFFAAAAELGQPVFIHPQLPSAAVRDASYRGFDPMTELGLATFGWGWHLDAATAALRLILRGTFDRHPDLQVVLGHWGEMLLFWLDRANSLSRVAGLQRSVKDYIRSNFFITTSGMLNPALLHHALSVTTVDRLIFSTDYPFQHPTREEITSFLEHFTSDGERQKFSSANAASLYGIDI
>NZ_CP007155.1|WP_081789608.1|6960511_6961708_-|SDR-family-NAD(P)-dependent-oxidoreductase
MGTSRTVVITGAAGGIGSELVERFLKNGDTVVATDVSQETLDSWRSRWDADTFDGRHSFLHAVAGDLSSEQSIAALTETTWDRFGIVGVLVNCGDLSLDPVRGDARRPLAASPRRQPHWRQMRALHRDEVPQDVVGSVFFLAPRPHPIAPTSQYDPLNTTTGAVMSSTSVNTTVLLIGASRGLGHAIAAEYLDRGARVVATVRGTGRTALHELQDTADGQLEIEHVDITVPEQVQALRDRLGDRKFDLLFVNAGVSNGRYETSADVTTEEFTRVMVTNALSPMRVIETLGELTGPNGTIAIMSSGQGSIANNGRGGFEIYRASKSALNQLMRSYAARHRDDSRTLLLMAPGWVKTEMGGSDARLTISESIPNLVTVVDAQRGRAGLQYLDYQGQSVAW
>NZ_CP007155.1|WP_025359462.1|6958630_6959800_+|acyl-CoA-dehydrogenase-family-protein
MSEHPFTLFAIDSLLSEEERAIRDTVRRFCADRIRPHLADWFETARLPARELARELGGLGLLGMHLEGYGCAGTSATAYGLACMELEAADSGLRSLVSVQGSLAMFAIHHFGSEQQKQEWLPRMASGEAIGCFGLTEPDFGSNPAGMRTRAKRDGSDWVLDGSKMWITNGSIADVAVVWARTDEGIRGFVVPTDTPGFSAPEIHRKLSLRASVTSELVLAGVRLPESAMLPGAKGLSGPLACLNEARFGIVFGALGAARDCLESALAYTADREVFDKPLAGYQITQTKLADMALELGKGALLALHLGRLKDAGQLRAEQVSLGKLNNVREALAIARECRTLLGANGITLEYPVIRHANNLESVLTYEGTSEVHQLVIGNALTGQAAFRG
>NZ_CP007155.1|WP_025359461.1|6957129_6958638_+|long-chain-fatty-acid--CoA-ligase
MRLSLATILAESAKRVPDKTALIESGHRLTYRELWRQARSCAARLHERGVRPGDHVALLAPNVADFARNYYGILALGAAVVPVPTLLNAEEAAHILTHSRARAVVCERSCVAVGERAAELAGIPLLDAGDWTGHEPVPSYELRDPGDTAVVFYTSGTTGQPKGAVLTHLNLVMNATVNAFDANPLYRDDVVLGCLPLFHTFGQTVSMNSTFRVGGTLVLQPRFDADEAIELVHAERVTAFFGVPTMYMRLLDRAARHAPVTTLRSCVSGGASLPVAVLERFEAQFATTVYEGYGLSETSPTASVNQQCYGARPGTVGHPVWGVDVEIARADLEDRIELLPVGESGEIVIRGHNVFAGYLDDPEATRAAVVDGWFRTGDIGVKDAEGFVSVVDRKKDLIIRGGYNVYPREVEEVLARHPAVGQVAVIGLPDELRGEEVVAVVVAKPGADTDAAAIIAWAREHLAGHKYPRRVEFVAELPMGPSHKVLKRELRRILTTPKDDDV
>NZ_CP007155.1|WP_051913253.1|6955605_6956583_-|IS630-family-transposase
MAALESGTVTGYRQAAEVFRVAERSVGAWWRAYRDGGREALAVRRVRRPGPAELITAAERGTLFMAMADYTPEELLIGGPLWTRAAVVELIRLVTGVVMTEQGVGLWLRRHGFTPQRPARRAYEQQPAAVRAWLDTEYPAIASRAKAEGAVVAWVDQCGLRSDAAPPGRSWAPKGHTPVVRVTGKRLRVNVMSAVASRGALWFTVFTGRFTAPVFTAFLARLARQAGRKVYVIADRHPVHRSRVVRTWLEANTDRIELHLMPGYSPELNPDELLNADLKRNMPAGRARTVERLARDTRRFLHRRQRQPHLVRGYFQARHVRYAIM
>NZ_CP007155.1|WP_025359460.1|6954938_6955586_+|response-regulator-transcription-factor
MVNVVIADGHLDARRHLSSLLDGVPGMRVAGTAGTGREAVREVVSHRTDVLVVDLQLREHDGFTTIREVRRTAPGVAVLVRTELADTQSLLSAVRAGALGYLLDDADENCLIRAIGSVADGCAIFCPRIASRFTHLLVDATTAHQAPFPELTDRESQVLELLASGMSNPAIARTLRLAAKTVGNHNSAIFTKLGVTTRAEAIRKATQAGIGRTTY
>NZ_CP007155.1|WP_081789988.1|6951156_6954873_+|hypothetical-protein
MREQAGSPTYRELSRAAHYSATVLSEAAGGRKLPTLAVTLAYVRACEGDPDQWQDRWQQVAAELSGAAPPLPRAPEQPAPYVGLGAFQSTDADRFFGRERLVGELLARVRDRRLLGVFGASGSGKSSLLRAGLVAEVAAGGGRTLVITPGPHPLEECALHLAPLTGEPAPGLHAELAEDPANLHLVVRQALLGESEDAELLLVVDQFEEVFTVCTDPAERTWFIAALVHAAQAATSRTRVVLGVRADFYGHCGQHPDLVEALRDGQLLVGPMTAEELRQAVTAPAVRAGCTVETALVSRLIADATGQAGVLPLVSHALLETWHRRRGTRLTLEGYQETGGIQHAVSRTADQVFSGLDPAGQRVARQLFLRLTALGEGTEDTKRRIRREELDPESEPVLRTLADARLLTLDRDSVEIAHEALIRSWPRLRGWLTEDRDALRVHRQLGEATDSWRALDRDPGALYRGTRLALARDFAAANGSALTVREREFLEASLAAEAAEQATARRRAKRLRQLVALLTVLLLMAVTAVVYAMNTQRTATEQRNIAVSRKAIGDAAAMRAGNPALSLQLSLAVYELVPNQESRDNLLSSLSTDFGTRLTGFSGDLSYSAFSPNGKVAAAVSLDRTARLWDVTDIHRPRELATIRQADPLVQLAFTADGRTMVTVGGGSARLWDVTDPASPRESGLLDGHGKNLTWVAFRPDGRLAVASVQDGPDRLFDLSDPAHPVQLPAELGRSAPFGQTAFGADGHLLAAVDGSVVRLWDLSDPAAPVRRGVLAGHVGTVASLAFSPDGHTVGTGGWDHQSRLWDVSDPAAPRGLATLTGQNSIVWGVGFSPDGHTFATTGDLTVRLWDLADRAHPRLSNVVSGGVYSVAFSPDSNRLLVTDDERAVRLTNLRELPMIGHENFVSSVQFSPNGHLLASGSWDGTVRLTEVTDPRSWHALPTLTDHTGYVRAVEFSRDGTLLATGSDDGTAALWNVRDPEHPVKVGSVQPKSGEVDSLSLRADGRVLATGTEHGVVLWDISDPKNPRELSRPPGYTVNSWAVVFSPDGKTLATENGDPKSLLWDVTDPSNPRRLPFPLGSTESIPVRGFSPNGNVLATVRDDGLVRLVDMTDRHNPRELSQLTGHTRGVYDASFSTDGNRLVTSSADKTVRVWDVSDPRAPRLLETLSGHTLAVATSMFSPDGHTVVSGSNDGTVRLWDTDVNEVEARICAVAYPRITPEEWARYLPDIDYRQLCPL
>NZ_CP007155.1|WP_025359469.1|6967519_6968407_-|hypothetical-protein
MNESEFSAALQQAVLARGLTLDRIVHRLRERGFTLSTATLSYWTTGRSQPERQESLAALDVLETILDLEPGSLRGKLVPRARKSRRKPDRLVPLELLWREISGPIGRVVDPGEHYVRARKVLSMHDRYTLDANGALAHVRTTTVLEADEDDVDHMLIICHDEDVVHDLPQVRPVSGAYLGRVDRFDSDHVQMAELVFDQPLQRGERTMVEHELIFPAGGRRVWRGERRLPMAIRQHVVEVVFDPAALPAAAQHVTVPADGTGRTVQPLAVDPANTARLVLLDPPAGIHGIHWTWP
>NZ_CP007155.1|WP_025359470.1|6968403_6968601_-|hypothetical-protein
MTQPDSTEFSATPQRAIAAKGLTLDRIVHRPHERGHALSADTLSYWTTGRGQSERPRGLHWDRTR
>NZ_CP007155.1|WP_158510848.1|6968625_6970116_-|carboxylesterase-family-protein
MELTRRGVFALTAAASLTLCGGAGAAAATEEVIARTALGRLRGLRQGGVCVWRGVPYAQPPERFAPARPVQPWQGVRSATEFGPTAMQIALGPGGPSTATRQSEDCLYLNVWSPGTTGRRPVVVWIHGGAFVSGAGSDYDGTQYAALGDTVFVTINYRLGAFGYLYQADRPGSGNLALTDQIAALRWVRQNIAAFGGDPDAVTVMGESAGGMSIGYLLGMPAARGLFRRAVVQSGGARPLFTPEQAAKTTAAVREALGGADPKSVTAEQLRTASAAVAKDSALGGEPFHQVVDGGVVPAHPLEQLDSQVDVMIGTCRDESNVLARILPLFAKGLPQHVKEVVGTAKWAQLQRVYRDSTPSDRDWELDLLSACFTVMPSVWLAEAAHNAGARVWQYRFDYADASPTGPVHAADLMFTFNSVEPDLLAPKADLAVARAVARRVFDGVVAFARDGNPGWAAFEPVRRCTMLFDAEPGVREDRIERVQREAWRGVRPTHF
>NZ_CP007155.1|WP_025359472.1|6970130_6970766_-|hypothetical-protein
MDPTTRRAALKVGAAAALAAGLTAVSAGSSPAARLPLTPACTDGDDTPGNIEGPYFKRNSPLRSDLRTAGVTGVLLTLRGTVHSEHCLPVPGALLEFWQADDKGVYDNTGFTLRGHQYTPADGTYSLETIVPKDYVDAGTHRTPHIHVKVQPANGRVLTSQLFFPDTTTAYGLDFAQLNARDRFLNRKCTLALGVLSDNHYAANFDFVVAA
>NZ_CP007155.1|WP_025359473.1|6970893_6971859_+|LysR-family-transcriptional-regulator
MELEIRHLRSVRAIAEAGSLTAAAAALGVSQPSLTVQLRRIESAVGGQLFLRGKNGAVPTELGEYVLSTCDEILDRMAELRRHATCRAGGERIRIGGMPGPLFAASLDHLCRTRGAPPVASSVHYSGIALIRLLDEQRLDGATLVGFPSAPASTLPEVAVRTVSEGPVFVMLARSHPLAARERLHLAELREENWVLPPATGDGVRGHVRAACEAAGFSPWVPHETSDLHSAGEIVAHGLGVGLLQATAPVPEGVVGRELIGSPLRLSQLFAWHTGGPLAPLAEELVTALRLSYVDSALASPVFTAWLRENSVARSQVATPF
>NZ_CP007155.1|WP_025359474.1|6971835_6972429_-|TetR/AcrR-family-transcriptional-regulator
MVTPEANRPRLSRDLIVAAARSVADSTGLDSLTLREVARELGTGQASLYRHIADRRELLGLLADDLALGFPLADPALPPRERLPALWQSLHGYLSRHRWAARVIVDGEHTSRNAVPFVDSLLDCSAAVGMGPALAMRTYQAVYNLLLGYLLNEHPMGHDREGGQRPLPGWHVAGGQDAFCWAMRCLLDGVLEGRGDL
>NZ_CP007155.1|WP_025359475.1|6972512_6973856_+|MFS-transporter
MIDLAARPTVRGGALLTAMSVTVLAYSLTQTMLVPTTTVLQHALNTTATWAAWAVLSAPLLASAVLTPLIGKLGDFHGKRRVLLWVLAVFLLGTLGGLVAWDIGSLIAFRAVQGVSLGVLPLVFGIVKESLPADRVTHGLALTSGLVGGAAGLGLVLGGLLVDLLSWRWLFAVSAVLVTAALVLVARSVPESPHRPGGRLDVPGAVLLALGIGGLLLALPLGPTLGWGSAWVLGLFALAVLGLAAFLVVERRSTSPLVDPEVLVDRPVLWIHLAALSLGAAQFVLYVLVPKIAQTGFGTGVTVAGLIMLPGTLVMLPASWLAVRLGERTSLAAGLGCVAAAAGLLALWNGQVWHLVVFYLVASVGFGLVMAVLPRLVTGSVPHDRVATANGVNTVARTAGGAVGSQLAAAILVSGGGYPFAFGAAALVALAGVLLSSGATREGLADQ
>NZ_CP007155.1|WP_025359476.1|6973849_6975307_-|adenosylhomocysteinase
MSDKLRKSNGVEFAVADLGLAALGRDQIRLAEHEMPGLMATRREYAESQPLKGARIVGSLHMTVQTAVLIETLVALGAQVRWVSCNIFSTQDEAAAAVVVGEGTPEQPAGTPVFAWKGETLEEYWWCTDQVFRFPDGQLANMIVDDGGDATVLLHKGVEFEATGVVPSAGENDPEEYGILLRTLAASLAEDPKRFTRIAEQMRGVTEETTAGVNRLYRLAAEDKLLFPAINVNDSVTKSKFDNKYGIRHSLADGLNRATDVMIGGKLAVVCGYGDVGKGAADALRGQGARVVVTEVDPICALQAAMEGLEVVRLEDVVEKGDIFITTTGNFNIIMAEHMARMKHNAIVGNVGHFDNEIDMAGLAKVPGIRKREIKPQVHEWVFPDGHAILVLSEGRLMNLGNATGHPSFVMSNSFTNQVIAQIELFTNVRGYERQVYRLPKHLDEKVARLHLDAVGARLTTLTKEQAEYIGVDVAGPFKPDHYRY
>NZ_CP007155.1|WP_030111724.1|6975535_6975973_-|GNAT-family-N-acetyltransferase
MRRAVPGDLEDLLVLVGEFYEIDRHEFDRSTVLRGLGPLLDGDEHGQVWLLLDNRDRSAAGYAVMTWSWSLESGGREALLDEIYVRDRASGAGSALLNRVLREASARGARAVFLETEEHNERVRAFYSRHGFAVEKSTWMSRVLP
>NZ_CP007155.1|WP_025359478.1|6976028_6976373_-|Lsr2-family-protein
MAQKTIVQLIDDVDGSEANESVSFALDGVEYTIDLSDDNAAKLRGNLAPFVEKAQRLGGRKQRAGATRTAVRAGGDRAQNQAIREWARSQGETISDRGRIPQELVTRFQAAHGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_16

7143595-7143828

Orphan

Consensus_repeat	Method
GCCCCGGCACTGCCACGAAGGTGCCCTTTGCGACGCTCAACGTCCCGAACGG	PILER-CR
CGCCCCGGCACTGCCACGAAGGTGCC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP007155_16

>merge|NZ_CP007155|16|7143595-7143828|PILER-CR,CRISPRCasFinder
CATGAAGGTGCCCTTTGCGACGCTGGGCACCTACCCCCACCGCCGCGAAAGTGGCTTTCACTGCGTTGGGCGCAGCGAATGGTCCTATGGCAGCACGCCCCGGCACTGCCACGAAGGTGCCCTTTGGGACGTTCAACGTCGCGAACGGCACCTTCATGGCATGGCGCCGGGTGAGGCCCCGCGCCCCGGCACTGCCAGGAAGGTGCCGTTTGCGACGCCCAACGTCCTGAACGG

>NZ_CP007155|16|2|7143595-7143828|PILER-CR
CATGAAGGTGCCCTTTGCGACGCTGGGCACCTACCCCCACCGCCGCGAAAGT	GGCTTTCACTGCGTTGGGCGCAGCGAATGGTCCTATGGCAGCACGCCCCGGCACTGCCACGAAGGTGCCCTT
TGGGACGTTCAACGTCGCGAACGGCACCTTCATGGCATGGCGCCGGGTGAGG	CCCCGCGCCCCGGCACTGCCAGGAAGGTGCCGTT
TGCGACGCCCAACGTCCTGAACGG

>NZ_CP007155|16|15|7143690-7143801|CRISPRCasFinder
CGCCCCGGCACTGCCACGAAGGTGCC	CTTTGGGACGTTCAACGTCGCGAACGGCACCTTCATGGCATGGCGCCGGGTGAGGCCCCG
CGCCCCGGCACTGCCAGGAAGGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025359618.1\|7156145_7157183_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP007155.1\|WP_025359605.1\|7135602_7137330_-\|fatty-acyl-AMP-ligase	unknown	unknown	gnl\|CDD\|341254
NZ_CP007155.1\|WP_025359606.1\|7137665_7138769_+\|NAD(P)-transhydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|240629
NZ_CP007155.1\|WP_158510853.1\|7153981_7155880_-\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|269893
NZ_CP007155.1\|WP_030110958.1\|7148736_7149966_-\|YeeE/YedE-family-protein	unknown	unknown	gnl\|CDD\|377230
NZ_CP007155.1\|WP_025359601.1\|7130270_7131707_-\|carboxylesterase/lipase-family-protein	unknown	unknown	gnl\|CDD\|365897
NZ_CP007155.1\|WP_042220993.1\|7151719_7153543_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377548
NZ_CP007155.1\|WP_025359603.1\|7132777_7133641_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|181382
NZ_CP007155.1\|WP_158510855.1\|7157160_7157304_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359600.1\|7129646_7130189_+\|snapalysin-family-zinc-dependent-metalloprotease	unknown	unknown	gnl\|CDD\|280248
NZ_CP007155.1\|WP_081789626.1\|7144725_7148046_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173812
NZ_CP007155.1\|WP_025359602.1\|7131708_7132656_-\|catalase-family-peroxidase	unknown	unknown	gnl\|CDD\|163709
NZ_CP007155.1\|WP_081789995.1\|7148267_7148447_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_081789994.1\|7140397_7141408_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|183405
NZ_CP007155.1\|WP_025359604.1\|7133948_7135172_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379258
NZ_CP007155.1\|WP_025359607.1\|7138765_7139044_+\|NAD(P)-transhydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|378941
NZ_CP007155.1\|WP_025359615.1\|7149978_7151664_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359608.1\|7139040_7140417_+\|NAD(P)(+)-transhydrogenase-(Re/Si-specific)-subunit-beta	unknown	unknown	gnl\|CDD\|376743
NZ_CP007155.1\|WP_148309727.1\|7143941_7144679_+\|serine-protease	unknown	unknown	gnl\|CDD\|214473
NZ_CP007155.1\|WP_025359613.1\|7148506_7148710_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025359618.1\|7156145_7157183_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.00892e-110
NZ_CP007155.1\|WP_025359605.1\|7135602_7137330_-\|fatty-acyl-AMP-ligase	gnl\|CDD\|341254	cd05931, FAAL, Fatty acyl-AMP ligase (FAAL). FAAL belongs to the class I adenylate forming enzyme family and is homologous to fatty acyl-coenzyme A (CoA) ligases (FACLs). However, FAALs produce only the acyl adenylate and are unable to perform the thioester-forming reaction, while FACLs perform a two-step catalytic reaction; AMP ligation followed by CoA ligation using ATP and CoA as cofactors. FAALs have insertion motifs between the N-terminal and C-terminal subdomains that distinguish them from the FACLs. This insertion motif precludes the binding of CoA, thus preventing CoA ligation. It has been suggested that the acyl adenylates serve as substrates for multifunctional polyketide synthases to permit synthesis of complex lipids such as phthiocerol dimycocerosate, sulfolipids, mycolic acids, and mycobactin.	7.91588e-163
NZ_CP007155.1\|WP_025359606.1\|7137665_7138769_+\|NAD(P)-transhydrogenase-subunit-alpha	gnl\|CDD\|240629	cd05304, Rubrum_tdh, Rubrum transdehydrogenase NAD-binding and catalytic domains. Transhydrogenases found in bacterial and inner mitochondrial membranes link NAD(P)(H)-dependent redox reactions to proton translocation. The energy of the proton electrochemical gradient (delta-p), generated by the respiratory electron transport chain, is consumed by transhydrogenase in NAD(P)+ reduction. Transhydrogenase is likely involved in the regulation of the citric acid cycle. Rubrum transhydrogenase has 3 components, dI, dII, and dIII. dII spans the membrane while dI and dIII protrude on the cytoplasmic/matrix side. DI contains 2 domains in Rossmann-like folds, linked by a long alpha helix, and contains a NAD binding site. Two dI polypeptides (represented in this sub-family) spontaneously form a heterotrimer with dIII in the absence of dII. In the heterotrimer, both dI chains may bind NAD, but only one is well-ordered. dIII also binds a well-ordered NADP, but in a different orientation than a classical Rossmann domain.	5.05548e-168
NZ_CP007155.1\|WP_158510853.1\|7153981_7155880_-\|alpha-galactosidase	gnl\|CDD\|269893	cd14792, GH27, glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.	6.32405e-69
NZ_CP007155.1\|WP_030110958.1\|7148736_7149966_-\|YeeE/YedE-family-protein	gnl\|CDD\|377230	pfam04143, Sulf_transp, Sulphur transport. This is an integral membrane protein. It is predicted to have a function in the transport of sulphur-containing molecules. It contains several conserved glycines and an invariant cysteine that is probably an important functional residue.	7.4291e-52
NZ_CP007155.1\|WP_025359601.1\|7130270_7131707_-\|carboxylesterase/lipase-family-protein	gnl\|CDD\|365897	pfam00135, COesterase, Carboxylesterase family.	1.4288e-108
NZ_CP007155.1\|WP_042220993.1\|7151719_7153543_-\|hypothetical-protein	gnl\|CDD\|377548	pfam05694, SBP56, 56kDa selenium binding protein (SBP56). This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homolog of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport.	0.00118003
NZ_CP007155.1\|WP_025359603.1\|7132777_7133641_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|181382	PRK08317, PRK08317, hypothetical protein; Provisional.	2.94411e-18
NZ_CP007155.1\|WP_025359600.1\|7129646_7130189_+\|snapalysin-family-zinc-dependent-metalloprotease	gnl\|CDD\|280248	pfam02031, Peptidase_M7, Streptomyces extracellular neutral proteinase (M7) family.	2.69308e-38
NZ_CP007155.1\|WP_081789626.1\|7144725_7148046_-\|S8-family-serine-peptidase	gnl\|CDD\|173812	cd07487, Peptidases_S8_1, Peptidase S8 family domain, uncharacterized subfamily 1. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	7.25526e-34
NZ_CP007155.1\|WP_025359602.1\|7131708_7132656_-\|catalase-family-peroxidase	gnl\|CDD\|163709	cd08153, srpA_like, Catalase-like heme-binding proteins similar to the uncharacterized srpA. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes involved in the protection of cells from the toxic effects of peroxides. It catalyses the conversion of hydrogen peroxide to water and molecular oxygen. Several other related protein families share the catalase fold and bind to heme, but do not necessarily have catalase activity. This family contains uncharacterized proteins similar to the Synechococcus elongatus PCC 7942 periplasmic protein srpA, of mostly bacterial origin. The plasmid-encoded srpA is regulated by sulfate, but does not seem to function in its uptake or metabolism.	4.34123e-118
NZ_CP007155.1\|WP_081789994.1\|7140397_7141408_-\|AI-2E-family-transporter	gnl\|CDD\|183405	PRK12287, tqsA, pheromone autoinducer 2 transporter; Reviewed.	1.68791e-44
NZ_CP007155.1\|WP_025359604.1\|7133948_7135172_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379258	pfam13556, HTH_30, PucR C-terminal helix-turn-helix domain. This helix-turn-helix domain is often found at the C-terminus of PucR-like transcriptional regulators such as Bacillus subtilis pucR and is likely to be DNA-binding.	3.73365e-16
NZ_CP007155.1\|WP_025359607.1\|7138765_7139044_+\|NAD(P)-transhydrogenase-subunit-alpha	gnl\|CDD\|378941	pfam12769, PNTB_4TM, 4TM region of pyridine nucleotide transhydrogenase, mitoch. PNTB_4TM is the region upstream of family PNTB, pfam02233, that carries four of this transporters transmembrane regions. PNTB is the beta-subunit of pyridine nucleotide transhydrogenase. This family forms part of the Proton-translocating Transhydrogenase (PTH) Family.	9.3092e-32
NZ_CP007155.1\|WP_025359608.1\|7139040_7140417_+\|NAD(P)(+)-transhydrogenase-(Re/Si-specific)-subunit-beta	gnl\|CDD\|376743	pfam02233, PNTB, NAD(P) transhydrogenase beta subunit. This family corresponds to the beta subunit of NADP transhydrogenase in prokaryotes, and either the protein N- or C terminal in eukaryotes. The domain is often found in conjunction with pfam01262. Pyridine nucleotide transhydrogenase catalyzes the reduction of NAD+ to NADPH. A complete loss of activity occurs upon mutation of Gly314 in E. coli.	0
NZ_CP007155.1\|WP_148309727.1\|7143941_7144679_+\|serine-protease	gnl\|CDD\|214473	smart00020, Tryp_SPc, Trypsin-like serine protease. Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.	2.34437e-51

>NZ_CP007155.1|WP_081789994.1|7140397_7141408_-|AI-2E-family-transporter
MKAAAWLIAPTLLALVIVIVLNPVHRRLRRRGVPSWAATLALVVLVYGVLVTFGAVLVVSLARLAALLPRYEDLARALLADAVDLAGRWGVGHDQLRQVVNSLDPGRLMSALSALLGDLAGVTTSLVFLLALLLFLSLEASGVDVRLAEIAKDRPQIQGALGDFARRTRRYLVVTTVFGLVVAVLDTLALAWLGIPLAVLWGLLSFVTNYIPNIGFLLGVVPPALLGLLGAGWRCALAVLGVYAVLNFVVQSLVQPRFVGDAVGLSTALTFLAVVFWAWVLGPLGALLAVPATLLVMTVLVDIDPRAGWALALLRAPQRRKGHRRRAASRLIPPAS
>NZ_CP007155.1|WP_025359608.1|7139040_7140417_+|NAD(P)(+)-transhydrogenase-(Re/Si-specific)-subunit-beta
MIIQLVYLAAATCFVLGLHLMNSPATARRGNLVSAAGMVAGVLATAVLIAEQNLIKPTGWAVLLAGSAVGAVLGLVSARTVRMTAMPQLVSLFNAVGGGAAALVAVDEVLRGSGGAVTVVLDVLIGAVTFTGSLLAAGKLQGLVPGRPVVFAGARALNLVLALVMLLGGGYFALVRPDPLVITAVGLAALVFGVTMVLPIGGADMPVVISLLNAFTGTAVAMAGFVIANDMLVIAGALVGASGAILTKLMADAMNRSLASILVGGFGTGDGDPSVAVGASAQVREVAVDDAAIQLAYAHRVVVVPGYGLAAAQAQHEVRELAEVLGAQGVDVSYAIHPVAGRMPGHMNVLLAEANVPYERLREMEQANPEFARTDVALVIGANDVTNPAARRPGNPVSGMPILDVDQARSVIVIKRSMGHGYAGIDNELYGDPKTGMLFADAKAGLAALTAAVKTLVG
>NZ_CP007155.1|WP_025359607.1|7138765_7139044_+|NAD(P)-transhydrogenase-subunit-alpha
MRAVAGLSVFVLSLLVGFEVISKVPATLHTPLMSAANSIHGIIVVGAMLIAASADTVLGYVLAFLASAFAAMNVVGGYVVTDRMLRMFRGRR
>NZ_CP007155.1|WP_025359606.1|7137665_7138769_+|NAD(P)-transhydrogenase-subunit-alpha
MRAELTVAVLRETAPGERRVALVPEGVRALTDAGARVLVENAAGELAHHPDSSYTEAGAEVVPRETALAQAGILLVLHCPLPTGLRKGQVLIGLLAGADLPALAERGVTAIGLEGLPRKLSRAQSMDALSSQDNVAGYKAVLVAAQVYPRYLPMLITAAGTAPPARVLVLGVGVAGLQAIGTARRLGAVVTAYDIRPETAEEVRSLGASFLELATAIAGSGQGGYARALTAEEEQAQRHELDAHIARHDIVITTARVPGRKPPLLVTEQAVKAMVSGSVVVDLAAGPLGGNVELSEPGVTRVTENGVTVIGAEGLAATVPSAASAAYSRNLLALLRHLLHEGEPRIDLTDEIQAGVVRTHDGRETGA
>NZ_CP007155.1|WP_025359605.1|7135602_7137330_-|fatty-acyl-AMP-ligase
MDTTPGARHSLADCLAEWSLSHAEDAALTFVDHRGSPDGLAVTLSWSALHRRVSATAAWLQRVARAGQRAVLLAPQGLDYVVAFLATLRARVVAVPLAVEDVLDNREYLAEVFADCTPNWVLTTGPLLTEMRDFLDEQRLTDTVQTIAVDAVPEALAADCRPVHVHPEDIAYLRYTVDALGAPAGVVISHGNLVAGGLRAVEACGAVPGRTVSVTWQPLSRDLGLIMAVVAPLTARLRVVLLDPGAVLEQPRRWLQVLSATQGAITAAPDFALAYCASRVSEQDRVWMRLGQVAALVNGGEPIRPDTVRAALDVFGECGLLPQALRACYGSPESAGPVSITAAGAPPRQLTVDRELLAAGKAVPRTGSDHRSTTLVSSGVPVRGELLVVDPDLRWPLSDDLVGEIWVSGATVARGHWGRDAAEQDVFGAKLDDPVLGTESWLRTGDLGFRHEGELYVIGRQEDLLTVNGRHLDPREVELTARAAHSALRPDGLVAVSVPTPRGDAVTVFAERSQHVSPKDLDLGAITEAVRCAVTARFGVAVDQVLVLEPGRIPFTSAGRVARSVCRQRYLDGTL
>NZ_CP007155.1|WP_025359604.1|7133948_7135172_+|helix-turn-helix-domain-containing-protein
MTGMIEAQDTATELFEALPRGLGALLRPELGSLADEILRCLQRRIPEYSTPLDGPYGQKIRAGVEYALRQFADQVSTPGAVCEDQAELYKQLGRLEAKAGRSLDALQAAYRVGGQLAWRRITEFGQRSRLPAHTIWQLGEAALAYIDGLAALSAEGFAEVRANAAGTKRRQHRRLVRLLLTEQPPPAATLAEVCEQVGWTVPKRVSVVVLQRLDQGRPAEPPAPLVADLDGIEPLVIMPEPEEHPLPVAGLTGWRALVGPSVPLAEAAKSLRQAMALRELVRTGIVSAEDVVRSEDHLSTLWLLSDEVLAKQLVAKRLAPLSGLTDKQSHRLGRTLLAWLETRGGAPEIATRLGIHPQTVRYRMRQVEQLFGEQLRDPTARFELEVALRAAALAAGEPTCPEDDELD
>NZ_CP007155.1|WP_025359603.1|7132777_7133641_-|methyltransferase-domain-containing-protein
MDTGGKGVFGGVFDRVAQVYDTTGVEFFKPMARRLLEHLAPRPGERALDVGCGRGAVLFPLAEQLGPTGSVVGIDLAAAMVTATGAEVAQRGLDTVGVRLMDGTAPEFPPGSFDLVAGSMSIVMIPDLPRAFANYLTLLGPGGRLGLTAPTPPGGLGTWRLGPLDADLLAAAIDPAVLDADPGLSGFVRDTAFGGARSLVPVLREAGFAEVEVHEEDLPICAADAGELVAWTQSHGMRIVWEAIPPARRAGVEAALAASITERNGGPGPIRFGFPISYLVARSGRSG
>NZ_CP007155.1|WP_025359602.1|7131708_7132656_-|catalase-family-peroxidase
MSPQPPTGVHPQLAVDVVDRLEWVSGLYPGYRRAHAKGACYRGVFLPSGKVSTLTTAAHLQVDPVPATVRFSNFSGNPYIWDRSRSARGLSVSFHLPGGVSTDLVMVSQPVFVAATPQDMWEFLQAAEPDVFTGSPDPEVLRRYATEHAESFRGLRAVKKTPIPVSYATLRYWAVHAFVWVNRRLQRTAVRYRWEPEAGVQQLTDERAAAKSPNYLHEELAERLANGSVAFTLRVQLAGPGDATDDCTALWPADRTELTAGRLLVTGEVEDQAKAEQRMFDPTRLVPGLELSDDPMLAFRAQVYAVSHSRRTRGS
>NZ_CP007155.1|WP_025359601.1|7130270_7131707_-|carboxylesterase/lipase-family-protein
MPHLISTPHGQVRGVEFDGVRAWRGIPYAQPPTGPLRHRAPRPVTPWSGVRGATEFAARAPQPPPLFRVVPPRRPAHSDDPDLTSEDCLYLNVCAPARPASAPRPVLVWLHGGGYSTGSGPEGIGDGETLVREHDLVVVTVNYRLGAFGFLNLGGESANCGVLDQIAALGWVRDSIGAFGGDPAQVTVAGVSAGAKAVATLLAAPLASGLFTRAVSISGGGDHVATQQVSAEWADRFCALLGIGPERVGEVPAAELVAAQQQLSSLPTGLWRWRPTVDGVVLPDLPARRIAAGSAPGVALLAGTTAHEANTFQVLDPRCADRAPAVLTEAFGADRAQRLLAVYEGDLLGVMTDERYGVPTVRLLDGQSAHAPAWRYRFDGAAPWLPAGMAAGHGTDVPFHWAVGGLHHPDPDTAGLLRAASEQFGRFVRTGRCDWARYEPSRRATRVLDAKPHVAEDPGALRRAAWDGLTWPSGTWYR
>NZ_CP007155.1|WP_025359600.1|7129646_7130189_+|snapalysin-family-zinc-dependent-metalloprotease
MSARPIGRVVLGLAAVLLPLAGAQVFTATAAEAATTQAVTLYYDSSDAPDYQSQADQAAANWNGVVHNVQLSSGGSATILIHEVTGGGSYTQTDGHGHGDIYIDVQQVNEGNDPTRILAHEMGHNLGLPDHYEGPCSEIMSGHGPGTSCKNAMPNAQEAAQVDQNFANGFTPALASHLYR
>NZ_CP007155.1|WP_148309727.1|7143941_7144679_+|serine-protease
MRRTLIGIVTTVLLLGGAAPALAQPEIIGGQVATGSWTWITALLTPDGKQYCGGSLIAPKWVLTAAHCVDDSTSRDAARIGSNDRTSGGTVVGIKRAVPHPQFGPDFDNDIALVELAKAVTNKPAVLGTGTNWDGYTLRLFGWGQTCPVKGCNGGSDRLLRVDNTALPQEKCRAQGTGFHPEHELCMDSRNQRTACYGDSGGPAVYMVNERVIGVTSRGSRSCGDQDTLYTRVQPYLSWIKSYTG
>NZ_CP007155.1|WP_081789626.1|7144725_7148046_-|S8-family-serine-peptidase
MTHRQQRRRLMLIAVTVGGLIAAAAPTTAAADPALSQGAQQSVIVVLRDQHPELPVRTQKSQRQAKVRQDQTPLLNQARGAGAQNLKTYDVVNGFSAKVTAAEASHLAADPSVAAVVPDRTRAVRPLSTEQRSDLKAAADKPLANGVCPADPGKPLLEPEALQTTHTAFTNPSLPQAQNLVDGKGVSVAWIADGLDPHNPDFIRADGTPVFTDYQDFSGTDPNGPQGGEEAFGDASSIAAQGRQVYDLSTVVAAAHPLPKGCNVTVRGIAPGASLVGLNVFGSAALVTNSIVLQAVDYAVNVANVDVINESLGGNPFPADGVDPVALANDAAVAAGVTVVASTGDAGPSGTIGTPAVDPHVISAGSVTNYRLYAQTGERGARTFATSWANDNMSALSSGGVDDLGRVPDLVAPGESGWSLCTADPRFSQCTDEQGRPSAIRTFGGTSEAAPFIAGGAALVIQAYKQTHGGQRPDPLLVKQILTSTATDLGHPAYEQGAGEMNTYAAVRMAMSVQDGNGTPSRQGAGLLTSTTGGDTQLTAAGKPGATQNLPLTVTNTSPNTQVVSAHGRILSQQLSDKVGSIALDVTSDTTPSFVDGTSALRRYASTTFTVPLGADHLQGSLAWPGTPAQTQTVRMALIDPNGVYQSDSRPQNSASQANHGRVDVHYPAAGTWTAVFYATAGSPGFKGNVAYEFTATKYADFGKLSPSTLTLKPGQSGTFHVTAKAGDQPGDTSAAVELDTALGERTSVPLTLRSLVTPDKAFTGTIVGGNGRDYSPAQTQTYWFDVPAGKRDLAVDLSLGGDPNQTVFGALKAPSGQVLSLATNGGGKSLQSTVRAPEKGRWELVVNVNQGVSGTALSQPFTGHLRFDTVDAHATGLPTGGKVAAGKPITVKVKVRNTGVAPSGFFADPRLTQESDQQLVVLPPSSATIALPAPATAIGPNWLVPTETRSLTFQQSSTIPADFDISAYSGVPELHGVPRGLSASATSTAAEVTQGQWAGLPTAIGPTDGPVSGSATLAAVVHAQGFDTAATSTTGDLWRSSTSANPPAFSPLSLAPGQTGEITVTLTPSGAPGSKVSGVLYVDSYSSVLGSGDELTAIPYSYTVG
>NZ_CP007155.1|WP_081789995.1|7148267_7148447_-|hypothetical-protein
MLGFAAPAMADTAPSGGGVVVVDQPDTSNLNNIWTFAPLGVPVFGTIQAVLQAPARLLG
>NZ_CP007155.1|WP_025359613.1|7148506_7148710_-|hypothetical-protein
MSTVVSRAVAGTVAALALTGLTGGIAHAGTPVYVLPGVDLGSVLDPTVPVPTEALGPIAHLLTFLHG
>NZ_CP007155.1|WP_030110958.1|7148736_7149966_-|YeeE/YedE-family-protein
MTAVSSEVPRHLPAPSAKVGVTSVGVVLAIVLGSAVYHAAGPIMTLLFGIGIALGLVLFHSRFGFTSAWRQVVVVGQGAAIRAHMLMLAVACLLFAVILGSGLGLSGVPKGTVLPTSIGVALGAFLFGIGMQVGGSCASGTLFAVGSGQTAILYTLGGFVLGSIASAFAADWIVYMQSLGPTVNLAATPWGYPGGLLISFAIIGAIVGISLVVQRLRKPPPVEQPPTAHGVLRVLRGAWPLWVGALLLAGLNALTLFVAGGPWGITSAFALWGAKILGWVGIDISHAPYWSVPRNAAALHASVLTDRVSVMDFGIMIGALIASALAGAFVLHRAVPWRMALGAVLGGIAMGFGARLAGGCNIGAYFSGVASFSLHGWLWGVMAIGGTLVGVRLRPLFGLGNPKPTDSVC
>NZ_CP007155.1|WP_025359615.1|7149978_7151664_-|hypothetical-protein
MHMSDMGTQAVSAGAVLVRILLLLAGATIAGIGLVRPAVAEVRRPALVLAWTAAAATVVADVVSIVVYEVNPVFAVVQLVLALAVPPLLRWRSAPAYAGFGLFVVLVSEISLDHMGIEFFADTAYTVAAVLWIGITVLGTGGWQPERLRPKPVALTLAAVLVLAGIVQIAASGVALDRRLYTTGFGLLLIVVAVLPLVVTALVLTRPRFFPLGVTVVVAAYVAWSALIAVPKPLDLPTPGVPLLVSQPTPLLLTPQRPGRNLVHVPAGSVTVRAGDEPPVTAVSRPGADGAWAEVTLPAGRSTLTVERDGVSSTVDVDTGTDPLQVNAVGADGPECAGAALGGLLGGSRAALASCPADELSTEDADSLRSMIGFLASKSVPAITLVGDESPRARAAAALVRANAEQMHIPVVTEEAPNNALLLVSGWTRAATELSLVATEQTERPTFTRGVYLAPWLLTGPLVKSVVSSAVPLRFDPREQRSLNYTLDLASAFEGQSASVAGFQRWLAARGQRLDEPVRIYACAQVDVMQMSEHMNGMDMNYPGQWVPSATVVPISGPLPD
>NZ_CP007155.1|WP_042220993.1|7151719_7153543_-|hypothetical-protein
MPLKSLGGRRVRTGAAAVLVAAAAVTFPIAGTSAYADVQVSTQHVAGADGKDYTVTNHLVGNYAARQEQRKEWLLVWAGDENIADTAVSDIKNLPGTVGGVVNKLPGALPGPDFLAVIDATKGSPTYGKVVNTATVGPLVENEPHHMQYVWHKGDTIYAGALFAAATYAFDVSALPNLKLKGISLPSQTLGGSVPDAYWTLKDGTAYGTYMGGPVVPGPYIYDNGSVQIGNGFAGSPGEVVHFDRDGKVLSQSPAATPQGDNEKLCDDLPRLGAPTCANPHGIQAREDLNTMVTSDYAEPRNIILDPVKQPSPYLRRPTIRTWDISDRNHPKLKAVSYLQDGPRANPADPLHAESRAVMETTVTNLPGHKGAFAQTMQGGAIFYTPDITAAQPHWREVFDDGAANKSFDAKADSVGSSSNGGWVQTSPDDHYLYHAVIGRQKGTLGSDDPGTVGGVYTLDISKLLAAGDNYTCTIDTKAKAENGGGGDCPTLAGAAAINPGKPGQGPHWGTYDNFQLGGDGFYHETDQPGRVAVSDYFVARSGLDGDHKVTMVDLGKDGKLTVDTAFRDENSGQVGINFNRKSWPHGDFGNAKPHSELFVVADADVK
>NZ_CP007155.1|WP_158510853.1|7153981_7155880_-|alpha-galactosidase
MARGRLRVLTPAVLGLALLGAVPAHANDGVSQPATNYSSAATPASAIAPVPPMGFNNWARSTCAAQAPLDGSPTASYSFQQYMKDNAKGLVDSGLAAAGYQTITVDDCWMRRTAAGYLHGATTWGGSSQPGFDYELTDYGDYLHGLGLKFGIYESSGTNTCSTTPNTATGSEYHEQDDANSFVYWGVDALKYDNCQTKEPLKTLDGRMSAALATAVGNAAAGGRKTPNVLFNESAPAAYNNGATKFDVMNWVRDHGQQWRVGPDIWNYAASTDPWDKALSGYNFGAYQSFDTTVDLARYQSPGNWNDADMLLIGDNGMSSAEERSQLALWSAMAAPLFISTDARKFTPSYLDAHPDQAAHLRESIRTLGNAEVLAVDQDPLGAGGYRVSGGAARSDGTPSSASGIDLVVKQLADGSRAVVVLNKGSAATNYSLSLSDLGFSGTGCTYSVRDLWAHTDSTSTGTVPLTIGSHDNAMLKVKGCSFAPTGQITVARGDWGKAALCLDNYASGTAANNPVVVYQCTSGANQRWTRNADGTVKLANGLCLTARSGTSTSPVNGASGRFVGVAGCGSAPSSQKWDYTRDGQLKLSGTALCLDVYGGSTSTASTPVDVYTCAAAGSLQNNQTWSAPFIR
>NZ_CP007155.1|WP_025359618.1|7156145_7157183_+|LacI-family-DNA-binding-transcriptional-regulator
MATISIREVAARAGVSVGTVSNVLNRPDLVAESTRERVREAISALGFVRNESARQLRSGTARAIGLIVPDVGNPFFTDVAKGMEDTASEAGHAVILCNSDESAQRQERHLDLLTEQRVHGVLITPVDDSPEPVLRLRERGVSVVLLDHATALSDTCSVTVDHRIGGELAVRHLLEQGHRELAMINGPESVTQCLHRAQGARDALREAARAPGDLHVVEVPAMNVASGLAAGERLLTGNRPDAVFCANDLLALGLLQAAVRHGVRVPHELAIVGYDDIDFAAAAAVPLTSVRQPSRLIGRTAAELVIAETRDPGGHAHQRVVFTPELVVRESSRRPADQLSPCPER
>NZ_CP007155.1|WP_158510855.1|7157160_7157304_-|hypothetical-protein
MGRLMDIEPVELGWEPERDALHAGQEWIPWQADHEDGFEPIIVRGMD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_17

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_17

7342601-7342750

Orphan

I-C,I-E,II-B

Consensus_repeat	Method
GTGTTCCCCGCACGAGCGGGGGTGGTCC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP007155_17

>merge|NZ_CP007155|17|7342601-7342750|CRISPRCasFinder
GTGTTCCCCGCACGAGCGGGGGTGGTCCGTCGACTTGCACCGGATGCAAGCACCCGCCGTGGTGTTCCCCGCACGAGCGGGGGTGGTCCCTCGCTGTGATGCTGGGCGCACAGGATCAGGTCGTGTTCCCCGCGCGAGCCGGGCTAGTCA

>NZ_CP007155|17|16|7342601-7342750|CRISPRCasFinder
GTGTTCCCCGCACGAGCGGGGGTGGTCC	GTCGACTTGCACCGGATGCAAGCACCCGCCGTG
GTGTTCCCCGCACGAGCGGGGGTGGTCC	CTCGCTGTGATGCTGGGCGCACAGGATCAGGTC
GTGTTCCCCGCGCGAGCCGGGCTAGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_148309743.1\|7335483_7336104_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_063750709.1\|7337007_7338126_-\|NADH:flavin-oxidoreductase	unknown	unknown	gnl\|CDD\|240095
NZ_CP007155.1\|WP_042221021.1\|7338231_7338828_-\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378696
NZ_CP007155.1\|WP_025359781.1\|7342786_7343395_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|188483
NZ_CP007155.1\|WP_025359788.1\|7351225_7352428_+\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340817
NZ_CP007155.1\|WP_030107999.1\|7344693_7345503_-\|glycoside-hydrolase-family-16-protein	unknown	unknown	gnl\|CDD\|185693
NZ_CP007155.1\|WP_030108000.1\|7346478_7348923_+\|CHAT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378942
NZ_CP007155.1\|WP_025359777.1\|7338912_7339368_+\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
NZ_CP007155.1\|WP_025359772.1\|7331144_7335440_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368582
NZ_CP007155.1\|WP_030108001.1\|7348986_7349424_+\|nitroreductase-family-deazaflavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|281995
NZ_CP007155.1\|WP_081789639.1\|7327564_7330837_+\|CHAT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378942
NZ_CP007155.1\|WP_025359782.1\|7343465_7344638_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP007155.1\|WP_025359787.1\|7350486_7351152_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|238194
NZ_CP007155.1\|WP_025359783.1\|7345841_7346288_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359774.1\|7336230_7336833_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|223340
NZ_CP007155.1\|WP_025359785.1\|7349416_7349713_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025359778.1\|7339439_7340069_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235615
NZ_CP007155.1\|WP_025359779.1\|7340432_7341893_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP007155.1\|WP_042222822.1\|7349702_7350452_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|378278
NZ_CP007155.1\|WP_025359780.1\|7341892_7342528_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|222984

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025359788.1\|7351225_7352428_+\|glycosyltransferase-family-1-protein	gnl\|CDD\|340817	cd03784, GT1_Gtf-like, UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.	4.3798e-48
NZ_CP007155.1\|WP_063750709.1\|7337007_7338126_-\|NADH:flavin-oxidoreductase	gnl\|CDD\|240095	cd04747, OYE_like_5_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 5. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.	0
NZ_CP007155.1\|WP_042221021.1\|7338231_7338828_-\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	1.01565e-13
NZ_CP007155.1\|WP_025359781.1\|7342786_7343395_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|188483	TIGR03968, transcriptional_regulator_TetR_family, mycofactocin system transcriptional regulator. Members of this family are TetR family putative transcriptional regulators that occur in genome contexts near proteins of the mycofactocin system. These include the precursor peptide (TIGR03969), a radical SAM peptide maturase (TIGR03962), and a putative carrier protein (TIGR03967). [Regulatory functions, DNA interactions].	2.60396e-17
NZ_CP007155.1\|WP_030107999.1\|7344693_7345503_-\|glycoside-hydrolase-family-16-protein	gnl\|CDD\|185693	cd08023, GH16_laminarinase_like, Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.	3.47463e-109
NZ_CP007155.1\|WP_042222822.1\|7349702_7350452_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|378278	pfam09859, Oxygenase-NA, Oxygenase, catalyzing oxidative methylation of damaged DNA. This family of bacterial sequences is predicted to catalyze oxidative de-methylation of damaged bases in DNA.	9.42678e-112
NZ_CP007155.1\|WP_025359777.1\|7338912_7339368_+\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	2.66447e-97
NZ_CP007155.1\|WP_025359772.1\|7331144_7335440_+\|hypothetical-protein	gnl\|CDD\|368582	pfam05729, NACHT, NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.	0.000160045
NZ_CP007155.1\|WP_030108001.1\|7348986_7349424_+\|nitroreductase-family-deazaflavin-dependent-oxidoreductase	gnl\|CDD\|281995	pfam04075, F420H2_quin_red, F420H(2)-dependent quinone reductase. This family of proteins is found in the genera Mycobacterium and Streptomyces. Member protein Rv3547 has been characterized as a deazaflavin-dependent nitroreductase. Rv1558 is an F420H(2)-dependent quinone reductase involved in oxidative stress protection.	1.77183e-23
NZ_CP007155.1\|WP_081789639.1\|7327564_7330837_+\|CHAT-domain-containing-protein	gnl\|CDD\|378942	pfam12770, CHAT, CHAT domain. These proteins appear to be related to peptidases in peptidase clan CD that includes the caspases. This domain has been termed the CHAT domain for Caspase HetF Associated with Tprs. This family has been identified as a sister group to the separins.	8.86577e-15
NZ_CP007155.1\|WP_025359782.1\|7343465_7344638_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	5.62242e-78
NZ_CP007155.1\|WP_025359787.1\|7350486_7351152_+\|peptidylprolyl-isomerase	gnl\|CDD\|238194	cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases. This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the immunosuppressive drug cyclosporin (CsA). Immunosuppression in vertebrates is believed to be the result of the cyclophilin A-cyclosporin protein drug complex binding to and inhibiting the protein-phosphatase calcineurin. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. Cyclophilins are a diverse family in terms of function and have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. This group contains human cyclophilin 40, a co-chaperone of the hsp90 chaperone system; human cyclophilin A, a chaperone in the HIV-1 infectious process and; human cyclophilin H, a component of the U4/U6 snRNP, whose isomerization or chaperoning activities may play a role in RNA splicing. .	3.2706e-36
NZ_CP007155.1\|WP_030108000.1\|7346478_7348923_+\|CHAT-domain-containing-protein	gnl\|CDD\|378942	pfam12770, CHAT, CHAT domain. These proteins appear to be related to peptidases in peptidase clan CD that includes the caspases. This domain has been termed the CHAT domain for Caspase HetF Associated with Tprs. This family has been identified as a sister group to the separins.	2.9848e-12
NZ_CP007155.1\|WP_025359774.1\|7336230_7336833_-\|dihydrofolate-reductase	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	4.49875e-23
NZ_CP007155.1\|WP_025359778.1\|7339439_7340069_+\|hypothetical-protein	gnl\|CDD\|235615	PRK05812, secD, preprotein translocase subunit SecD; Reviewed.	1.91823e-23
NZ_CP007155.1\|WP_025359779.1\|7340432_7341893_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	9.56683e-73
NZ_CP007155.1\|WP_025359780.1\|7341892_7342528_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|222984	PHA03100, PHA03100, ankyrin repeat protein; Provisional.	2.1049e-06

>NZ_CP007155.1|WP_025359780.1|7341892_7342528_+|ankyrin-repeat-domain-containing-protein
MQDAEWDGVTLRSDYREEHVAKRDGLADAARDGNWPYVLEAVTGSGMVNSTRVGGPSGYAPLHQAAWHGVRPDIAQRLLDLGAWRTLRTSDGERPVDIAVRKGHLLLAEVIRPRSEEDLSELEHQLHELIRHRIPDLVTEHALRLPQIHVLTELTNPCLRFPVPGLYGGFSIELTGRELIVKSWCRVAGGWAQTHRVTSEGYELIESGWDL
>NZ_CP007155.1|WP_025359779.1|7340432_7341893_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQRTIGSTAGGTESAAADRRSRWTALIVLCIGMFMIVLDGTVVNVALPAIQSDLGFTQSSLAWVVNAYLIAFGGLLLLAGRLGDLLSRRGMFLSGLGVFTVASLLCGLAPTKELLVAARFVQGVGGAMTSAVVLGMIVTLFPGQREQAKAIGAYGFVATAGASVGLLAGGVLTQVLSWHWIFMINIPIGLITGFVALRLLPADRGVGVGRDTDFLGAALITGSLMLGVYTIVTPAAELGWTAPQTLLLAGATLVLLIAFVAREATARNPLVPLRIFRSRNVSGANAIQALTVAGMFGMFFLGVLYLQQVLGYDALQTGLAFLPTTVVIGTLSLRYSERLITQFGARTVLLPGLVLIAAGLALFARVPVPGNYLTDVLPPTLLMGVGIGVSFPTLAALAMSGATEDDAGLASGLVNTTMEVGAAVGLAVLATLSATRTRELAAAGVNAVTALTGGYQLAFLIGAALVVVALVIGLVVLRNEPKPETE
>NZ_CP007155.1|WP_025359778.1|7339439_7340069_+|hypothetical-protein
MIHEPRHRADRSWPILVPVTILGAIALFCGVATQFVLTTRTTPTPAETTLVFRPVVEDSAAVQRSAQSTVDRQAAGLTARALEDLDCSRLRPLPGKEDPRKPLLTCDHARQTRYLLGPAFLDASGIQSARATFESEQGSWVVWLTFTPEGARTWSDYTGTHVGGQVAFTLDGEVVSAPRINQPIAGDTQVSGSFTEQAARQLAEALTRN
>NZ_CP007155.1|WP_025359777.1|7338912_7339368_+|ribonuclease-HI
MAVVEIYTDGACSPNPGPGGWGAVLRYGGHEREMYGGEAGQTTNNRMELMAPIQALETLTRPSVVRIYTDSTYVRNGITQWMAKWKRNGWQTSGRQPVKNADLWQRLEQAGSRHEVEWLWVKGHAGHPENERADRLAVRGVHEVTGRAERP
>NZ_CP007155.1|WP_042221021.1|7338231_7338828_-|CGNR-zinc-finger-domain-containing-protein
MSAVSWPASDRYGMEPAPGCLGYVHDLLNTLSAGRPRQPDLLADLARARDWADRALATWSAVTGHPARQVVLDQDDVDQLRGFRDDLHERVTAGGTLDCATVVHTASASLCMGEDGRVRLAPRGTGWRYLASLALVTALEAQCAEVWCRLKTCRNPRCAIAFYDRSRNNSGVWHDVRVCGNAANLRAYRARQRGDLPA
>NZ_CP007155.1|WP_063750709.1|7337007_7338126_-|NADH:flavin-oxidoreductase
MMVSVEQASRVSRVLDRPFTVGDLTVRNRIVMAPMTRTQSPNGVPGPDVAEYYARRAANEVGLIVTEGTYVNRVAASAYENVPHFYGEQSLAGWAHVVERVHQAGGRIIPQLWHTGAARTAEEPPAEGPSGLALDGTPLGKAMTQQDIDEVVAAFAEAAAAAERLGFDGAELHGAHGYLIDNFLWSGTNRRTDSYGGDHASRARFATEIVQAIRAAVSPGFPIFFRLSQWKAYNYQARIAENPAELEQLLAPLAEAGVDAFHASTRRYWVPEFEGSELNLAGWVKKLSGKPTVTVGSVGLDTEFTPATGEGNQPGAGVTGIDQLLDRLERDEFDLVAVGRALLSNPDWASKALRGKLAETVPYDVSVLKSLN
>NZ_CP007155.1|WP_025359774.1|7336230_7336833_-|dihydrofolate-reductase
MRKISAGLFISLDGVVENPQDWHFPYFNEEMGAAVLADMASADTLLLGRRTYDSFAGAWPEREAAGGEDAGMAKGLGDTRKIVVSNQELEFTWRNSEQLRGDLVEAVTALKDEPGADIAMSGSVSLVRQLLAAGLLDELHLLVHPIAVRQGMRLFDEGEAIPLRLISSQTFTTGVLSLRYGPAETTVTGTYEDAKVHLDQ
>NZ_CP007155.1|WP_148309743.1|7335483_7336104_+|hypothetical-protein
MRAIVPVLAAVSAALAFAVPANAGTAPILVHADLDGDGVADEVTLTPVADNAHEQLLTATVRGIQLTARVPFDSLFGLEPLRVVDLNGDGKQEVVVTESVGANTDGFSVWGLYGGLRPVTSGGADRFKLWEGGGFSAISGYGCEPAGGTRQLVTVSAELTDWQNEVYEGDRVTYSVRDGVATETSRRHVVGVRGEAGFRTDARTCA
>NZ_CP007155.1|WP_025359772.1|7331144_7335440_+|hypothetical-protein
MGRLQASFADELRRLHVAAGKPAYARLAKHSKVARSSLCDLLNGRFKRAPSWDVVRALVTACVAESVRDDHGRVPAEVAARGEVAWWLRRHGELVSGLEQERAGRTGGARGYAAEVNLVAGVPVRLLYLLQVERFTPRQLIGRDAEIAEMAEFCTAPEVPSAYRWWRAEAWSGKSALMAWFVLHPPVGVRVVSFFVTARWASQNDRTAFIENLVQQLLTLLGRRMPPLVSEATRETHLLGLLAEAAEACRRRGERLVLVLDGVDEDRGVHEGPDAHSIAALLPSTPPAGMRIMLAGRPRPPVPADVPAHHPLREQSVVQVLAPSPQAQAVREEMERELKRLLHGTAADQDLLGLVAAAGGGLSAADLAELTGLSRWEVDDRLKTVIGRSFSRRGSHYRPEDGPDTYVLGHEELQVTALEMLGQSRLERYRERLHSWADRYRAGEWPADTPEYLLRGYFGLLHATGEVDRMISCAIDPARQGRMLDLSGGDAAALTEITTTQEVLLRAARPDLLALTRLVMHRDRLADRNCKVPVELPAVWAILGQVNRAEAIASSITDRGDLVLALASVAKVVADTDRTRAVEIIDKAEIVTHSIAEGYDHRRALDAVIDAAAAIGDLDRAEAKARSIGDTKRRASALTTLAERVAATGDLLRASELVAEAEAAARSITEAAEQDRAMYSVVRALAVAGDLEQAESLARSFPDPVDRAHALALLAEAVAAADGERADEYLAEVETIAGTITEPEQHEQAQASIVCALAATGDLARAATTAHAIPRLIGRLWALHSVVRAATTAGDLDLAEKIACTMPACMSQPEIQLTSLMHVADEAAAAGDFDRSEALAESLGYPGLQLKTLARMARAAAARGDLARTSALVARLEAAARPTFVPGWHLGVLAAVAKAAGATGNLDEGEAIALSITDPHRQGYTLMSLAEAAAAAGDLDRALGLAEMIDRAEIRSKALNSLVRTTAAAGDLGCFEMVFAHAVTAAQSVPRENEQGNSLKTLVEAALAVGDFDRAESVTRLITDPQLQAHAVASTAEAASGEVDRVRRMIDHTEKMVRSSKEIELQGWTLESLAEAAAAIGDIDRAENIAQSITNPDQEDPFFKDCDLRGSALASTAKGAAALGEVERAEAIARSLTSPRIRSWALKAVAQAVAANGGIDHAANIALSIEDLEVQGWALRSAADAAAAAGEFDRATEIAHLIRNPGPQNSSSTGHDQRGETLCSLAKAASAAGELDQAEIIIQSMGASNDRGLALSQLAEAAAAIGDLDRAERIALSKTTPEGQVFVLTAVVGAATAVVDHRRLADLLDRAEATSRDITHTYWQPEALARVAEAAAALGDLDRAENIALSIEDPKCQAKTLLAVAPEHDTHRRNRAVARALALTEWTSTLPQLLELAPQALATITAELDTLSDCDPRHTLATRRDDSRLSL
>NZ_CP007155.1|WP_081789639.1|7327564_7330837_+|CHAT-domain-containing-protein
MRGTTCGGAPRNPRERYCGWSRQRCPGGRVTDQPDNHFEGTAREVVQAHHIDGVHINVHEQPVSAPFRTPRELPPDVPGFTGREAELTELDALLDSAPDSTAAVISAVAGTAGVGKTALAVRWAHRVRDRFPDGDLYVDLRGYDSDRPMSPDDALAGFLRSLRVDGSAIPSERHERTAQYRTLLAGRRVLVVLDNASSAEQVRPLLPGSAASFVLVTSRDSLAGLVARDGARRVDLDRLSVTESVDLLHALIGPRVAEEPGRAAELARHSAQLPLALRVTAELAVSRPTTPLAELVRELADEQHRLAELDAGGDERTAVRTVFSWSYLHLPEPAARVFRLLGISPVREPDVSATAALAGTDLAEARRLLTTLRRAHLVEDVSPGRFRMHDLLHAYAVGLAAEQGTEAERVGAVNRLFDHYHDTAVRALKAVADTAGEPGHLAWLEAEIPNMLVLHDHAQRHSWPGQRQRLSQVLHDCMVTLHTLGIAARQDGDLPEALRHFDTAIARFELLAPGYCNGIRLDQAEALLDLGMYEEAAQHLRRAIPLLRELGMDEEIAKAETYQAMAALRHGDLVSARRRAAVAVRLFERLGDEHWACTARLTLVRALVAISVAHRQAPSSLIGRITALAAEFEQRGRCGEAAVAKLLAARLYVRKALPQVVRQLLDEVPPPEQTTSIDQLLLLRTCRAELAVLRGDRASAYREVSAGLAELDRFRRGLGSPELVCGAASHGRELGSLAVSVVLRDPGASGAELVDWLERTRAQAYRYRPGQSEPRESASLAELGAALGERALVSFTSSAGSIFAVVVVDGRAELVPLGESEPVLHWAGELHADLDALAPDRLPRVLVDVVATSARRRAALLDELLLHPLAGLTGDRELVLVPANALHTLAWGALPSLVGRPVSVAPSATAWLSASRRRVAGPTVLVTGPGTPAELDAAELCRPHPGAVLLRGERATVRGVLGALDGAGLAHLATHGMHEPGNALFSHMELADGELRAHELTRLSRPPGHVVLGAAELTVADEGHGFAGALLVIGARTVSAAVSRVGLNAAATTCAEYHQLLARGTSPAVALAAVTSVDPLRRPYVCLGAG
>NZ_CP007155.1|WP_025359781.1|7342786_7343395_-|TetR-family-transcriptional-regulator
MDESRRERKKRQTRQLLVETALRLFDEQGYEQTTVAQIASAADVATKTFFNYFPSKEDVLFAESTAYQAIPIEVIADRREGESVSELLTRAYEKSIADYRAGGVGPRDREFMQIYVRLVSSVPSLQAKALHQAFETQKDVAAALVAAYPDELDLISASAVVGALAGATQAASLVCLEQGCSEDELWEAMRRALDIALNGLGA
>NZ_CP007155.1|WP_025359782.1|7343465_7344638_+|cytochrome-P450
MEPLTFPMTRSHPFDPPDAIQAMRTERPIARVRYPDGKLGWLVTRRETVRTVLADTRFSARQELRSNPFSPAKEPPPATPGSFIGMDAPEHTRYRRLLTGQFTVRRMRKLTEHIEQIAGQRLDHMAQAGPTVDLVREYAMAIPAQVICELLGVPQGHREQFERQAAELNKPGTSMESLLKALGEITGHLAELIEAKRAEPADDLLSGLITEGTDLTQEELTNIAFLLLGAGFDTTANVLSLGALALMLDPAQIPVLTDPQTADNAVEELLRYLPVVPGTIRSALEDVELEGELVRAGESVMVSLPAANRDPERFPEGDRLDLTRPATGHIAFGHGIHQCLGQQLARVELRAALPALFRRFPGLRLAVPPEQVKLREHTAIYGVDELPVSW
>NZ_CP007155.1|WP_030107999.1|7344693_7345503_-|glycoside-hydrolase-family-16-protein
MRTPLLSRALACAAVVLLCGAGLADAAPSAPKLSWSDEFSGAAGSAPNPAKWNYDTGGGGWGNQELEYYTNSRNNSFLDGAGHLVIQARKDDAAKYHCWYGTCQYTSARLLTSGKFSQTYGRFEARVQVPGGQGVWPAFWALGANIGSVGWPACGEIDAMENIGREPNQVHGSLHGPNGYNTSSTYTLGSPVSAGFHTFAADWYPDHIAFSVDGHVYNTQQRPASGWVFDKPFFLLLNLAIGGNWPGSPNGATHFPAKMLVDYVRVYTH
>NZ_CP007155.1|WP_025359783.1|7345841_7346288_+|hypothetical-protein
MAGLTKVLGWLGFAVVAVIGFSLISRGCASHLKAEGATVQAYFHALGTGDAASACGALADSAQAKLKAQQSAATCQLAVSRLHTSLTQAQREELVKADISVNDAAYAGSRKEITLVGGDPLGYAVVVLSTAGEHEMITDWGWDARQLV
>NZ_CP007155.1|WP_030108000.1|7346478_7348923_+|CHAT-domain-containing-protein
MGRHVYGRVLALAGRVASRRRLPDQGPLASGSTRRIAALIDDYLERHEDLPGKLSTELLEHEGLLRGLSLADAHDAGNAGIAWARSVIMRVSLEHGLAREPVSGDNKLAQLHELLGRQYVQFGDWSTASECFTGAALRWTRRTHKRKALSQVIVCCLRGGDTASASALLNMVEGLVSHRPSQHFLRITGKLLSAEAEIDARDEEQVHEVRRLGVINYGYLASCLVRRLAAEGHFHRALRVTTRTLDRLRQDQADTWVIGDLEQQAASIHNALGEHEQALRLAVAAWAKLDAPRYQACSRAQRQSTWGNFAPSRYAALRAAVELGDGRALAELIESCRLQSLVATELEIDHREEQEKVTATGVRLSNKGEPRLTDGGMSLSTAVFAAVNDAFTSTRLNRPAPVAYQGTSLLAPHYSEQPGAGPAPDPCALDDALPQGVFWSSHVENGVMFWFLAEDGKPVAHGMTDLREDEHLQPVLRSLAGCSESAEPETWNLPPHRAESGEHYEPLLHLAQWRSPEEQIMSSTVGGLLPPPLVDLLSEAAKRKEPLRLTLAPAREFGCVPWPIAVVPGSSDRLVERATLRTWTSAPTQLARKARAPHPPSSPVPFLIACDNPDGTLRERTTGSAVSLAWEVLGGPTSASPATRQALLSALHRIDPKAHGLFFYRGHARPDLAWSGLPLAGGDPLRAGELLGSVQDGTPLLPMPARVIVSYCSGSGGSLTGGEGVGLAAGLVQSGAEQVVATSVDVLDAPFTEAFEDMLIKGMLVPDLDHAEVLRAVQLRMLREWKVFSLRGRPARRADIREPHPIIWTAYQAY
>NZ_CP007155.1|WP_030108001.1|7348986_7349424_+|nitroreductase-family-deazaflavin-dependent-oxidoreductase
MAAPNDMRAFNRAIIEEFRANNGLVGHEALRGARIVLLTTTGVRTGKPHTTPLGDLGEEPGRTVLWASNLGAAEHPAWYRNLLARPEVVLERRTPAGVLERVEGRAVTATGQERERLLAALRASRPEIAAHQDRTDREIPLVVVS
>NZ_CP007155.1|WP_025359785.1|7349416_7349713_-|hypothetical-protein
MRADLLVAVGHSRDAASRALVTDFLARWPGEVLVVVSWPERAASWLRQARRLAAGQPDAWVVASTVDSWWHVRRRLCEQPGWDPARTYLLHEGAVDLS
>NZ_CP007155.1|WP_042222822.1|7349702_7350452_-|2OG-Fe(II)-oxygenase
MAEIRQPTRPPAWQARGVHQVDEQDWAGLAAELDAQGCALTGPLLTAEQCGEVAAFYEQEALFRSTVDMARHNFGSGQYKYFQAPVPEVVARLRAAFYPRLLPIARDWAGRLRKPAPWPDTLAEWLGMCHEAGQVRSTPILLRYRAGDWNALHRDLYGDLVFPLQVVIGLDVPGADYTGGEFLLVEQRPRAQSRGTAVSLPQGHGLIFTTRDRPLRSVRGWSTAPVRHGVSSVRSGLRHTLGLVFHDAS
>NZ_CP007155.1|WP_025359787.1|7350486_7351152_+|peptidylprolyl-isomerase
MKLRWGAALAVVVVALTGLVGAGQASAADVPLVRCTFTPTPENPAARWVLRPLPVALTVGTVDVTFRFNYGPVTVRLNRAGAAPCAVHNMVSLVLQHFYDHSQCWRLTNSTRLGVLQCGDIYEVEKGGPGYKFPDEVDGTETYERGTIAMGNQGPGTNGSEFFIVHSFAHIPANYSVLGKVVRGMDVLDRVVAAGIIPSERGELDGAPAKPVTIAGGSVRF
>NZ_CP007155.1|WP_025359788.1|7351225_7352428_+|glycosyltransferase-family-1-protein
MRVVFTAQSEYSHLMPVVVPVAQAARRAGHEVAVAVGPNLVAQVHDLGLQVLPLPNVVRLGEMRDNPEIARRYGIDMSMLTGVGLRTVGTPGAVAARNFAGPAALPYAQDLIEALTQWKPDLLVHEPTAFGAYYAAEALGLSRAVLDISPLTPRDPEALLAEINTQRQALDLAPTGDPDDLMRTTVAGVVPEQFYPVRRRVPGARYYRPELLPTGQRLDPAVAGLPGDRPLVLASLGSVAAKLLAGDSPVLNTIVEVLGELPVTAVVALGKDVDPRDWPGSRPDNVHLTSFVQQQLLLPACELFLTHGGFSGVRESLNAGVPTVVVPLFAEQPANADRLVELGLGTRLNVEDVDHASLTAACRTVLADPGYRSRAKAVQRQFLALPDFDQLVADLATRFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_18

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_18

7622909-7622989

Orphan

Consensus_repeat	Method
GTGATAACACCACCACGCTCCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_18

>merge|NZ_CP007155|18|7622909-7622989|CRISPRCasFinder
GTGATAACACCACCACGCTCCGCGTGAGGGCTGCGGCGCTTCTCTATGTCTGCGGCCAGTCATAACACCACCACGCTCCGC

>NZ_CP007155|18|17|7622909-7622989|CRISPRCasFinder
GTGATAACACCACCACGCTCCGC	GTGAGGGCTGCGGCGCTTCTCTATGTCTGCGGCCA
GTCATAACACCACCACGCTCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025359938.1\|7621299_7622343_-\|recombinase-RecA	unknown	unknown	gnl\|CDD\|236476
NZ_CP007155.1\|WP_025359945.1\|7626641_7628627_-\|glycoside-hydrolase-family-32-protein	unknown	unknown	gnl\|CDD\|224536
NZ_CP007155.1\|WP_025359947.1\|7630050_7631877_-\|Hsp70-family-protein	unknown	unknown	gnl\|CDD\|212667
NZ_CP007155.1\|WP_025359944.1\|7625958_7626540_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP007155.1\|WP_025359943.1\|7625539_7625755_-\|CbtB-domain-containing-protein	unknown	unknown	gnl\|CDD\|370526
NZ_CP007155.1\|WP_025359941.1\|7623919_7624741_+\|bifunctional-5,10-methylenetetrahydrofolate-dehydrogenase/5,10-methenyltetrahydrofolate-cyclohydrolase	unknown	unknown	gnl\|CDD\|223268
NZ_CP007155.1\|WP_030109024.1\|7613925_7614588_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223620
NZ_CP007155.1\|WP_025359948.1\|7631927_7633193_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP007155.1\|WP_025359936.1\|7619600_7620749_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173788
NZ_CP007155.1\|WP_025359942.1\|7624785_7625520_-\|CbtA-family-protein	unknown	unknown	gnl\|CDD\|378192
NZ_CP007155.1\|WP_025359933.1\|7615202_7615532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_042222864.1\|7628758_7629988_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP007155.1\|WP_025359939.1\|7622518_7622713_-\|DUF3046-domain-containing-protein	unknown	unknown	gnl\|CDD\|378612
NZ_CP007155.1\|WP_025359935.1\|7618526_7619588_+\|trypsin-like-serine-protease	unknown	unknown	gnl\|CDD\|214473
NZ_CP007155.1\|WP_025359932.1\|7614713_7615112_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|377965
NZ_CP007155.1\|WP_052360508.1\|7615533_7618380_-\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226415
NZ_CP007155.1\|WP_025359930.1\|7613324_7613816_-\|PE-domain-containing-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_042222866.1\|7633252_7633849_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|236607
NZ_CP007155.1\|WP_025359937.1\|7620767_7621292_-\|regulatory-protein-RecX	unknown	unknown	gnl\|CDD\|234646
NZ_CP007155.1\|WP_025359940.1\|7623332_7623923_+\|cyclodeaminase/cyclohydrolase-family-protein	unknown	unknown	gnl\|CDD\|377428

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025359938.1\|7621299_7622343_-\|recombinase-RecA	gnl\|CDD\|236476	PRK09354, recA, recombinase A; Provisional.	0
NZ_CP007155.1\|WP_025359947.1\|7630050_7631877_-\|Hsp70-family-protein	gnl\|CDD\|212667	cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family. HSP70 (70-kDa heat shock protein) family chaperones assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Some HSP70 family members are not chaperones but instead, function as NEFs to remove ADP from their HSP70 chaperone partners during the ATP hydrolysis cycle, some may function as both chaperones and NEFs.	4.33464e-90
NZ_CP007155.1\|WP_025359944.1\|7625958_7626540_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	9.15601e-24
NZ_CP007155.1\|WP_025359943.1\|7625539_7625755_-\|CbtB-domain-containing-protein	gnl\|CDD\|370526	pfam09489, CbtB, Probable cobalt transporter subunit (CbtB). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of a single transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a protein (CbtA) predicted to have five additional transmembrane segments.	3.36205e-07
NZ_CP007155.1\|WP_025359941.1\|7623919_7624741_+\|bifunctional-5,10-methylenetetrahydrofolate-dehydrogenase/5,10-methenyltetrahydrofolate-cyclohydrolase	gnl\|CDD\|223268	COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism].	6.37033e-102
NZ_CP007155.1\|WP_030109024.1\|7613925_7614588_-\|HAD-family-hydrolase	gnl\|CDD\|223620	COG0546, Gph, Predicted phosphatases [General function prediction only].	2.08076e-27
NZ_CP007155.1\|WP_025359948.1\|7631927_7633193_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.30197e-84
NZ_CP007155.1\|WP_025359936.1\|7619600_7620749_+\|S8-family-serine-peptidase	gnl\|CDD\|173788	cd04056, Peptidases_S53, Peptidase domain in the S53 family. Members of the peptidases S53 (sedolisin) family include endopeptidases and exopeptidases sedolisin, kumamolysin, and (PSCP) Pepstatin-insensitive Carboxyl Proteinase. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of Asn in subtilisin. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Characterized sedolisins include Kumamolisin, an extracellular calcium-dependent thermostable endopeptidase from Bacillus. The enzyme is synthesized with a 188 amino acid N-terminal preprotein region which is cleaved after the extraction into the extracellular space with low pH. One kumamolysin paralog, kumamolisin-As, is believed to be a collagenase. TPP1 is a serine protease that functions as a tripeptidyl exopeptidase as well as an endopeptidase. Less is known about PSCP from Pseudomonas which is thought to be an aspartic proteinase.	5.34277e-52
NZ_CP007155.1\|WP_025359942.1\|7624785_7625520_-\|CbtA-family-protein	gnl\|CDD\|378192	pfam09490, CbtA, Probable cobalt transporter subunit (CbtA). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of five transmembrane segments, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a small protein (CbtB) having a single additional transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site.	9.36426e-64
NZ_CP007155.1\|WP_025359932.1\|7614713_7615112_+\|SH3-domain-containing-protein	gnl\|CDD\|377965	pfam08239, SH3_3, Bacterial SH3 domain.	0.00786465
NZ_CP007155.1\|WP_042222864.1\|7628758_7629988_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.90188e-20
NZ_CP007155.1\|WP_025359939.1\|7622518_7622713_-\|DUF3046-domain-containing-protein	gnl\|CDD\|378612	pfam11248, DUF3046, Protein of unknown function (DUF3046). This family of proteins with unknown function appears to be restricted to Actinobacteria.	3.33074e-28
NZ_CP007155.1\|WP_025359935.1\|7618526_7619588_+\|trypsin-like-serine-protease	gnl\|CDD\|214473	smart00020, Tryp_SPc, Trypsin-like serine protease. Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.	1.04887e-30
NZ_CP007155.1\|WP_025359945.1\|7626641_7628627_-\|glycoside-hydrolase-family-32-protein	gnl\|CDD\|224536	COG1621, SacC, Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism].	7.02241e-109
NZ_CP007155.1\|WP_052360508.1\|7615533_7618380_-\|LuxR-family-transcriptional-regulator	gnl\|CDD\|226415	COG3899, COG3899, Predicted ATPase [General function prediction only].	5.04295e-32
NZ_CP007155.1\|WP_042222866.1\|7633252_7633849_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|236607	PRK09648, PRK09648, RNA polymerase sigma factor ShbA.	6.40715e-86
NZ_CP007155.1\|WP_025359937.1\|7620767_7621292_-\|regulatory-protein-RecX	gnl\|CDD\|234646	PRK00117, recX, recombination regulator RecX; Reviewed.	2.26736e-34
NZ_CP007155.1\|WP_025359940.1\|7623332_7623923_+\|cyclodeaminase/cyclohydrolase-family-protein	gnl\|CDD\|377428	pfam04961, FTCD_C, Formiminotransferase-cyclodeaminase. Members of this family are thought to be Formiminotransferase- cyclodeaminase enzymes EC:4.3.1.4. This domain is found in the C-terminus of the bifunctional animal members of the family.	4.56911e-60

>NZ_CP007155.1|WP_025359939.1|7622518_7622713_-|DUF3046-domain-containing-protein
MRMTVFRRRMAEEFGEVRSEMLARDHVFAALGGRTADEALEAGLDAKRVWQAVCDAFDVPAERR
>NZ_CP007155.1|WP_025359938.1|7621299_7622343_-|recombinase-RecA
MAPAAPDKDKALELALAQIDKNFGKGSVMRLGEERREPIKVIPTGSIALDVALGIGGLPRGRIIEVYGPESSGKTTVALHAVANAQRAGGIAAFVDAEHALDPDYAKALGVDTDALLVSQPDTGEQALEIADMLVRSGALDILVIDSVAALVPRAEIEGEMGDNHVGLQARLMSQALRKMTSALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDSGDAVGNRTRVKVVKNKVAPPFKQAEFDILYGHGISREGSLIDMGVEQGILRKSGAWYTYDGDQLGQGKENARRFLLENPDVANEVEKKIQEKMGIGAQVDADAAAPAPVDF
>NZ_CP007155.1|WP_025359937.1|7620767_7621292_-|regulatory-protein-RecX
MIEDPAELPPEKGVDLVRKAQDLCVRQLTVRARSREELRQAMTKREIPEEVAELVLGRLDRAGLLDDAAFAEEWVRSRHTHRGLSRRALVAELRRKGVADSVAAEAASAVDEEDERERARELVRKRMGSLGSVDETTKLRRLVGVLARKGYSEGLAIRVVREELGGADGAAEFD
>NZ_CP007155.1|WP_025359936.1|7619600_7620749_+|S8-family-serine-peptidase
MPARYATLTAAITVLSLTTGLAPAAAVQQSDCTAAAHGHATCQAVTTPGPTAAPHGLTPADLRAAYQLPEGGAGVTVAVVDAGGNARAESDLATYRRQFGLPACGTADGCLRIVDQRGGTALPAPVPGGWPMEISLDLDAVSAACPRCHLLLVEADTSADTDLYTAEDTALRLGARLISNSWLSDVPDKPAEIDKHFAYSGVLFAFATGDEGYRQPGNYPASSPYTLAVGGTTLRRTPSGWAESAWSGAGSGCATGGPAPAWQTALTSACGGLRTSSDVSAVGDPATGLAVYNTATAHGWQVVGGTSLSTPLVTAMYALAGGVPPATERPAAYPYRHPGALTDVTSGSNGGCGAPLCQAGPGWDGPTGLGSPLGKGVTAFTP
>NZ_CP007155.1|WP_025359935.1|7618526_7619588_+|trypsin-like-serine-protease
MSKTPVVAALVVTALLAPVVAAQAATPAFRGGEKASVKDYPFIIAGEREGGTRPQGQTCTGSVVAPRKILIAAHCKAAEGEKSFVYGLDDLNASGGFRTKVVDYKTHPKYVNFDQGYDVAVVTTADDIPVPGGAYAKVATSADTELNKPGKTGLGLGYGKKDVDDSAKDVTLEKASLPIVDPSTCTGVGNGVQAATMICAGYSDGHVSILPGDSGGPLVVDGKIVGVASWSRSDFFWYSIYGRLNNDMGDWVKQQIDGGDPTGTPSASFTAQCQSTCKFDGSASSADGATISSYAWDFGDGQTGTGVSTTHTYPARSGTYSATLKVTTDKGKTDSMSRKITCFGFGSQPLCFA
>NZ_CP007155.1|WP_052360508.1|7615533_7618380_-|LuxR-family-transcriptional-regulator
MLTLRVVEPTAGASSLRNTPPPLIGRQDELSALLDVLACPPAVVLVEGEAGIGKTRLVSELLAHPALSARRVLSGGCQPMREPFPYGPVFDALAALHPPPRLGLNPVVGALRGLLPEIAHHLPPVPPALGDPLAERHQLFRAVRELLASCGPTVLVIDDLHWADEATLQLLRFLLCRIPEQLSLVLAYRPEELPWRVPLGSLPRRGWAIGTTVVRLDALDQEQVHVMASRTLGTPVGTEFARRLVELTAGIPFVLEEVLRAVGDGELDSLDGLDVPVPLRAAVADRLAVLPGTAVRVAKSVAVLDAPSEARLIGEVAAIRGDRLSIALQRLLAAGVLRENPPGHYGFRHSLARQAVYEVINGPERQLLHGRTMRALSRVRPAPLVRLAEHAKLAGHYQEWLDYAESAADHAESVGDTAVAIEVLQRVLDGGALDTADVERLAVKLSRVALRGLHRAVTTTLRAILVDPRLSRPARGRIRLNLGLLLIRWSGTLQEGRAEVERAIKDLAGEPEHAAHGISVLAQPLEGELPLSWHLPWMERARRLADLVEDPEKRLALRTDRIATLVQLGDEEGWRLFERLTSVAATTAEQVQLSRLWCNVADGASWCGYHERAAALLEQGLRMAGDCGALFVAGTARSTQLRLDWLTGNWSGLSELCRRLLDSYQDVGPVAAELSLVMGSLAAARGEWEVAEQHLLATGVPSLADVAAPVVLSASGTLVRMRLSAEDVVEACAEADRGLAAARRKGVWVWACELVPVAVEAYVRGGRLESAEQVLADFELGVAGRQAPLAQAALAAGQGLLLAAHGDRQSAVERLGEASAAYAALPMPYAAAWVLECSATSAEDQIEVLSSVADTYDQLGATRDAARCRHLLRMWGSGKPSRRGRRGYGDQLSPRERDVARLLATGQTNKEIADVLFLSPRTVEQHVARVLHKLNLRSRSEVRAEVLS
>NZ_CP007155.1|WP_025359933.1|7615202_7615532_+|hypothetical-protein
MKRTSLAIALGLSVMALPVVATTATAATPSITCGNQWTQRSEGPDARDFQWGNCATHATKIKVYSLTYGGVFKNLVREQCVAAGAVVPLGSSTNWRVLAYTGEDTATAC
>NZ_CP007155.1|WP_025359932.1|7614713_7615112_+|SH3-domain-containing-protein
MRAPHAATCLALTAATLLAGGATALAGTSETTYTITAWHEVKQRSCPSTSCGEVGEILAGQVWQRAVCWTHGEEITDAGITNDVWIQVRHEDGGTQWASAVYFTGDQYAGLPVSARCPARTGGRSTPINPLP
>NZ_CP007155.1|WP_030109024.1|7613925_7614588_-|HAD-family-hydrolase
MNHTSVRARHVVWDWNGTLLDDNEAVVHSVNAVLTAFDRAPLTIDAWRAAFTRPLTTCYERLLGRVLAPEDWARIDVLYHEAYRERLDECGLALGVPHLLRDWQNSGRTQSLLSMWFHEELVPLVGKLGLDGLFTRVDGLRGVNMGGSKTEHLAAHLSAMALDPAEVVLIGDVVDDAEAAAAAGAQCVLVSTGVMDRPRLEAAGVPVADSIPQALGLLGS
>NZ_CP007155.1|WP_025359930.1|7613324_7613816_-|PE-domain-containing-protein
MQYDGHAPPAAPMPGYPAAPKPAPMPGYPGHPQAAPKPAPMPDHVVAPAPEQPVGCFAFTEDEFQAVIKQWRDLLHELKQAERAARPMSSVRPAADEPVSRFVATITNDSGRAYLKHNREAQRFVSEFLAKLTQAHQVYLDAEQNGTDGLRRAAGTPGGGKSC
>NZ_CP007155.1|WP_025359940.1|7623332_7623923_+|cyclodeaminase/cyclohydrolase-family-protein
MRDQTIGDWLDQLASRAPAPGGGAVAAMHTAMAAGLVEMVCNLTIGKPRYAEHEPTMLGALREAGQCRAEAVELAERDAAAFTAVTTAYRLPKEDERDRAVRGERIQQALRAAAEVPLRTAEVAERVLELAGRIRRGANVNVLSDVDVAEHSARAALASAVVNVEVNLAAMTDQAARAELAAEVSRIGRVLEGVRA
>NZ_CP007155.1|WP_025359941.1|7623919_7624741_+|bifunctional-5,10-methylenetetrahydrofolate-dehydrogenase/5,10-methenyltetrahydrofolate-cyclohydrolase
MTLIDGRSVAAAIRTQVAEDAAELRAAGTTPTLAILVPTDDEATAWYVRSIVRTAEKVGVSVRVVERSQDVGGALRELSADPEVHGIICQTPLPEGMTLDEVGLHIDVRKDVDGANPTSVGRLAVGLPAFAPATAQAVVELLRAHGTPLASADVVVVGRSTVVGKPAALLLLAENATVTVCHSHTKELAAQTSRADVLVACVGRPEMLGAEHVRPGAVVIDVGTNPTADGGLVGDVQTAAVEPIASAVTPVPGGVGPVTTALLLRNVIAAAGQ
>NZ_CP007155.1|WP_025359942.1|7624785_7625520_-|CbtA-family-protein
MMRTLLVRGMLAGLAAGVLALVFTWLLGEPLVGSAIDFESAEAAAAGEAAEPELVSRGVQSTLGLATGVLLYAIAFGGLFALAFAIAYGRLGRISARSTSLLLALAGYLSAFVVPFLKYPANPPSVGNPDTIGERTGAYFLMVVLSIGLAVAATYLGRRLLPGLGTWNAALVAVLAFVVAVAVVQLLLPAINEVPKEFPAALLWNFRVVSLGTQLVMWATIGLLFGALVQRKLRTESQLTAQPV
>NZ_CP007155.1|WP_025359943.1|7625539_7625755_-|CbtB-domain-containing-protein
MSIASPSPIAIPIPVRIPLREVLPWAVFIGVLAVVLLYFVGAEQGATSLVSGHYVHEFVHDGRHLLGFPCH
>NZ_CP007155.1|WP_025359944.1|7625958_7626540_+|histidine-phosphatase-family-protein
MVTMNRIFLISHGATEAVREARFADDESLCGTTDPLETPSRVDEVRCGPERRCLETATVLGLTPVTDPGLSDLDCGSWRGRALAEVQEQDPAGLMAWLSDPDADAHGGETVRQLLARVGSWLDCLPDRGRIVAITSPSVVRAAIVHCVQAPPASFWRFDVAPLTLTHLYGGPGRWTLRETGHPLPPARTAPPS
>NZ_CP007155.1|WP_025359945.1|7626641_7628627_-|glycoside-hydrolase-family-32-protein
MHLPSSCLAFATAMTLALAGAPTASVPANADFETCDTGGWTLTGSAFTVSSATTWWGGTYDQHGTCFLSGYLAHQDTATGIARSSVFTATDHLSFLIAGGYDPQHLHVALVRAADGAVLDRQTGYNSEQLARITWDTSEVRGQAVYLEVVDEATGQWGHLNLDDVRTSAVGDAGNGLTSVRLGSANQPGPTEGPAAARYAVDPLRPQYHYTPYQGWINDPVGLIQWRGTYQLFAQFNPASPFWGPMHWAHAQSPDSVHWTNAPVALTPPAPAGPSDTTGEWSGSAVADNGALRLFYTHYTDTAAHPGAIREQVWSATSTDGTTFTPGAGNPVIPGPPAEAEAGFRDPKVFRDPHDGLWKMVLGSGHGGAGKVLLYSSPDLRAWTYRGVLLSGDGSTGGMWECPNLIQVDGRWALLVSTNGGEHYFLGDFTGSTFTPTASGQLDSGPNFYAAQAFTDSSGRPLLVGWMNNGDAFDPNRLDGWSQAETITRQLSVRPDGTLGSAPVSQLDRLHGTQLARRGGTAVPTAAPVPIADGASLDLRTGFDLSRSSATTLGLTLFASSAERVILSYEPATRQLVLDTRNSGYGQGSVSHVTSAPDAQGRLNLRVLTDRSSIEVFTGDGRSLTARVYPRYTQSTGVTAFATGGEARLLPTEAWAMTSAW
>NZ_CP007155.1|WP_042222864.1|7628758_7629988_-|MFS-transporter
MVHPAQRRVLSVLVCTQVFGAAGVGLGVAVAVLVTTSLSESTVVGGLGATATALGAAGLALVVATLSTRYGRRRALLVAYATGAFGGAVAALAVQLRSWPLLLAALVPFGGGTSATLAARFAATDLAAPAHRAATLSTVVWSTTLGAVAGPNLVEPATRFAGDGGPFLLAAAVFALAAAGIALGLRADPLMPVGTVPAAIGDSCCGVTGSTIPAEPVRWSMLRVLSPSARLALLGVTLCNTAMVGMMSMTPVQMQHTGSSLTVVGVVISLHVAAMYAGSPLFGWLADRLGRMPVLAVGAALVVAAAGVCGMADSHEAPQLAVGMAVLGAGWSAGVVAGSALLTESVPAPLRQAAQGLSDLLMNAGGALGGLAAGVVVQAWSYPALGLLLGFLALPVLMASVLTTLRPAR
>NZ_CP007155.1|WP_025359947.1|7630050_7631877_-|Hsp70-family-protein
MNVLSVDLGTSNTVAVLRAQDRAPRVVEVDGAATMPSAVFAAEDGTILVGRDAERSARLDPSRFEPNPKRRIDEGTLLLGTSVVPVNEVLAAVLRRVLTETCRQLGGAAPEQVRLTHPAQWGTPRRNALLSSARLAGITGELVLVPEPVAAAAHFASSHGMLAPGQALAVYDLGAGTFDVAVVGVDQSGFTVLAEDGLPDLGGLDVDQALMEYVGRQVSHRDAPGWQRLLRPESTADRRARRSLWEDVRAAKETLSRHPQTEVPMPEPFHDVLVTRPELEALIRPSVLRSTELLGATIAATGLAPQSLAGVYLVGGSSRIPLVATLIAERLRVVPVSLDQPETAVALGAHHVPRAGMAVRTAGFTAPQQAPPSQPVPRQQYPDSDRFLAQAQFPATPPQQFPQQPQFQHPQYQAPQQQTPSRKRLPKAALLSVAAVVVLALLGVGGFVLLRGGTGADCTSTEGKGVPGCLRQLAGAVADKADCNGGYDGGAVGLSGLTGAAATCRLGGSDGTHTVVYQQAKSAEEAAAKVKALLDGYAASNQVGADWKGNGLAGSYRSVVASGVGVLVFTVKDQPLVGVLTTAVTSAPDSLTANAVADYFEQNVQPGT
>NZ_CP007155.1|WP_025359948.1|7631927_7633193_+|MFS-transporter
MSTAAPARRWVFVIPVAAVMYLLAYLDRTNVSVILPYVDRELALSPSAQGLAGGIFFLGYLLLQIPAAVLAARWSARRTVLLLMLAWSVAAMACGLVATEGQLYLARFLLGVFEGGVWPAVLILLASWFPQAERARANALWMACLPLSAILTSPLSGWMLSHWSWRLVFVVQGLPPLLWALVWWFTVADRPAQARWISAAEREHVERALAADEAAKPVSGNGSYLAALRDPVVLRLIAVYFFWITGFYGFSLWLPSVVKTLTHNGSPAVVGALSAVPYLFALAAMLGAAVWADRTGRRRAAVAVPLVVAMAALLLGQLAAGAPVLQFALLCVVAAGVYAPYGPFWAIPGRVLRFEVVAVAMGVINALGNLGGFAGPYLVGWLTERTGSSLPGFAALSAFLAVAVLVALFGLKSEQDVHAVR
>NZ_CP007155.1|WP_042222866.1|7633252_7633849_-|sigma-70-family-RNA-polymerase-sigma-factor
MIARPVAAYGPQDEHFRRLVDAAVHGDADARDRVLTSIRPIVMRYCRARIGRLDKSFASADDVVQEVCLSVCSALPSYRDQGQPFLAFVYGIAQHKVADAHRAAARNRSLPVSEVPDRPEIGAGPEQRMLQAELKDSMGKLLGVLSDKQREIVVLRVVVGLSAEETADLVGSTPGAVRVAQHRALNRLRKLMASGREL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_19

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_19

7994321-7994432

Orphan

Consensus_repeat	Method
GTCACGAAGGTGCCCTTCACGACGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_19

>merge|NZ_CP007155|19|7994321-7994432|CRISPRCasFinder
GTCACGAAGGTGCCCTTCACGACGTTGGGCGTCCGCAACGGCACCTTCGTGGCGTAGCTGCGGGTCCGGCGACCGCCCCCGTGACGTCACGAAGGTGCCCTTCACGGCGTTG

>NZ_CP007155|19|18|7994321-7994432|CRISPRCasFinder
GTCACGAAGGTGCCCTTCACGACGTTG	GGCGTCCGCAACGGCACCTTCGTGGCGTAGCTGCGGGTCCGGCGACCGCCCCCGTGAC
GTCACGAAGGTGCCCTTCACGGCGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025360262.1\|7996404_7997037_-\|imidazole-glycerol-phosphate-synthase-subunit-HisH	unknown	unknown	gnl\|CDD\|237290
NZ_CP007155.1\|WP_025360267.1\|8000139_8001048_+\|ornithine-cyclodeaminase-family-protein	unknown	unknown	gnl\|CDD\|225280
NZ_CP007155.1\|WP_025360264.1\|7997929_7998817_-\|transketolase	unknown	unknown	gnl\|CDD\|132916
NZ_CP007155.1\|WP_025360259.1\|7994503_7994893_+\|PPOX-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274712
NZ_CP007155.1\|WP_025360249.1\|7983711_7984503_-\|tryptophan-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|237285
NZ_CP007155.1\|WP_025360268.1\|8001082_8001613_+\|RNA-2'-phosphotransferase	unknown	unknown	gnl\|CDD\|179136
NZ_CP007155.1\|WP_025360256.1\|7989760_7990132_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025360251.1\|7985739_7986549_-\|indole-3-glycerol-phosphate-synthase-TrpC	unknown	unknown	gnl\|CDD\|234710
NZ_CP007155.1\|WP_025360266.1\|7999563_8000028_+\|redox-sensitive-transcriptional-activator-SoxR	unknown	unknown	gnl\|CDD\|133385
NZ_CP007155.1\|WP_030111198.1\|7986676_7987219_-\|Trp-biosynthesis-associated-membrane-protein	unknown	unknown	gnl\|CDD\|378200
NZ_CP007155.1\|WP_148309771.1\|7997218_7997902_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025360254.1\|7988823_7989420_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380054
NZ_CP007155.1\|WP_025360258.1\|7991261_7994258_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368582
NZ_CP007155.1\|WP_025360257.1\|7990128_7990902_-\|imidazole-glycerol-phosphate-synthase-subunit-HisF	unknown	unknown	gnl\|CDD\|234996
NZ_CP007155.1\|WP_030111199.1\|7984499_7985720_-\|tryptophan-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|235288
NZ_CP007155.1\|WP_025360261.1\|7995644_7996382_-\|bifunctional-1-(5-phosphoribosyl)-5-((5--phosphoribosylamino)methylideneamino)imidazole-4--carboxamide-isomerase/phosphoribosylanthranilate-isomerase-PriA	unknown	unknown	gnl\|CDD\|237589
NZ_CP007155.1\|WP_042222943.1\|7998830_7999469_-\|transketolase	unknown	unknown	gnl\|CDD\|238970
NZ_CP007155.1\|WP_025360253.1\|7987211_7988744_-\|anthranilate-synthase-component-I	unknown	unknown	gnl\|CDD\|184152
NZ_CP007155.1\|WP_025360260.1\|7994947_7995685_+\|Clp-protease	unknown	unknown	gnl\|CDD\|214361
NZ_CP007155.1\|WP_025360255.1\|7989389_7989764_-\|phosphoribosyl-AMP-cyclohydrolase	unknown	unknown	gnl\|CDD\|234598

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025360267.1\|8000139_8001048_+\|ornithine-cyclodeaminase-family-protein	gnl\|CDD\|225280	COG2423, COG2423, Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism].	6.28077e-44
NZ_CP007155.1\|WP_025360264.1\|7997929_7998817_-\|transketolase	gnl\|CDD\|132916	cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins. Thiamine pyrophosphate (TPP) family, pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and the beta subunits of the E1 component of the human pyruvate dehydrogenase complex (E1- PDHc), subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. A polar interaction between the conserved glutamate of the PYR domain and the N1' of the TPP aminopyrimidine ring is shared by most TPP-dependent enzymes, and participates in the activation of TPP. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this sub-family. Like many TPP-dependent enzymes DXS and TK are homodimers having a PYR and a PP domain on the same subunit. TK has two active sites per dimer which lie between PYR and PP domains of different subunits. For DXS each active site is located at the interface of a PYR and a PP domain from the same subunit. E1-PDHc is an alpha2beta2 dimer-of-heterodimers having two active sites but having the PYR and PP domains arranged on separate subunits, the PYR domains on the beta subunits, the PP domains on the alpha subunits. DXS is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis, it catalyzes a transketolase-type condensation of pyruvate with D-glyceraldehyde-3-phosphate to form 1-deoxy-D-xylulose-5-phosphate (DXP) and carbon dioxide. TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates. In heterotrophic organisms, TK provides a link between glycolysis and the pentose phosphate pathway and provides precursors for nucleotide, aromatic amino acid and vitamin biosynthesis. TK also plays a central role in the Calvin cycle in plants. PDHc catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. This subfamily includes the beta subunits of the E1 component of the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). ADC participates in the breakdown of acetoin. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate during the breakdown of branched chain amino acids.	3.0194e-41
NZ_CP007155.1\|WP_025360259.1\|7994503_7994893_+\|PPOX-class-F420-dependent-oxidoreductase	gnl\|CDD\|274712	TIGR03666, Rv2061_F420, PPOX class probable F420-dependent enzyme, Rv2061 family. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. [Unknown function, Enzymes of unknown specificity].	7.21489e-47
NZ_CP007155.1\|WP_025360249.1\|7983711_7984503_-\|tryptophan-synthase-subunit-alpha	gnl\|CDD\|237285	PRK13111, trpA, tryptophan synthase subunit alpha; Provisional.	6.33619e-119
NZ_CP007155.1\|WP_025360268.1\|8001082_8001613_+\|RNA-2'-phosphotransferase	gnl\|CDD\|179136	PRK00819, PRK00819, RNA 2'-phosphotransferase; Reviewed.	8.23107e-78
NZ_CP007155.1\|WP_030111199.1\|7984499_7985720_-\|tryptophan-synthase-subunit-beta	gnl\|CDD\|235288	PRK04346, PRK04346, tryptophan synthase subunit beta; Validated.	0
NZ_CP007155.1\|WP_025360251.1\|7985739_7986549_-\|indole-3-glycerol-phosphate-synthase-TrpC	gnl\|CDD\|234710	PRK00278, trpC, indole-3-glycerol phosphate synthase TrpC.	3.07215e-133
NZ_CP007155.1\|WP_025360266.1\|7999563_8000028_+\|redox-sensitive-transcriptional-activator-SoxR	gnl\|CDD\|133385	cd01110, HTH_SoxR, Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator. Helix-turn-helix (HTH) transcriptional regulator SoxR. The global regulator, SoxR, up-regulates gene expression of another transcription activator, SoxS, which directly stimulates the oxidative stress regulon genes in E. coli. The soxRS response renders the bacterial cell resistant to superoxide-generating agents, macrophage-generated nitric oxide, organic solvents, and antibiotics. The SoxR proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the unusually long spacer between the -35 and -10 promoter elements. They also harbor a regulatory C-terminal domain containing an iron-sulfur center.	1.19583e-74
NZ_CP007155.1\|WP_030111198.1\|7986676_7987219_-\|Trp-biosynthesis-associated-membrane-protein	gnl\|CDD\|378200	pfam09534, Trp_oprn_chp, Tryptophan-associated transmembrane protein (Trp_oprn_chp). Members of this family are predicted transmembrane proteins with four membrane-spanning helices. Members are found in the Actinobacteria (Mycobacterium, Corynebacterium, Streptomyces), always associated with genes for tryptophan biosynthesis.	1.58348e-23
NZ_CP007155.1\|WP_025360254.1\|7988823_7989420_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380054	pfam17920, TetR_C_16, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. This entry represents the C-terminal domain found in a number of different TetR transcription regulator proteins found in Actinobacteria. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain.	1.03438e-30
NZ_CP007155.1\|WP_025360262.1\|7996404_7997037_-\|imidazole-glycerol-phosphate-synthase-subunit-HisH	gnl\|CDD\|237290	PRK13146, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional.	4.36045e-112
NZ_CP007155.1\|WP_025360257.1\|7990128_7990902_-\|imidazole-glycerol-phosphate-synthase-subunit-HisF	gnl\|CDD\|234996	PRK02083, PRK02083, imidazole glycerol phosphate synthase subunit HisF; Provisional.	6.35873e-154
NZ_CP007155.1\|WP_025360261.1\|7995644_7996382_-\|bifunctional-1-(5-phosphoribosyl)-5-((5--phosphoribosylamino)methylideneamino)imidazole-4--carboxamide-isomerase/phosphoribosylanthranilate-isomerase-PriA	gnl\|CDD\|237589	PRK14024, PRK14024, phosphoribosyl isomerase A; Provisional.	1.43582e-155
NZ_CP007155.1\|WP_025360253.1\|7987211_7988744_-\|anthranilate-synthase-component-I	gnl\|CDD\|184152	PRK13571, PRK13571, anthranilate synthase component I; Provisional.	0
NZ_CP007155.1\|WP_042222943.1\|7998830_7999469_-\|transketolase	gnl\|CDD\|238970	cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates. In heterotrophic organisms, TK provides a link between glycolysis and the pentose phosphate pathway and provides precursors for nucleotide, aromatic amino acid and vitamin biosynthesis. In addition, the enzyme plays a central role in the Calvin cycle in plants. Typically, TKs are homodimers. They require TPP and divalent cations, such as magnesium ions, for activity.	1.39924e-55
NZ_CP007155.1\|WP_025360258.1\|7991261_7994258_-\|hypothetical-protein	gnl\|CDD\|368582	pfam05729, NACHT, NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.	0.000545918
NZ_CP007155.1\|WP_025360260.1\|7994947_7995685_+\|Clp-protease	gnl\|CDD\|214361	CHL00095, clpC, Clp protease ATP binding subunit.	2.894e-36
NZ_CP007155.1\|WP_025360255.1\|7989389_7989764_-\|phosphoribosyl-AMP-cyclohydrolase	gnl\|CDD\|234598	PRK00051, hisI, phosphoribosyl-AMP cyclohydrolase; Reviewed.	2.58433e-67

>NZ_CP007155.1|WP_025360258.1|7991261_7994258_-|hypothetical-protein
MDSWTGVLQSWGVPALVVGVVVLLVAAPKVIEGIRAVLGLLVAPLRLLTPALLGPAARAEQARRRRVATVLLSALDLTEERLGWRGERYTEIRAAIESVDTPRRTRGLFGLRTGAGTYRTRSLEAAFRRERAAVVHLHGSAGSGKSVILRRYARDVLVSARDGAARRRPLALYVSLRDLDLPPEQVTATVLQDYVARQVNPHGSVELAEYLSTDLPRDLREGQVVLLFDSFDEIPAVIASATVDRAVRPYVELITSYLGGGRAHCVVASREYRGPRVPGWARLEISPLARAEQLHLLSAYGLSGRQIRAVEHLLHDVSGGFTTHLRNPMYLSLFALYVLAHGGPPDRASQLFEEHLRTRLDAADPKGRPEVLAVLLEVLERLALRSTRAEDSGLCIELAEIRREAHACARGVPARELVPILVASGLLVPTTNERYAFAHRLIREYVVGGYLVRHPDEVPVAELVEQPRWRETTVALLQVGEPEHVAELLVAIWMLLDEERRTPERFEQFSPRAVHLLELLVTAYGAAAGWLPDLCRTIVGGLIARAWDEGGISERKFALDCLTLLPTEHQPWYVEQAFSGSSTWLRMTALRRCALFSPLPVTIEMLIRRLLVTLLAGGQLSADRVVIDSDLRRLYEGTRFVRTRRVLVALPVALAGLCALKLGLDLVQFGLLVLVWPFGLLTWVLLPAGSFWLLQSSQPLSLPTSTRTARFFQRAMDRVYGWNDRTDSAQLFLGIVVVTGISVLIQFVLAVAMPLLSAEFTQAAIGLATGPLLVLYLYLWAPAVLNSTVNRPLGSAIRVRELFFAPLFYALRAVRVLATDGRPMAFDLAGSLARMVLIGAAAYGASWLIVEFAGVVGIVLLAVVVVLVLAGAPIAVARLVIGEIRSRRAVRRGLRRTTALDEAVLLAEMSRFTDPLEVVDYLRALRVDRTEQARALRREFVQDLIRAVERSADTELDALPVLLGEGGAAEHVPVPVLRGWRVEVLDELGRLSEFLTER
>NZ_CP007155.1|WP_025360257.1|7990128_7990902_-|imidazole-glycerol-phosphate-synthase-subunit-HisF
MPVSVRVIPCLDVDRGRVVKGVNFTDLVDAGDPVALAAAYDAEGADELTFLDVTASSGDRETTYDVVRRTAEQVFIPLTVGGGVRAPEDVDRLLRAGADKVSVNTAAIARPELLRECSQRFGAQCIVLSVDARRVPADGQPTASGFEVTTHGGRRGTGIDAVEWAARGQELGVGEILLNSMDADGTKAGFDLDLITRVRAVVDVPLIASGGAGQVDHFPPAVAAGADAVLAASVFHFGTLRISEVKDGLRASGAVIR
>NZ_CP007155.1|WP_025360256.1|7989760_7990132_-|hypothetical-protein
MIGGSAPLEVRVAALVFALGGLLFAGGSFAWGTQIGDTSVAIVPAVDAVVGLLLGGLLAVGARAARMPAFVWAALITILQIVLALGVAPVWLRILCGLLAAAHVYAFVLLNTAPAGRYLGGAR
>NZ_CP007155.1|WP_025360255.1|7989389_7989764_-|phosphoribosyl-AMP-cyclohydrolase
MTLDPAIADRLKRNAEGLVCAVVQQRGTGEVLMVAWMDDEALHRTLTTREATYFSRSRGRQWIKGETSGHTQHVHEVRIDCDGDTVLLVVDQVDGACHTGDRTCFDAGLLLAAEAQGSSSSPVR
>NZ_CP007155.1|WP_025360254.1|7988823_7989420_+|TetR/AcrR-family-transcriptional-regulator
MTQPRRRGRRPAGEDTRTALLAAARQVFTEQGFDGATVRGIASRAEVDPAMVNHWFGGKRGLFAAAVELPADPEAVRAHVFGGDREHIAERAVRAFVTVWDSTAGGGFAALIRSAATQEAAATMMREFITAIFGEAIRDLGVDRPELRLSLFGSQLSGLGLARYVVKLEPLASADVDTLVATVGRTLQHYLTGELELP
>NZ_CP007155.1|WP_025360253.1|7987211_7988744_-|anthranilate-synthase-component-I
MVSAALGEVSPTREEFRALAASRRVIPVVRRLLADAETPVGVYRKLAGDRPGTFLLESAENGRSWSRWSFVGVRSPAALTVVGGQASWTGTPPVGLPSGGDPLDALRRTLEVLRTDPLPGLPPLTGGMVGFVGYDAVRRLERLPELAADDLRLPEMVMLLATDLAALDHHSGTITLIANAVNWDDSPERVDAAYEDALARLDQMTEELGATAPATAAVLAPSEPRFRRRRDSAEFRSAVDTAKEAIRAGEAFQVVVSQRFEIDTEADALDVYRVLRTTNPSPYMYLLRLDGFDIVGASPEALVTVRDGQATTHPIAGTRWRGADAEEDALLEKDLLADAKERAEHLMLVDLGRNDLGRVCRPGSVNVVDFFRVERYSHVMHIVSTVTGHLDTGRTAFDAVAACFPAGTLSGAPKPRAMELIEELEPTRRGLYGGIVGYLDFAGDCDTAIAIRTALVRDGVAYVQAGAGIVADSDPAAEDTECLNKARAVLSAVATAGTLRPAGEVVGSGV
>NZ_CP007155.1|WP_030111198.1|7986676_7987219_-|Trp-biosynthesis-associated-membrane-protein
MSERRPLWTVVGLLALASLVLWLSSQMTWTWSQHTDDLRGLVTTKATGDQAETALVPLAVLVLALVAAVVATGGWLRRITGVVVLLSGFGVLWLAANGIGDVLGPHPAGYPAGTVLAAHGLAALAGLAVLAGGTLLVAAGHRMPRLGAKYQSPQAKKPVTDPDRELWQALDSGQDPTARQ
>NZ_CP007155.1|WP_025360251.1|7985739_7986549_-|indole-3-glycerol-phosphate-synthase-TrpC
MTVLDSIIDGVRADLASREAEIPFEVIKERSLAAPAPRDAMTALKAPGIGVIAEVKRRSPSKGDLAEIPDPAVLAADYAAAGARVISVLTEQRRFGGSLADLDAVRAAVDVPLLRKDFIVSPYQVHEARAHGADVVLLIVAALEQNALEALLDRVESLGMTALVEVHTAEEADRALEAGAKVIGINARNLHTLEVDREVFGRIAPGLPFETYKVAESGVRGPADLMTYAGAGADAVLVGEGLVTSGDPKAAVTQLVTAGSHPACPRPSR
>NZ_CP007155.1|WP_030111199.1|7984499_7985720_-|tryptophan-synthase-subunit-beta
MNEQHDPHGPDERGYFGPYGGRFMPEALIAALDELTTVYEKASVDPEFTGEFQRLLRDYAGRPSLLTEVPRFAEHAGGARVLLKREDLNHTGSHKINNVLGQALLTKRMGKKRVIAETGAGQHGVATATACALMGLDCVVYMGEVDTQRQALNVARMRLLGAEVIPVTSGSRTLKDAINEALRDWVTNVDSTHYLLGTAAGAHPFPVMVRNFHKVIGIEARQQVLDLTGRLPDAVAACVGGGSNAIGIFHGFLDDPGVRLVGLEPGGKGVDSGHHGATLTAGTPGMLHGARSYLLQDEDGQTIEAYSISAGLDYPGVGPEHSYLKDLGRAEYRSVTDAEAMAAMRLLSRTEGIIPAIESSHALAGALELGRELGPEGIVLVNLSGRGDKDMDTANSFFGLVEQGES
>NZ_CP007155.1|WP_025360249.1|7983711_7984503_-|tryptophan-synthase-subunit-alpha
MMSLAELFTATREQGRAALVGYLPAGYPTAAGSKSMLRAMVDGGCDLVEVGVPYSDPVMDGPTIQAAATQALEAGFRLRDVFEVVESISSAGGRAVVMTYWNPVNRYGVDAYARDLAAAGGLGIITPDLIPDEADEWLAASTEHGLDRIFLVAPSSTEERIARTAKASSGFLYATSVMGVTGARDVVSSAAPELVRRVRAHTDLPVGVGLGVRNGAQAAELAAFADAVIVGSAFVSKVAEGEQAVADLAAELAQGVRGAAAVA
>NZ_CP007155.1|WP_025360259.1|7994503_7994893_+|PPOX-class-F420-dependent-oxidoreductase
MALSEVERLSAGKYLLLTTFRKDGTPVPTPVWVARDGELLVVWTVAGSGKVKRLRRDDTVELAPCDVKGNPTGDPVPGRARLLDAAGTESARHLITRKYPVTGRLLVWGSRVRRGSKGTIGIAIEPGVA
>NZ_CP007155.1|WP_025360260.1|7994947_7995685_+|Clp-protease
MDAPQYRLDDMITTVKALHPNGDALDQLADAVLISERLGELADHLVGHFVDQARKAGASWTDIGKSMGVSKQAAQKRFVPKADASTIVDMGPFSRFTDRARHVIVETQEEARRAGHNYIGTEHLLLGLLCEPEALAAKALTEQGITAEQLRNSVKVVLGPAKENVPGHIPFTPGAKKVLELTVREALRLGHNYVGTEHILLGIVAEDESVAAKVLFSLGYDREAGEAWIVEQLTELLRQRGPEQE
>NZ_CP007155.1|WP_025360261.1|7995644_7996382_-|bifunctional-1-(5-phosphoribosyl)-5-((5--phosphoribosylamino)methylideneamino)imidazole-4--carboxamide-isomerase/phosphoribosylanthranilate-isomerase-PriA
MTFQLLPAVDVAEGKAVRLVQGEAGTETSYGDPLDAALAWQADGAEWIHLVDLDAAFGRGSNRELLAGVVGKLDVKVELTGGIRDDASLEAALSTGCARVNLGTAALEDPAWCAKVVAEHGERVAVGLDVRITEQGHRVAARGWTRDGGDLWEVLDRLDRDGCSRYVVTDVSKDGTLRGPNLELLREVCARTDAPVVASGGVSSVDDLLALAELSQDGLEGSIIGKALYAGKFTLAQALAAVAAR
>NZ_CP007155.1|WP_025360262.1|7996404_7997037_-|imidazole-glycerol-phosphate-synthase-subunit-HisH
MVPRVVVLDYGSGNLRSAERALRRVGAEVEVTADHRAALDCDGLVVPGVGAFAACMAGLNAVRGGRIIGERLAGGRPVLGICVGMQILFERGVEHGIEAEGCGEWPGTVERLHAEVLPHMGWNTVRAPEGTGLFAGLGPEERFYFVHSYGVRKWELVPDSRLAAPLVTWAEHGEPFVAAVENGPLCATQFHPEKSGDAGAQLLRNWLNGL
>NZ_CP007155.1|WP_148309771.1|7997218_7997902_-|hypothetical-protein
MTARSLIWTPVPTAQLQLRLHAEGDGPALLVPVESGTVLAPSPALRFHRVVALARACRRVGGHAVAVRWNERAATVHPVYDKIVYGWSWGGHAQVLALIDQTVARGPVSRAVLHGQFLVNRDKREDRSRHDLVTARFAESLGAAEDPVFQRVRDWQTGGPDELAALFETAGKSDVAKVVRLVQAGTADSWLAKLPEAGRKAVRTGPLATVLPVVPVTQGSVPPPGQG
>NZ_CP007155.1|WP_025360264.1|7997929_7998817_-|transketolase
MRDAFAETISRALDTDPRLALVLADISADRIQQAARRHPDRVINVGIREQLLIGVTGGLALAGMRPVAHSFPPFLVERAFEQIKLDLSHQDAGAVLVSWGGSYDIADNGRTHMAPGDVALMDTLPGWRIQVPGHPREAAELVSAALPGEDSVYLRLSAQSNAQARPVTPTLQVVRRGREAVVVAVGPTLDRVLAATASMDVTVLYASTVRPFDGAGLRAAVEFTGRADVVLVEPYLAGTSTHCVAEALLHVPHRVLALGVRRDVELRAYGEPADHDAAHGLDVTGIAAAVHTFTG
>NZ_CP007155.1|WP_042222943.1|7998830_7999469_-|transketolase
MPSPAKYANIVNSTLDVLWVLYDRVLDVSPERIEDPDRDRFLLSKGHCPNAFYAVLAAKGFIEAAELDKWGSFASRLGKHPDRVLLPGAEIGSGSLGHGLGLGVGTVLGLRAQGRTAPKVVVLVGDAEMDEGSNHEAIVLAGRLGLEQLTAVVVDNTSASHGWPGGIGARFALEGWAERVVDGHDHTALYEAFTQPHPGRPLVVVAQVEPKN
>NZ_CP007155.1|WP_025360266.1|7999563_8000028_+|redox-sensitive-transcriptional-activator-SoxR
MSKLPDWLTIGQVSERSGVAQTALRFYEDRGLITAERSAGNQRRYNRSVLRRLAFIRTAQRVGLSLEEISSALATLPERRTPTKADWSRLSRNWQAELDARIDALQRLRDKLTYCVGCGCLSLRVCGLHNAEDRLADYGPGAPRLWPAAEGGIP
>NZ_CP007155.1|WP_025360267.1|8000139_8001048_+|ornithine-cyclodeaminase-family-protein
MKVISDAQVRAALRPGAAVRVCRDALVQAHRGTLKAPPRTGIDVGSTELVFTAGGTEAGTVGFGCYGLWPGPEHADQLVAVWGPDGKVRGVVVGHALGALRTGAIGGASVDALARPDASVCAVIGSGTQSWAQLWAASAVRGFTEVRVSSPTPANRTRFAARAREVLGLNAVAMADSVEAVRGADVVLVATKSTRPVLPATAFSPGCHVNTIGPKLRGASELPAELASVSAIVCSDSPAQAAAYGNPFFTGRRLSHLGGIIAGDLPGRISEGQTTLFCSTGLAGTDVLLADLLFTDPEVAAA
>NZ_CP007155.1|WP_025360268.1|8001082_8001613_+|RNA-2'-phosphotransferase
MDKRMITLSKRLAKCLRHAPEQFGVTLGTGGWTEVEPLLHALRMTRAELEHVVAHNDKSRFALDGTGTLIRASQGHSVQVDLDLPEAQPPAVLYHGTAERTVPAILAEGLRPMRRHDVHLSRDVATARRVGARHGRPVVFEVDAAGMSAAGHVFRVSANGVWLTGSVPANALRLMP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007155_20

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007155_20

9567895-9568001

Orphan

Consensus_repeat	Method
GCCCGCCGGGGGGACACCCCCGGACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007155_20

>merge|NZ_CP007155|20|9567895-9568001|CRISPRCasFinder
GCCCGCCGGGGGGACACCCCCGGACCGCCGCCCGATGGGCCGACCGCGCTCGCGGAACACGCTCGCCGGATCGGGCGCTCGTGCCCGCCGGGGGACACCCCCGGACC

>NZ_CP007155|20|19|9567895-9568001|CRISPRCasFinder
GCCCGCCGGGGGGACACCCCCGGACC	GCCGCCCGATGGGCCGACCGCGCTCGCGGAACACGCTCGCCGGATCGGGCGCTCG
TGCCCGCCGGGGGACACCCCCGGACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007155.1\|WP_025361685.1\|9561692_9563228_-\|amidophosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236113
NZ_CP007155.1\|WP_025361691.1\|9569884_9570928_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|176192
NZ_CP007155.1\|WP_025361696.1\|9576168_9577092_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176127
NZ_CP007155.1\|WP_025361682.1\|9557977_9559471_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143404
NZ_CP007155.1\|WP_030109380.1\|9560571_9561651_-\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
NZ_CP007155.1\|WP_025361699.1\|9579187_9580045_+\|lysozyme	unknown	unknown	gnl\|CDD\|119374
NZ_CP007155.1\|WP_025361694.1\|9574342_9575164_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|252734
NZ_CP007155.1\|WP_025361697.1\|9577205_9578066_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381314
NZ_CP007155.1\|WP_025361687.1\|9563887_9564268_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380033
NZ_CP007155.1\|WP_025361698.1\|9578186_9578984_+\|lysozyme	unknown	unknown	gnl\|CDD\|119374
NZ_CP007155.1\|WP_025361690.1\|9568025_9569888_+\|glycoside-hydrolase-family-15-protein	unknown	unknown	gnl\|CDD\|225922
NZ_CP007155.1\|WP_025361681.1\|9556968_9557967_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP007155.1\|WP_042221400.1\|9564390_9567051_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375794
NZ_CP007155.1\|WP_030111734.1\|9571269_9573321_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP007155.1\|WP_025361683.1\|9559523_9559919_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP007155.1\|WP_025361693.1\|9573422_9574265_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|252734
NZ_CP007155.1\|WP_025361686.1\|9563365_9563761_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007155.1\|WP_025361684.1\|9560143_9560572_-\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|181730
NZ_CP007155.1\|WP_158510906.1\|9575318_9576239_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379274
NZ_CP007155.1\|WP_025361689.1\|9567269_9567848_+\|type-VII-secretion-system-associated-protein	unknown	unknown	gnl\|CDD\|236681

Protein	Function_ID	Function_description	E-value
NZ_CP007155.1\|WP_025361685.1\|9561692_9563228_-\|amidophosphoribosyltransferase	gnl\|CDD\|236113	PRK07847, PRK07847, amidophosphoribosyltransferase; Provisional.	0
NZ_CP007155.1\|WP_025361696.1\|9576168_9577092_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176127	cd08436, PBP2_LTTR_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.01432e-57
NZ_CP007155.1\|WP_025361698.1\|9578186_9578984_+\|lysozyme	gnl\|CDD\|119374	cd06412, GH25_CH-type, CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.	5.24118e-113
NZ_CP007155.1\|WP_025361682.1\|9557977_9559471_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	gnl\|CDD\|143404	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD.	0
NZ_CP007155.1\|WP_025361694.1\|9574342_9575164_-\|SAM-dependent-methyltransferase	gnl\|CDD\|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	8.65959e-90
NZ_CP007155.1\|WP_030109380.1\|9560571_9561651_-\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP007155.1\|WP_025361699.1\|9579187_9580045_+\|lysozyme	gnl\|CDD\|119374	cd06412, GH25_CH-type, CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.	1.87982e-112
NZ_CP007155.1\|WP_025361687.1\|9563887_9564268_-\|hypothetical-protein	gnl\|CDD\|380033	pfam17844, SCP_3, Bacterial SCP ortholog. This domain is found in MSMEG_5817 gene product from M. smegmatis. It has been shown to be vital for mycobacterial survival within host macrophages. Crystal structure revealed a Rossmann-like fold alpha/beta two-layer sandwich forming a highly hydrophobic interface cavity and with high structural homology to the SCP family. Hence, it has been suggested that this domain may be involved in the interaction of apolar ligands through its hydrophobic cavity. Alanine-scanning mutagenesis of the hydrophobic cavity of MSMEG_5817 protein demonstrated that the conserved Val82 residue plays an important role in ligand binding.	2.47141e-52
NZ_CP007155.1\|WP_025361697.1\|9577205_9578066_+\|aldo/keto-reductase	gnl\|CDD\|381314	cd19088, AKR_AKR13B1, AKR13B family of aldo-keto reductase (AKR). Xylella fastidiosa phenylacetaldehyde dehydrogenase is a founding member of aldo-keto reductase family 13 member B1 (AKR13B1). phenylacetaldehyde dehydrogenase (EC 1.2.1.39) catalyzes the NAD+-dependent oxidation of phenylactealdehyde to phenylacetic acid.	6.92591e-107
NZ_CP007155.1\|WP_025361691.1\|9569884_9570928_+\|glucose-1-dehydrogenase	gnl\|CDD\|176192	cd08230, glucose_DH, Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability.	3.43223e-131
NZ_CP007155.1\|WP_025361690.1\|9568025_9569888_+\|glycoside-hydrolase-family-15-protein	gnl\|CDD\|225922	COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism].	2.4082e-120
NZ_CP007155.1\|WP_025361681.1\|9556968_9557967_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	2.43772e-104
NZ_CP007155.1\|WP_042221400.1\|9564390_9567051_+\|hypothetical-protein	gnl\|CDD\|375794	pfam18368, Ig_GlcNase, Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.	1.24677e-37
NZ_CP007155.1\|WP_030111734.1\|9571269_9573321_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	6.67767e-106
NZ_CP007155.1\|WP_025361683.1\|9559523_9559919_-\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	0.00750108
NZ_CP007155.1\|WP_025361693.1\|9573422_9574265_-\|SAM-dependent-methyltransferase	gnl\|CDD\|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	1.06564e-75
NZ_CP007155.1\|WP_025361684.1\|9560143_9560572_-\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|181730	PRK09256, PRK09256, aminoacyl-tRNA hydrolase.	7.0366e-59
NZ_CP007155.1\|WP_158510906.1\|9575318_9576239_+\|hypothetical-protein	gnl\|CDD\|379274	pfam13576, Pentapeptide_3, Pentapeptide repeats (9 copies).	0.00189666
NZ_CP007155.1\|WP_025361689.1\|9567269_9567848_+\|type-VII-secretion-system-associated-protein	gnl\|CDD\|236681	PRK10401, PRK10401, HTH-type transcriptional regulator GalS.	3.83448e-05

>NZ_CP007155.1|WP_025361689.1|9567269_9567848_+|type-VII-secretion-system-associated-protein
MQPEHTHLLTITQEMRDNAKANPNTWLHILDPAFRPGEEVPPHGVIGSFRVDANGDIDERFEPNPQWRPSPKAAAMPEPETELERILQRARTGYEPGEALIRAVLNATLLVYAKSPQDRELAGFQDQVTGQILVAAASSHRYVPEAWPHSRAIAGRDLVTQLAGCPLLLNPGQKPGAVISAEHLVEAASLAR
>NZ_CP007155.1|WP_042221400.1|9564390_9567051_+|hypothetical-protein
MPRSSPTHRRAPWLVAALGLSLVVPAGVSSAAPAYRDVTGPSAPGQVVTVPGWRLQSSAKAGQGGAALSTPGYDDGSWTAVPARSTVLGGLVSAGKYPDLDYSTNLRDKVDKADFTVPWWYRQTFTANPADGAHTFLRLTNGIIGGSEIWLNGSKVGTTDNGAYPAHEFDVTGLLRKGGNALAIKASPADPKKQLSISWVDWSPAAPDNNMGIWRDVQLTESGAVSVRNTRVVTSLAVPSLSSADLTIKAEVTNNSASAVTTTVAGTVESTPFSQQVSLKAGETKTVSIGQHVDNPRVWWPYEMGGQPLYHLALTASVNGQVSDRASTDFGIRDVRSALNSSGAMQFTVNGKPFLVRGGGWSSDLLLRYDAQKLADQFGYVRDLGLNTVRLEGKEENDELYQLADKMGIMLLPGWECCSYWQSPDKWTAADHAVAKASATTEGLRLRNHPSILGFYIGSDEAPTATTEKEFLDGLKVSDWQAPVINAAADRSSPQLGRSGNKMDGPYWWVPPNYWYGDKKGGAFGFASEVGPGPTIPDSDALRKYLSPTELTDLWKNPGKAQYHLSPSAEFNKLGSFATALGKRYGAPTSLEDFTRKSQLANYEVNRAQFEAFGRNQSKAHNPATGVVYWMLNNPWPTLYWHLFDNSMAPSGSYFGAKAALRPLHVQYSYDDRSVALVNTGLGEASKLSVQTTVFNADGTVKSDSTQNSVTAKGNGSTTLAKVPTPSGLSSTYFVRLLLRDANGTVVDRNVYWLSTKADVLDYGKSTWYDTPQTGYADLTGLQGLGTGKVTAKAQSSTSGDHTSTALTLTNSGDKVAFFLRATVRKGAGGAEVTPVTWSDNYVTIWPGETVTLTADYRTADLGGATPSVQVAGVNVAARSVSAAPR
>NZ_CP007155.1|WP_025361687.1|9563887_9564268_-|hypothetical-protein
MPSTVDPHETRAAVLAVADWLTGAAEKPERPVLAAAVRLSLRTLAQVAPGRSVEVRVPPFAAVQCVEGVRHTRGTPPNVVETDALTWLRLAVGLEDWSAAVEDGRISASGSRADLSGWLPLLRVTP
>NZ_CP007155.1|WP_025361686.1|9563365_9563761_-|hypothetical-protein
MRKVLLLACGAISCVALVLGVATFVWGITPHEWDGDLDFTVTQFCHTTGDAPPSCAVLEPDQDQRGSASPIVDVRNVSTESWNLPAHTKVGDAVVCHVHQRDVAIDSAGGLTKVDQCRPMSATASAIAPKS
>NZ_CP007155.1|WP_025361685.1|9561692_9563228_-|amidophosphoribosyltransferase
MVTDRSAACPSNSSDEPEREPREECGVFGVWAPGEDVAKLSYYGLYALQHRGQEAAGISVSDGRQIVVFKDLGLVSQVFDEQVLSSLHGHIAVGHCRYSTTGSTTWENAQPVFRTTATGSGLALGHNGNLVNTAELLARSREAGLDMRNGATTDSDLMSGLLAAAAADKGLEQAAMELLPTLRGAFCLVFSDESTLYAARDPQGVRPLVLGRLERGWVVASETAALDIVGASFVREVEPGELLAIDAEGLRSSRFATPEPKGCVFEYVYLARPDTTIAGRSVHATRVEIGRRLAAEHPVQADLVIPVPESGTPAAIGYAQASGIPYGSGLVKNAYVGRTFIQPSQTIRQLGIRLKLNPLRDVIRGKRLVVVDDSIVRGNTQRALVRMLRESGALEVHVRIASPPVRWPCFYGIDFASRAELVANGLDFDGIRRSIGADSLGYVSLEALVAASEQPRSRLCAACFDGDYPIPLPEDAMIGKHLLEDIEKGVAGSAAPVLTNGYGAEDALRRP
>NZ_CP007155.1|WP_030109380.1|9560571_9561651_-|phosphoribosylformylglycinamidine-cyclo-ligase
MTTDTNSPKATYAAAGVSIAAGDEAVEKLKPWAQKANRPEVLGGIGGFAGLFKLKLDRWKDPVLAASTDGVGTKIAVAQAMDVHDTIGVDLVAMVVDDLVVCGAEPLLLQDYIAVGKVVPDRIAAVVKGIAEGCVQAGCALLGGETAEHPGLMADGVYDVSATGVGVVEASKLLGPDRVQGGDVVIGMGSTGLHSNGYSLARHVLLEIARMPLEGHVEEFGRTLGEELLEPTKIYAKDCLALAAEADARTFAHITGGGLVANLARVIPEGLTATLDRGTWTPAPVFALIAQRGRVEREEMEKTFNMGVGMVAVVSAEDADRALAVLTARHVPAWVLGEVSESESEDAARVVLRGEHPRF
>NZ_CP007155.1|WP_025361684.1|9560143_9560572_-|aminoacyl-tRNA-hydrolase
MPEELRVTPSLVIAGAELHERFSRSSGPGGQGVNTADSRVELSFDVARSVSVPEHLRPRMLARLANRLTAGVLTIAASEYRSQLANRQAARERLVALLRAAAAPPPAARRATKPSRGAKERRLAEKRRRSDTKRGRRGGYDD
>NZ_CP007155.1|WP_025361683.1|9559523_9559919_-|SH3-domain-containing-protein
MKFSYRAVTAGFAVLLSAGALVAGSATASAQEPGTGASPEAGTSLACPDHRWSNHDGRTGRFFKSNSVNIRTGPSTGCTSLGHGQKSHRVRLNCWKHGVGGTWSHVQDLTTGVRGWVKNSLLVGGGANKRC
>NZ_CP007155.1|WP_025361682.1|9557977_9559471_+|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase
MSSAPVAHWIDGARTTGSSTRTAPVFQPATGEVAREVLLAEQSDVDLAVGSAAKAAVAWADSSLSTRSRILFAYRQLLDQHRDELAAIISAEHGKVLSDAAGEVQRGLEVVEFACGIPHLLKGEHSEQVSRGVDAYSVREPLGVVAGITPFNFPVMVPMWMFPVAIACGNAFVLKPSERDPSASVRLAELFSEAGLPDGVLNVVQGDAFAVNALLDHPEVSGVSFVGSTPIARHVYARGTANGKRVQALGGAKNHMVVLPDADLDVAADAAVSAGYGSAGERCMAISVVVAVGDIADELVAKIAERTRELRTGPGDQPGSQMGPLVTGAHRDRVRSYVDAGVAQGATLVVDGRGHAPAGNENGFWVAPTLFDHVGTEMSIYTEEIFGPVLSVVRVATFEDAVRLVNANPYGNGTAVYTGDGLAAREYQRRVTVGMVGINVPIPVPMAYYSFGGWKDSLFGDTHVHGADGVRFYTRAKAVTARWPRQSGIDLGFPTHG
>NZ_CP007155.1|WP_025361681.1|9556968_9557967_+|LacI-family-DNA-binding-transcriptional-regulator
MGRPTMEDVAARAGVSRALVSLVMRGSPKVSEQRRQAVLLAAEELGYSPHAMARSLASATSTVLGAMVSDLHNAFFAEVVEGLEAAASAEGFDLILNTGGRSPSRERRAVDSLLSFRPAGIALLGPVVPASTIASAAAQAPTVLVSRASRLSTVDTVNDDGEAGSGLAVDHLVQLGHRAIAHLDGGNGSQSSLRRKGYVAAMQRNGLQPLVIASEYTDTAGAKAIRALLERGEPLPTAIVAANDFNAVGAISALEDAGLRVPDDVSVVGYDNTSLAALRHVSLTTVDQPRNEMGRLAAEALLERVRGQRSEAMHRWLHPSLVVRATTSPPSR
>NZ_CP007155.1|WP_025361690.1|9568025_9569888_+|glycoside-hydrolase-family-15-protein
MAELDSGPGRIEDYALLSDLRSAALVGTDGSVDWLCLPRFDSPSCFSRLLGDDQSGRWLIAPTGEISSVRRQYRDTTLVLETEFQTVDGVVRLIDTMPPHEPDGTDETRLVRIIEGVSGEVEVRLRWVVRFAYGDSTPWVRRVKRDGDEHILAVAGPHAVVLRGDRLPYRVHHERAHEAVFTVAEGQRLSWVMEFTSTPDDPSPAVDPEAEVARSERFWRKWSGDIGYEGPHAELVHRSLATLKGLTYAPTGGIVAAPTTSLPEALGGERNWDYRYCWLRDATLTLLAFDNFGCSQEALAWRGWLLRAVAGDPADVQIMYAIDGQRHLLEWEVDWLPGYQGAKPVRVGNAAYRQLQLDVYGEVMDALHLARERGVAESAESWALQRGLLRHLESIWAMPDKGLWEVRGPDRFFTHSRVMIWVAFDRAVRAVEEDGLPGPVRRWRELRDAVHEEVLAKGWNEEVGAFTQYYGGTELDAATLLIPAVGFLPGTDERVRSTISAIEKELKHGDLVDRYSTGRGESEVDGLRGHEGSFLACSFWFVDALALSGRREEAEAMFERLLGLTNDVGLLAEEFDVDNQRFTGNFPQAFSHLALVNSAAVLYGGRHRRHERDRRNGVEA
>NZ_CP007155.1|WP_025361691.1|9569884_9570928_+|glucose-1-dehydrogenase
MRAATVVPGRPDDLLLEDLPDPLPGKDELLVAGVLAGLCHTDLEVISGRFGTLPPGRDRMVLFHEAFGRVVSAPEGSGFVPGDHVAGMVRRPDPTPCGPCANHRWDFCLREDYTERGVKELDGYGSQLWTVEPRYAVKLAASVGEAAVLTEPTSVVAKAWDQAETVGGRVFASQRTALITGAGPVGLLAAMLGVQRGLDVHVLDRVTDGRKPDLVRQLGATYHHDLDSLRVAPDVVIECTGVGPLVFEAVRRTARNAVVVLLGLSTSDGPAPLHTGAFNDQLVFGNTSVVGSVNAGPHHFVQAAEALRLADPQWLAQLLTRRVPLSRWTDALTRSADDIKVTIDLQA
>NZ_CP007155.1|WP_030111734.1|9571269_9573321_-|EAL-domain-containing-protein
MGTSYVPMTKAEVVDHLRGLTDLLVGALLTEPFRTAAAHEVGIRLVEAHFTGTETLDRTIQLMGDELLGELRRDGDPVLYSRIAALQGALAAGYAQSLRERTLDEQEAIREAVLDARDHAEAALRASEARFRAVFAEAAIGMGISDTDGNVLEVNQSLQDMLGYPASELRQRNLRSLMHEDDVASVWEFYEELVRGERDHFRVEKRFKRRDNQSVWTHLTISLVRDDDGRPAYQVAMVEDVTDRHLLQNRLRYQALHDPLTGLPNRALFLERLGKAFDTSVVSARVGLCYLDLDGFKVINDSLGHDIGDQLLVAVARRLDESVSGDGMLVARMGGDEFVILMEGSTGTQSIVDVADRVLTSLTGPVRIDGHELSVSASIGIVERAIEGTTSADVMRDADITLYWAKADGKSRWALYDPERNAREVARFTLSATMPAALERDEFYVDYQPLVRLEDSKILGVEALVRWQHPEFGRLAPDRFIELAEETGLIVPLGRWVLRKACQQARRWLDAFGDATPFVSVNLAVRQSRDPALVADVRQILAEAALPPHLLQLELTESAIMGTADEPLEALRALSDMGVRIAIDDFGTGYSNLAYLRHLPVHELKIAGSFMEGLRAADGADPVDAQIVSTLVSLAHALGLTVTAEGVETPAQAERLRRIGCDAGQGWLFARPGPPDHIEPLFS
>NZ_CP007155.1|WP_025361693.1|9573422_9574265_-|SAM-dependent-methyltransferase
MEHPNQARKSNGAGEVDLRRVSVARIDDYLLGGAHNFAVDRELAEQAVRLMPQLPRLVQTNRAFLGRAVRYLVECGVSQFIDLGSGLPTAGNAYDVAKRATSAARVVHVDADPMVVAHSRCMVEGPNSAIIQADLREPDSVLDDPTTRKLIDLNRPVGLLMLFVLDFVPYAEDLVALIARYRERMAPGSHLVVSHSTVDGGDDTFARAQELYRSYAIEIYPRTRGEVSSLLAGFELAEPGVVQVPHWRAVGSESSESGPAEDIDEQPEHAGAYAVVGRRP
>NZ_CP007155.1|WP_025361694.1|9574342_9575164_-|SAM-dependent-methyltransferase
MDRPSWAPVDVDVSRPSSARVYDYYLGGAHNFAVDRAVAEQTLRLMPGLDQVMRLNRAFLRRSVRMLVRSGVTQFLDLGAGIPTAGNVHEVAQAENPTARVLYVDVDPVAVAHSNTMLAGNERAAALQADIRDPKRIFDEAQRGGVLELDRPVAVLMNFVLHFVPDSDDPEGVVAVYRQLMSEGSYLVLSHAGFDSESDPPSGWASAVDLYDREVSVLHFRRSDRVARLFSGFDLLEPGVVRLPLWRPDPDEEVPGDAHRYLGFAGVGRKPCR
>NZ_CP007155.1|WP_158510906.1|9575318_9576239_+|hypothetical-protein
MGDQVWLWTSGAAVLVLLVVVPVIGRRWARMVWLPTCILAFAVLAAVTGWLRLVEPGTSHVEALKTGGLAAASVVALYGLWLNDRRRRVEERRQEQEDLRIAHDRERVADERFAKSVELLGHAGDQVRLGAMHALANLARSRREYTQTVLDVLCAYLRRPFALGEDDLEKQVRLTAQRLVGALLPAAGSDGPDYDLDLTGATLEYLDLSGRRIGELTMRRANLHQATALYEAEIRGPAWFTAATAHYRFVAHRTTFHDKAWFSGFVAVGPADFSGARFLGETKFSRARFQDTMRSAAQPSPGPIPG
>NZ_CP007155.1|WP_025361696.1|9576168_9577092_-|LysR-family-transcriptional-regulator
MELRQLEYFVAVAEECHFTRAAQRLHVAQSGLSASIRTLERELGATLFLRSTRQVELTEAGRALLVEARRALTNVAAARDAVAAVQGLLRGRLAVGTIQCLCTVDLPRVLAQFSAAHPGVQMQLRHSESADLIEQVRTGRLDVAFVSRPARCPDDVMMTPLAAVPMALTCGPEHPFALRSEVALEELSGLSFVDYNPGWGTRDTVDRVLAAAAVDRHVALEVNDVHSLLDLVACGLGVALVPEHFAHKRTEARFVPLAGAVPCWETVIVTPASHSAAASVLLRMVSRESARETAALPSASCPGTARG
>NZ_CP007155.1|WP_025361697.1|9577205_9578066_+|aldo/keto-reductase
MQTRRIGDAQVSAIGLGGMPLSIEGRPDEARAVATIHAALEAGVTLIDTADAYSLGGPDTGHNEALIARAVASFGGDTSEVLIATKGGHLRPGDGTWTLDGTAAHLKQACEDSLKRLGVEAIGLYQFHRPDPDTDYAESIGALRDLLDQGKIRFAGISNANPEQIRLADEILGGRLVSVQNQFSPEFRSSEPELRLCEEMGVAFLPWSPLGGITKAAELGSRFAAFNEVAARHGVSPQQVTLAWMLAKSPVVIPIPGSSRPETIRDSAAAVHLELSAEDITALDAA
>NZ_CP007155.1|WP_025361698.1|9578186_9578984_+|lysozyme
MRALLATAAASALLAVVCPASATASPLAPAHPEDDFAGAQIRKHEGTDPGRVVELSVAEDTLGMDVSSHQGNVDWPKASRDGAKFVYIKATEGVTYTNPNFTQQYNGSYDVGMIRGAYHFALPDVSDGRTQANYFIDHGGGWSKDGRTLPPALDLEYNPYGDTCYKKSPADMVAWTRAFSDRVRERTGRLPTIYTSTSWWSKCTGNNGGFGANPLWIPRYGPEVGTLPNGWARQTIWQFADKGTLPGDQNRYAGNQDGLRSFATG
>NZ_CP007155.1|WP_025361699.1|9579187_9580045_+|lysozyme
MAGTALAARTRLAAIAVATGALLMGGMVPANAAPPTPDGNNPPLSVQDAQHNHVLGSQIRKHEGARGASRPLPMRAEDVVYGMDVSSYQGDVDWQTAWNNGGRFAYIKATEGTYYTNANFTQQYNGSYNVGMIRGTYHFATPNTTSGGTQANYFVDHGGGWSSDGKTLPGALDIEWNPYGDTCYGLSPGAMVRWILDFSDTYKARTGVFPVIYTATTWWSQCTGNQGDFTSTNPLWVARYASSVGALPYAWTFYTFWQYSNSGTFPGDQNLFNGSYDRLVALAKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP007155_14	14.2\|6803648\|37\|NZ_CP007155\|CRISPRCasFinder	6803648-6803684	37	NZ_CP007155.1	3204263-3204299	0	1.0
NZ_CP007155_14	14.2\|6803648\|37\|NZ_CP007155\|CRISPRCasFinder	6803648-6803684	37	NZ_CP007155.1	3406789-3406825	0	1.0
NZ_CP007155_14	14.2\|6803648\|37\|NZ_CP007155\|CRISPRCasFinder	6803648-6803684	37	NZ_CP007155.1	2950862-2950898	0	1.0
NZ_CP007155_14	14.2\|6803648\|37\|NZ_CP007155\|CRISPRCasFinder	6803648-6803684	37	NZ_CP007155.1	6585596-6585632	1	0.973

1. spacer 14.2|6803648|37|NZ_CP007155|CRISPRCasFinder matches to position: 3204263-3204299, mismatch: 0, identity: 1.0

accaccccagaacaccgaacacgcgacaccccaacgt	CRISPR spacer
accaccccagaacaccgaacacgcgacaccccaacgt	Protospacer
*************************************

2. spacer 14.2|6803648|37|NZ_CP007155|CRISPRCasFinder matches to position: 3406789-3406825, mismatch: 0, identity: 1.0

accaccccagaacaccgaacacgcgacaccccaacgt	CRISPR spacer
accaccccagaacaccgaacacgcgacaccccaacgt	Protospacer
*************************************

3. spacer 14.2|6803648|37|NZ_CP007155|CRISPRCasFinder matches to position: 2950862-2950898, mismatch: 0, identity: 1.0

accaccccagaacaccgaacacgcgacaccccaacgt	CRISPR spacer
accaccccagaacaccgaacacgcgacaccccaacgt	Protospacer
*************************************

4. spacer 14.2|6803648|37|NZ_CP007155|CRISPRCasFinder matches to position: 6585596-6585632, mismatch: 1, identity: 0.973

accaccccagaacaccgaacacgcgacaccccaacgt	CRISPR spacer
accaccccggaacaccgaacacgcgacaccccaacgt	Protospacer
********.****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	89872-89905	6	0.824
NZ_CP007155_17	17.2\|7342690\|33\|NZ_CP007155\|CRISPRCasFinder	7342690-7342722	33	MH834612	Arthrobacter phage Faja, complete genome	25790-25822	6	0.818
NZ_CP007155_11	11.1\|5121449\|29\|NZ_CP007155\|CRISPRCasFinder	5121449-5121477	29	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	141454-141482	7	0.759
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	MT658803	Mycobacterium phage Reindeer, complete genome	48427-48460	7	0.794
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5119642-5119675	7	0.794
NZ_CP007155_13	13.9\|6148798\|32\|NZ_CP007155\|CRISPRCasFinder	6148798-6148829	32	NC_018582	Gordonia sp. KTR9 plasmid pGKT1, complete sequence	18739-18770	7	0.781
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NC_019307	Streptomyces sp. W75 plasmid pCQ4, complete sequence	81863-81896	8	0.765
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP020811	Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed2, complete sequence	18000-18033	8	0.765
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	119025-119058	8	0.765
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	KR053195	Gordonia phage GMA1, complete genome	32252-32285	8	0.765
NZ_CP007155_13	13.9\|6148798\|32\|NZ_CP007155\|CRISPRCasFinder	6148798-6148829	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1265228-1265259	8	0.75
NZ_CP007155_13	13.9\|6148798\|32\|NZ_CP007155\|CRISPRCasFinder	6148798-6148829	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	512648-512679	8	0.75
NZ_CP007155_13	13.9\|6148798\|32\|NZ_CP007155\|CRISPRCasFinder	6148798-6148829	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	584012-584043	8	0.75
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NC_019307	Streptomyces sp. W75 plasmid pCQ4, complete sequence	69645-69678	9	0.735
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	9303-9336	9	0.735
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NC_013449	Streptomyces sp. W9 plasmid pCQ3, complete sequence	63170-63203	9	0.735
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP046574	Rhodococcus sp. WAY2 plasmid pRWAY02, complete sequence	243606-243639	9	0.735
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	131889-131922	9	0.735
NZ_CP007155_13	13.5\|6148798\|33\|NZ_CP007155\|CRT,PILER-CR	6148798-6148830	33	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1265227-1265259	9	0.727
NZ_CP007155_13	13.6\|6148615\|32\|NZ_CP007155\|CRISPRCasFinder	6148615-6148646	32	NZ_CP018064	Rhodococcus sp. 2G plasmid p1, complete sequence	86569-86600	9	0.719
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP044078	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence	68883-68916	10	0.706
NZ_CP007155_12	12.1\|6136083\|34\|NZ_CP007155\|CRISPRCasFinder	6136083-6136116	34	NZ_CP020695	Sulfitobacter sp. D7 plasmid p1SUD7, complete sequence	20391-20424	10	0.706

1. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 6, identity: 0.824

ctggatgcgcgagccggtcggcgtgtg-gggcggc	CRISPR spacer
cgtgctgcgcgagccggtcggcgtctgcgggctg-	Protospacer
*  * ******************* ** **** *

2. spacer 17.2|7342690|33|NZ_CP007155|CRISPRCasFinder matches to MH834612 (Arthrobacter phage Faja, complete genome) position: , mismatch: 6, identity: 0.818

ctcgctgtgatgctgggcgcacaggatcaggtc	CRISPR spacer
gccggcgcgatgctgggcgcacaggatcaggtg	Protospacer
 .** .*.************************

3. spacer 11.1|5121449|29|NZ_CP007155|CRISPRCasFinder matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

ggtccagttcgctggacagctccgagtac	CRISPR spacer
ggtccaggtcgctggacaggtccagagcc	Protospacer
******* *********** ***...  *

4. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to MT658803 (Mycobacterium phage Reindeer, complete genome) position: , mismatch: 7, identity: 0.794

-ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
ggaagatg-acgagcagttcggcgtgtggggcggc	Protospacer
   .**** .***** * *****************

5. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
cggcatcggcgaatcggtcggcgtgtggggcgtc	Protospacer
* * **  ****..****************** *

6. spacer 13.9|6148798|32|NZ_CP007155|CRISPRCasFinder matches to NC_018582 (Gordonia sp. KTR9 plasmid pGKT1, complete sequence) position: , mismatch: 7, identity: 0.781

cgacatccagggggcattcgccg--tcgatcgca	CRISPR spacer
cgacatccaggcggcaatcgccggacggatca--	Protospacer
*********** **** ******  . ****.

7. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NC_019307 (Streptomyces sp. W75 plasmid pCQ4, complete sequence) position: , mismatch: 8, identity: 0.765

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
ggagcgccgcgagccgtacggcgtgtggggcggc	Protospacer
  .*   *********  ****************

8. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP020811 (Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.765

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
cacgctgcgcgagccggtcggtgtgtgcggactc	Protospacer
*  * ****************.***** **   *

9. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.765

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
ctggaagggcgagccggtcggcgtggtctgcgat	Protospacer
***** * *****************    ***..

10. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to KR053195 (Gordonia phage GMA1, complete genome) position: , mismatch: 8, identity: 0.765

ctggatgc---gcgagccggtcggcgtgtggggcggc	CRISPR spacer
---ggcgcgcggcgagtcgttcggcgtgtggggcggg	Protospacer
   *..**   *****.** ****************

11. spacer 13.9|6148798|32|NZ_CP007155|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

cgacatccagggggcattcgccgtcgatcgca	CRISPR spacer
gcacatccagggggccttccccgtcggcgcca	Protospacer
  ************* *** ******..  **

12. spacer 13.9|6148798|32|NZ_CP007155|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 8, identity: 0.75

cgacatccagggggcattcgccg---tcgatcgca	CRISPR spacer
cgacttccagggggcagtcgccgagatgaacc---	Protospacer
**** *********** ******   * .*.*

13. spacer 13.9|6148798|32|NZ_CP007155|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 8, identity: 0.75

cgacatccagggggcattcgccg---tcgatcgca	CRISPR spacer
cgacttccagggggcagtcgccgagatgaacc---	Protospacer
**** *********** ******   * .*.*

14. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NC_019307 (Streptomyces sp. W75 plasmid pCQ4, complete sequence) position: , mismatch: 9, identity: 0.735

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
gcagctcaccgagccggaaggcgtgtggggcggc	Protospacer
 ..* *   ********  ***************

15. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
catcctgcgcgagccgatcggcgtgtgcggcctg	Protospacer
*    ***********.********** ***

16. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NC_013449 (Streptomyces sp. W9 plasmid pCQ3, complete sequence) position: , mismatch: 9, identity: 0.735

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
gcagctcaccgagccggagggcgtgtggggcggc	Protospacer
 ..* *   ********  ***************

17. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP046574 (Rhodococcus sp. WAY2 plasmid pRWAY02, complete sequence) position: , mismatch: 9, identity: 0.735

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
caccctgcgcgagccggtcggggtgtgcggactc	Protospacer
*    **************** ***** **   *

18. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 9, identity: 0.735

ctggatgcgcgagccggtcggcgtgtg-gggcggc	CRISPR spacer
cgtccggcgcgagccgatcggcgtgtgcggactg-	Protospacer
*     **********.********** **.* *

19. spacer 13.5|6148798|33|NZ_CP007155|CRT,PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.727

cgacatccagggggcattcgccgtcgatcgcag	CRISPR spacer
gcacatccagggggccttccccgtcggcgccat	Protospacer
  ************* *** ******..  **

20. spacer 13.6|6148615|32|NZ_CP007155|CRISPRCasFinder matches to NZ_CP018064 (Rhodococcus sp. 2G plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

cgcaggatcggggcgaacaacaacccgatgtg	CRISPR spacer
aactggatcggggcgaaccgcaacccgtacgg	Protospacer
 .* ************** .*******    *

21. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP044078 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
tactttgcgcgagccggtgggcgtgtgcggccag	Protospacer
.    ************* ******** *** .

22. spacer 12.1|6136083|34|NZ_CP007155|CRISPRCasFinder matches to NZ_CP020695 (Sulfitobacter sp. D7 plasmid p1SUD7, complete sequence) position: , mismatch: 10, identity: 0.706

ctggatgcgcgagccggtcggcgtgtggggcggc	CRISPR spacer
tacaacgcgcgagccggtcggcgtggtgggggcg	Protospacer
.  .*.*******************  *** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4694436 : 4791747

Leptospira_phage(25.0%)

protease,integrase,transposase

attL 4741458:4741517|attR 4783270:4784380

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025357599.1\|4694436_4694892_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_025357600.1\|4695034_4695523_-	universal stress protein	NA	NA	NA	NA
WP_025357601.1\|4696226_4696655_+	DUF2267 domain-containing protein	NA	NA	NA	NA
WP_148309548.1\|4697088_4697772_+	hypothetical protein	NA	NA	NA	NA
WP_025357602.1\|4697897_4698701_+	sigma 54 modulation/S30EA ribosomal C-terminal domain-containing protein	NA	NA	NA	NA
WP_025357603.1\|4698709_4699024_+	hypothetical protein	NA	NA	NA	NA
WP_025357604.1\|4699108_4699870_+	hypothetical protein	NA	NA	NA	NA
WP_148309549.1\|4700161_4700329_+	CBS domain-containing protein	NA	NA	NA	NA
WP_025357605.1\|4700554_4701106_+	DUF4232 domain-containing protein	NA	NA	NA	NA
WP_025357606.1\|4701283_4702201_+	fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_025357607.1\|4702867_4704631_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.9e-129	47.1
WP_025357608.1\|4704681_4705623_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_025357609.1\|4705619_4706612_+	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_025357610.1\|4706604_4707918_+	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_081789924.1\|4707980_4708172_+	acyl carrier protein	NA	NA	NA	NA
WP_025357612.1\|4708325_4709660_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_081789424.1\|4709779_4709986_+	DUF1918 domain-containing protein	NA	NA	NA	NA
WP_030110593.1\|4710136_4710814_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_025357613.1\|4710843_4711320_-	FMN-binding protein	NA	NA	NA	NA
WP_025357614.1\|4711333_4712725_-	ferric reductase-like transmembrane domain-containing protein	NA	NA	NA	NA
WP_025357615.1\|4712791_4714147_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_025357616.1\|4714143_4714833_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.7e-33	38.0
WP_025357617.1\|4714958_4715540_-	hypothetical protein	NA	NA	NA	NA
WP_042220596.1\|4715709_4717641_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_025357619.1\|4718149_4719946_-	pyruvate kinase	NA	NA	NA	NA
WP_025357620.1\|4720101_4720536_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_025357621.1\|4720691_4721357_-	hypothetical protein	NA	NA	NA	NA
WP_025357623.1\|4722505_4723207_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_025357624.1\|4723973_4724321_+	hypothetical protein	NA	NA	NA	NA
WP_025357625.1\|4725881_4726673_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.7e-27	33.9
WP_081789426.1\|4726807_4727563_+	hydrogenase small subunit	NA	NA	NA	NA
WP_030109038.1\|4727559_4729269_+	nickel-dependent hydrogenase large subunit	NA	NA	NA	NA
WP_042220601.1\|4729265_4729781_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_081789427.1\|4729777_4731571_+	AfsR/SARP family transcriptional regulator	NA	NA	NA	NA
WP_025357628.1\|4731595_4732153_-	hypothetical protein	NA	NA	NA	NA
WP_081789428.1\|4732203_4732983_+\|transposase	transposase	NA	NA	NA	NA
WP_025357630.1\|4733038_4733491_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025357631.1\|4734185_4734401_+	hypothetical protein	NA	NA	NA	NA
WP_081789429.1\|4734943_4735264_-\|transposase	transposase	U5P429	Shigella_phage	1.7e-12	41.2
WP_025357633.1\|4735811_4736960_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.1e-37	35.6
WP_030111711.1\|4736892_4737609_-	hypothetical protein	NA	NA	NA	NA
WP_025357634.1\|4737730_4738273_-	dihydrofolate reductase family protein	NA	NA	NA	NA
WP_025357635.1\|4738339_4739029_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_148309550.1\|4739586_4740231_-	DUF4304 domain-containing protein	NA	NA	NA	NA
WP_025357637.1\|4740371_4740647_+	hypothetical protein	NA	NA	NA	NA
4741458:4741517	attL	NA	NA	NA	NA
WP_051913253.1\|4741482_4742460_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-41	31.5
WP_025357639.1\|4742596_4742917_-	hypothetical protein	NA	NA	NA	NA
WP_025357640.1\|4743255_4744110_-	TIGR03564 family F420-dependent LLM class oxidoreductase	NA	NA	NA	NA
WP_025357641.1\|4744195_4744723_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_158510780.1\|4744809_4745070_+\|transposase	transposase	NA	NA	NA	NA
WP_025357642.1\|4746354_4746750_-	hypothetical protein	NA	NA	NA	NA
WP_025357643.1\|4747212_4750227_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	4.1e-124	32.0
WP_025357644.1\|4750480_4751602_-	epoxide hydrolase	NA	NA	NA	NA
WP_042220604.1\|4751619_4753077_-	MFS transporter	NA	NA	NA	NA
WP_025357646.1\|4753127_4753724_+	CGNR zinc finger domain-containing protein	NA	NA	NA	NA
WP_042220606.1\|4754041_4754281_+	hypothetical protein	NA	NA	NA	NA
WP_051913324.1\|4754740_4755271_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_030111078.1\|4756188_4757220_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_148309552.1\|4757212_4757692_-	hypothetical protein	NA	NA	NA	NA
WP_081789431.1\|4758288_4759152_-	toll/interleukin-1 receptor domain-containing protein	S6BFN8	Thermus_phage	4.3e-26	43.6
WP_025357651.1\|4759411_4760041_-	hypothetical protein	NA	NA	NA	NA
WP_025357652.1\|4760055_4761933_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_158510781.1\|4762154_4762922_-	hypothetical protein	NA	NA	NA	NA
WP_148309554.1\|4762940_4764878_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_051913326.1\|4765030_4765492_+	hypothetical protein	A0A286MR53	Mycobacterium_phage	4.1e-07	40.0
WP_025357657.1\|4766041_4767139_+	DUF3644 domain-containing protein	NA	NA	NA	NA
WP_025357658.1\|4767284_4768421_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_148309555.1\|4769688_4769916_+	hypothetical protein	NA	NA	NA	NA
WP_081789432.1\|4769928_4771218_+	MFS transporter	A0A2K5B2B5	Erysipelothrix_phage	5.7e-06	22.6
WP_025357663.1\|4772090_4772420_+	hypothetical protein	NA	NA	NA	NA
WP_148309556.1\|4772416_4775260_+	hypothetical protein	NA	NA	NA	NA
WP_025357666.1\|4775256_4776039_+	hypothetical protein	NA	NA	NA	NA
WP_148309557.1\|4777408_4779136_-	hypothetical protein	NA	NA	NA	NA
WP_148309558.1\|4779661_4780678_-	hypothetical protein	NA	NA	NA	NA
WP_148309559.1\|4780955_4782224_+	transcriptional regulator	NA	NA	NA	NA
WP_051913253.1\|4782326_4783304_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-41	31.5
WP_025357669.1\|4783559_4783910_-	hypothetical protein	NA	NA	NA	NA
WP_025357670.1\|4783909_4785463_-	hypothetical protein	NA	NA	NA	NA
4783270:4784380	attR	NA	NA	NA	NA
WP_025357671.1\|4785593_4785977_-	hypothetical protein	NA	NA	NA	NA
WP_025357672.1\|4786135_4786336_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025357673.1\|4786332_4786689_+	WhiB family transcriptional regulator	NA	NA	NA	NA
WP_025357674.1\|4786685_4787021_+	hypothetical protein	NA	NA	NA	NA
WP_042222327.1\|4787050_4787590_+	hypothetical protein	NA	NA	NA	NA
WP_025357676.1\|4787586_4789695_+	cell division protein FtsK	NA	NA	NA	NA
WP_148309647.1\|4790633_4791747_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-34	35.4

DBSCAN-SWA_2

5219126 : 5236373

Yellowstone_lake_phycodnavirus(100.0%)

protease,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025357383.1\|5219126_5220020_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081789457.1\|5220716_5221310_+\|transposase	transposase	NA	NA	NA	NA
WP_025358081.1\|5221752_5222286_-	hypothetical protein	NA	NA	NA	NA
WP_025358082.1\|5223026_5223920_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_158510789.1\|5224453_5225164_-\|bacteriocin	bacteriocin fulvocin C-related protein	NA	NA	NA	NA
WP_148309582.1\|5226067_5226592_-\|transposase	transposase	NA	NA	NA	NA
WP_025358084.1\|5227062_5227293_-	hypothetical protein	NA	NA	NA	NA
WP_025358085.1\|5227382_5227970_+	TetR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_025358086.1\|5228012_5228627_+	hypothetical protein	NA	NA	NA	NA
WP_025358087.1\|5228547_5229582_-	PHP domain-containing protein	NA	NA	NA	NA
WP_025358088.1\|5229645_5229933_-	hypothetical protein	NA	NA	NA	NA
WP_025358089.1\|5230199_5231942_+	pyruvate dehydrogenase	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	4.3e-25	23.3
WP_169743532.1\|5232039_5232195_+	hypothetical protein	NA	NA	NA	NA
WP_148309585.1\|5232369_5232549_-	hypothetical protein	NA	NA	NA	NA
WP_025358090.1\|5232568_5232940_-	hypothetical protein	NA	NA	NA	NA
WP_025358091.1\|5233061_5233586_-	hypothetical protein	NA	NA	NA	NA
WP_025358092.1\|5233847_5234369_+	SRPBCC family protein	NA	NA	NA	NA
WP_025358093.1\|5234384_5235380_+	hypothetical protein	NA	NA	NA	NA
WP_025358094.1\|5235611_5236373_+\|protease	trypsin-like serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

5487502 : 5503791

Streptomyces_phage(42.86%)

portal,capsid,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025358335.1\|5487502_5487961_+\|terminase	phage terminase small subunit P27 family	A0A142K627	Streptomyces_phage	3.1e-31	50.9
WP_042220738.1\|5487923_5489642_+\|terminase	terminase large subunit	B5A5W9	Mycobacterium_virus	6.1e-189	60.0
WP_025358337.1\|5489693_5489924_+	hypothetical protein	NA	NA	NA	NA
WP_025358338.1\|5489928_5491476_+\|portal	phage portal protein	A0A2L1IYC4	Mycobacterium_phage	1.8e-91	39.6
WP_148309606.1\|5493016_5494489_+\|capsid	phage major capsid protein	A0A249XP56	Mycobacterium_phage	4.9e-86	40.8
WP_025358340.1\|5494559_5494988_+	hypothetical protein	NA	NA	NA	NA
WP_025358341.1\|5494991_5495189_+	hypothetical protein	NA	NA	NA	NA
WP_030110526.1\|5495218_5495776_+	hypothetical protein	NA	NA	NA	NA
WP_025358343.1\|5495785_5496127_+	hypothetical protein	NA	NA	NA	NA
WP_025358344.1\|5496126_5496447_+	hypothetical protein	NA	NA	NA	NA
WP_025358345.1\|5496446_5496821_+	hypothetical protein	NA	NA	NA	NA
WP_042220741.1\|5496926_5497883_+	fibronectin type III domain-containing protein	A0A160DET9	Gordonia_phage	3.7e-10	25.5
WP_025358347.1\|5498046_5498376_+	hypothetical protein	NA	NA	NA	NA
WP_025358348.1\|5498423_5498795_+	hypothetical protein	NA	NA	NA	NA
WP_025358349.1\|5498814_5502912_+\|tail	phage tail tape measure protein	Q6VY42	Streptomyces_phage	5.2e-45	37.7
WP_025358350.1\|5502924_5503791_+\|tail	phage tail family protein	A0A1J0MCQ9	Streptomyces_phage	4.5e-07	32.5

DBSCAN-SWA_4

5780278 : 5913206

106

Leptospira_phage(57.14%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158510808.1\|5780278_5780743_+\|transposase	transposase	NA	NA	NA	NA
WP_158510809.1\|5780925_5781252_+	hypothetical protein	NA	NA	NA	NA
WP_081789498.1\|5781281_5781710_+	EVE domain-containing protein	NA	NA	NA	NA
WP_025358585.1\|5781752_5782028_+	hypothetical protein	NA	NA	NA	NA
WP_025358586.1\|5782299_5783436_+	hypothetical protein	NA	NA	NA	NA
WP_148309639.1\|5783462_5783663_+	hypothetical protein	NA	NA	NA	NA
WP_025358588.1\|5783691_5785596_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_158510810.1\|5785605_5785776_-	recombinase family protein	NA	NA	NA	NA
WP_025358589.1\|5785817_5786024_-	hypothetical protein	NA	NA	NA	NA
WP_025358590.1\|5788050_5788728_+	hypothetical protein	NA	NA	NA	NA
WP_081789499.1\|5788724_5790008_+	7-cyano-7-deazaguanine synthase	NA	NA	NA	NA
WP_148309962.1\|5791342_5793202_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_148309641.1\|5793375_5793573_+	hypothetical protein	NA	NA	NA	NA
WP_025358592.1\|5793982_5794510_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_081789959.1\|5794634_5795333_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_158510811.1\|5795523_5797245_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_158510812.1\|5797746_5799108_-	hypothetical protein	NA	NA	NA	NA
WP_025358596.1\|5799154_5802217_-	hypothetical protein	NA	NA	NA	NA
WP_030110616.1\|5802213_5802828_-	hypothetical protein	NA	NA	NA	NA
WP_025358598.1\|5802839_5803298_-	hypothetical protein	NA	NA	NA	NA
WP_025358599.1\|5803353_5804589_-	hypothetical protein	NA	NA	NA	NA
WP_148309642.1\|5804980_5805931_+	hypothetical protein	NA	NA	NA	NA
WP_025358601.1\|5806967_5810063_-	hypothetical protein	NA	NA	NA	NA
WP_148309644.1\|5809959_5811687_-	DEAD/DEAH box helicase	A0A1V0SDF7	Indivirus	2.6e-30	27.0
WP_025358603.1\|5811667_5812639_-	hypothetical protein	NA	NA	NA	NA
WP_025358604.1\|5812806_5814240_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_025358605.1\|5814359_5814890_-	hypothetical protein	NA	NA	NA	NA
WP_081789501.1\|5814976_5816146_-	cytochrome P450	NA	NA	NA	NA
WP_025358606.1\|5816142_5816994_-	hypothetical protein	NA	NA	NA	NA
WP_025358607.1\|5816993_5818190_-	hypothetical protein	NA	NA	NA	NA
WP_158510813.1\|5818255_5818417_-	hypothetical protein	NA	NA	NA	NA
WP_081789502.1\|5818473_5820786_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_030110621.1\|5820778_5821939_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_051913253.1\|5822099_5823077_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-41	31.5
WP_025358612.1\|5823490_5824150_+	hypothetical protein	NA	NA	NA	NA
WP_081789503.1\|5824272_5824698_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042220801.1\|5825123_5825591_+	hypothetical protein	NA	NA	NA	NA
WP_081789504.1\|5825632_5825896_-	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_030107977.1\|5826016_5826535_-	hypothetical protein	NA	NA	NA	NA
WP_025358615.1\|5826537_5827167_-	hypothetical protein	NA	NA	NA	NA
WP_025358616.1\|5827393_5827588_-	hypothetical protein	NA	NA	NA	NA
WP_025358617.1\|5828473_5828983_-	hypothetical protein	NA	NA	NA	NA
WP_025358618.1\|5829179_5830055_+	hypothetical protein	NA	NA	NA	NA
WP_025358619.1\|5830135_5830438_+	hypothetical protein	NA	NA	NA	NA
WP_025358620.1\|5830457_5831252_-	NYN domain-containing protein	NA	NA	NA	NA
WP_148309645.1\|5832876_5833464_-	hypothetical protein	NA	NA	NA	NA
WP_158510814.1\|5833616_5833895_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_148309646.1\|5833988_5834351_-	hypothetical protein	NA	NA	NA	NA
WP_030107981.1\|5834766_5835114_-	hypothetical protein	NA	NA	NA	NA
WP_025358624.1\|5835110_5835551_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_162483057.1\|5837608_5837905_-	hypothetical protein	NA	NA	NA	NA
WP_025358625.1\|5838012_5838204_-	hypothetical protein	NA	NA	NA	NA
WP_081789960.1\|5838522_5839032_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_148309647.1\|5838946_5840060_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-34	35.4
WP_052360486.1\|5840100_5841525_-	hypothetical protein	NA	NA	NA	NA
WP_025358628.1\|5841687_5842266_-	hypothetical protein	NA	NA	NA	NA
WP_169743535.1\|5842457_5842790_+\|transposase	transposase	NA	NA	NA	NA
WP_081789506.1\|5843090_5843444_+\|transposase	transposase	NA	NA	NA	NA
WP_081789961.1\|5843517_5844639_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_025358630.1\|5844883_5845756_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.7e-12	36.0
WP_158510815.1\|5846047_5846290_+	hypothetical protein	NA	NA	NA	NA
WP_081789962.1\|5846694_5847189_+	DUF4265 domain-containing protein	NA	NA	NA	NA
WP_081789507.1\|5847419_5853833_-	hypothetical protein	NA	NA	NA	NA
WP_025358633.1\|5854145_5859191_+	SGNH hydrolase	NA	NA	NA	NA
WP_025358634.1\|5859379_5860465_+\|transposase	transposase	NA	NA	NA	NA
WP_025358635.1\|5861479_5862493_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_148309647.1\|5862532_5863647_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-34	35.4
WP_081789963.1\|5867595_5869806_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_030108393.1\|5870244_5870874_+\|transposase	TnsA-like heteromeric transposase endonuclease subunit	NA	NA	NA	NA
WP_025358641.1\|5871174_5871798_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_025358642.1\|5871874_5873356_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_148309650.1\|5873430_5873832_+	hypothetical protein	NA	NA	NA	NA
WP_035968068.1\|5874333_5875179_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.4e-13	29.4
WP_025358645.1\|5875205_5875988_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_025358646.1\|5876080_5876683_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042221828.1\|5877272_5878103_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_025358647.1\|5878653_5879442_-	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_025358648.1\|5879446_5880256_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_081789509.1\|5880845_5883164_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_025358650.1\|5883143_5884058_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_025358651.1\|5884057_5884381_-\|transposase	transposase	NA	NA	NA	NA
WP_025358652.1\|5884445_5884853_-	hypothetical protein	NA	NA	NA	NA
WP_148309651.1\|5885754_5887152_+	hypothetical protein	NA	NA	NA	NA
WP_081789964.1\|5887137_5888364_-	TIGR02679 family protein	NA	NA	NA	NA
WP_051913368.1\|5888414_5892635_-	TIGR02680 family protein	NA	NA	NA	NA
WP_158510816.1\|5892631_5893807_-	TIGR02678 family protein	NA	NA	NA	NA
WP_025358657.1\|5893865_5895428_-	TIGR02677 family protein	NA	NA	NA	NA
WP_025358651.1\|5895588_5895912_+\|transposase	transposase	NA	NA	NA	NA
WP_025358650.1\|5895911_5896826_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_025358658.1\|5897207_5898710_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025358659.1\|5898878_5899202_+\|transposase	transposase	NA	NA	NA	NA
WP_025358660.1\|5899201_5900116_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_025353822.1\|5900164_5901205_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_169743536.1\|5903051_5903204_+	hypothetical protein	NA	NA	NA	NA
WP_025358662.1\|5903294_5904506_+	cupin	NA	NA	NA	NA
WP_063750721.1\|5904442_5905324_+	aldo/keto reductase	NA	NA	NA	NA
WP_035968855.1\|5905425_5906232_+	hypothetical protein	NA	NA	NA	NA
WP_025358665.1\|5906654_5907305_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_025358666.1\|5907452_5907818_+	hypothetical protein	NA	NA	NA	NA
WP_025358667.1\|5907802_5908207_+	hypothetical protein	NA	NA	NA	NA
WP_025358668.1\|5908659_5909571_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_025358669.1\|5909567_5909888_-\|transposase	transposase	NA	NA	NA	NA
WP_081789966.1\|5909794_5910874_+\|transposase	transposase	NA	NA	NA	NA
WP_158510817.1\|5910901_5911072_-	hypothetical protein	NA	NA	NA	NA
WP_051913253.1\|5911247_5912225_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-41	31.5
WP_025358670.1\|5912327_5913206_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_5

5940215 : 5996035

Leptospira_phage(33.33%)

integrase,transposase

attL 5940191:5940250|attR 5995033:5996143

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5940191:5940250	attL	NA	NA	NA	NA
WP_051913253.1\|5940215_5941193_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-41	31.5
WP_148309656.1\|5941170_5941605_+	hypothetical protein	NA	NA	NA	NA
WP_025358697.1\|5941615_5942353_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_025358699.1\|5942905_5943238_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_042220815.1\|5944138_5944792_-	hypothetical protein	NA	NA	NA	NA
WP_025358701.1\|5944889_5945330_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_030108678.1\|5945877_5946249_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_148309657.1\|5946368_5946830_+	hypothetical protein	NA	NA	NA	NA
WP_025358704.1\|5946960_5947695_-	prepilin peptidase	NA	NA	NA	NA
WP_158510818.1\|5947751_5947961_+	hypothetical protein	NA	NA	NA	NA
WP_081789967.1\|5947935_5948664_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_025357625.1\|5950287_5951079_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.7e-27	33.9
WP_081789516.1\|5951011_5951539_-	hypothetical protein	NA	NA	NA	NA
WP_025358706.1\|5952215_5952395_-	hypothetical protein	NA	NA	NA	NA
WP_158510819.1\|5953350_5955312_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	5.8e-18	30.5
WP_025358708.1\|5955427_5958220_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_051913085.1\|5958284_5959328_-	hypothetical protein	NA	NA	NA	NA
WP_148309659.1\|5960307_5961930_-	hypothetical protein	NA	NA	NA	NA
WP_148309660.1\|5962136_5963021_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_025358711.1\|5963156_5964245_-\|transposase	transposase	NA	NA	NA	NA
WP_025358712.1\|5964433_5964700_-	hypothetical protein	NA	NA	NA	NA
WP_025358713.1\|5964853_5965513_+	response regulator transcription factor	NA	NA	NA	NA
WP_025358714.1\|5965509_5966664_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_025358715.1\|5966797_5967865_-\|transposase	transposase	NA	NA	NA	NA
WP_051913340.1\|5968076_5969060_-	hypothetical protein	NA	NA	NA	NA
WP_025358717.1\|5969167_5969647_+	hypothetical protein	NA	NA	NA	NA
WP_025358718.1\|5969793_5970864_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_081789968.1\|5971372_5972584_+	hypothetical protein	NA	NA	NA	NA
WP_025358720.1\|5972580_5973123_+	hypothetical protein	NA	NA	NA	NA
WP_025358721.1\|5973119_5973797_+	hypothetical protein	NA	NA	NA	NA
WP_025358722.1\|5973793_5976889_+	hypothetical protein	NA	NA	NA	NA
WP_025358723.1\|5976918_5978256_+	serine/threonine protein kinase	A0A0B5J6A8	Pandoravirus	2.8e-08	28.8
WP_148309661.1\|5978331_5979336_+	hypothetical protein	NA	NA	NA	NA
WP_025358725.1\|5980549_5981515_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081789519.1\|5981720_5982038_-\|transposase	transposase	NA	NA	NA	NA
WP_169743537.1\|5982871_5983027_-	hypothetical protein	NA	NA	NA	NA
WP_063750767.1\|5983243_5983420_-	CsbD family protein	NA	NA	NA	NA
WP_025358728.1\|5983939_5984704_-	GAF and ANTAR domain-containing protein	NA	NA	NA	NA
WP_025358729.1\|5984778_5985495_-	GAF and ANTAR domain-containing protein	NA	NA	NA	NA
WP_030111168.1\|5985819_5986719_+	acyl-CoA desaturase	NA	NA	NA	NA
WP_148309662.1\|5986816_5987869_+	transaldolase	NA	NA	NA	NA
WP_025358731.1\|5988255_5989290_-	acyl-CoA desaturase	A6N231	Microbacterium_phage	3.7e-72	44.1
WP_025358732.1\|5989617_5990739_+	glycosyltransferase	NA	NA	NA	NA
WP_025358733.1\|5990784_5991933_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_025358734.1\|5992311_5992497_-	hypothetical protein	NA	NA	NA	NA
WP_025358735.1\|5992635_5993763_-	AI-2E family transporter	NA	NA	NA	NA
WP_158510820.1\|5994003_5994150_-	hypothetical protein	NA	NA	NA	NA
WP_025358736.1\|5994403_5994961_+	hypothetical protein	NA	NA	NA	NA
WP_051913253.1\|5995057_5996035_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-41	31.5
5995033:5996143	attR	NA	NA	NA	NA

DBSCAN-SWA_6

6001398 : 6062029

Burkholderia_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081789522.1\|6001398_6002178_-\|transposase	transposase	NA	NA	NA	NA
WP_025358742.1\|6002337_6002589_-	hypothetical protein	NA	NA	NA	NA
WP_025358743.1\|6002613_6003495_-	hypothetical protein	NA	NA	NA	NA
WP_025358744.1\|6004278_6004836_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_025358745.1\|6004832_6005825_+	hypothetical protein	NA	NA	NA	NA
WP_030110869.1\|6005891_6006386_-	hypothetical protein	NA	NA	NA	NA
WP_148309667.1\|6007862_6008207_+	hypothetical protein	NA	NA	NA	NA
WP_158510821.1\|6008489_6008702_-\|transposase	transposase	Q8W6R2	Burkholderia_virus	3.6e-11	50.8
WP_025358751.1\|6010575_6011337_-	GAF and ANTAR domain-containing protein	NA	NA	NA	NA
WP_025358752.1\|6012223_6014527_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_148309669.1\|6014795_6015761_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_148309670.1\|6015777_6016455_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_148309671.1\|6017326_6019018_+	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_025358756.1\|6019962_6020349_-	hypothetical protein	NA	NA	NA	NA
WP_025358757.1\|6021505_6022198_-	response regulator transcription factor	NA	NA	NA	NA
WP_148309672.1\|6022194_6022437_-	hypothetical protein	NA	NA	NA	NA
WP_148309673.1\|6022599_6022890_-	hypothetical protein	NA	NA	NA	NA
WP_148309674.1\|6023073_6023906_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_081789969.1\|6023985_6024606_+\|transposase	Mu transposase C-terminal domain-containing protein	NA	NA	NA	NA
WP_025358761.1\|6025983_6026373_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025358762.1\|6026453_6026936_+	NADH-quinone oxidoreductase subunit B family protein	NA	NA	NA	NA
WP_025358763.1\|6026932_6028951_+	NADH-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_025358764.1\|6028947_6029226_+	hypothetical protein	NA	NA	NA	NA
WP_025358765.1\|6029222_6030170_+	NADH-quinone oxidoreductase subunit H	NA	NA	NA	NA
WP_025358766.1\|6030212_6030875_+	hypothetical protein	NA	NA	NA	NA
WP_025358767.1\|6030874_6032353_+	hydrogenase	NA	NA	NA	NA
WP_025358768.1\|6032349_6033861_+	NADH-quinone oxidoreductase subunit C	NA	NA	NA	NA
WP_051913076.1\|6033892_6034078_+	universal stress protein	NA	NA	NA	NA
WP_051913077.1\|6034120_6034780_+	universal stress protein	NA	NA	NA	NA
WP_158510822.1\|6034910_6035120_+	hypothetical protein	NA	NA	NA	NA
WP_030109113.1\|6035119_6035452_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_148309675.1\|6035601_6035904_+	hypothetical protein	NA	NA	NA	NA
WP_025358772.1\|6035897_6036500_+	hypothetical protein	NA	NA	NA	NA
WP_025358773.1\|6036951_6038775_+	phosphoenolpyruvate carboxykinase (GTP)	NA	NA	NA	NA
WP_025358774.1\|6038874_6039879_+	ribose-phosphate diphosphokinase	A0A1V0SKK7	Klosneuvirus	1.7e-34	31.1
WP_025358775.1\|6039977_6041045_-\|transposase	transposase	NA	NA	NA	NA
WP_025358776.1\|6041423_6042671_+	condensation protein	NA	NA	NA	NA
WP_081789970.1\|6043315_6043540_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_025358779.1\|6044199_6045123_-	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_025358780.1\|6045519_6045771_+	hypothetical protein	NA	NA	NA	NA
WP_148309676.1\|6046896_6047337_-	hypothetical protein	NA	NA	NA	NA
WP_148309677.1\|6047674_6048412_-	hypothetical protein	NA	NA	NA	NA
WP_025358784.1\|6048667_6050929_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_025358785.1\|6050925_6051621_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-29	36.6
WP_025358786.1\|6051809_6052646_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_025358787.1\|6052778_6053540_-	ABC transporter permease	NA	NA	NA	NA
WP_025358788.1\|6054369_6054762_-	DUF1048 domain-containing protein	NA	NA	NA	NA
WP_025358789.1\|6054751_6055093_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_025358792.1\|6056863_6057508_+	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_025358794.1\|6057832_6058900_+\|transposase	transposase	NA	NA	NA	NA
WP_025358795.1\|6059085_6059979_-	hypothetical protein	NA	NA	NA	NA
WP_081789971.1\|6059999_6060962_-	cytochrome P450	NA	NA	NA	NA
WP_025353822.1\|6060988_6062029_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

6811979 : 6827131

Cronobacter_phage(50.0%)

tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025359380.1\|6811979_6814001_-\|tail	phage tail protein I	NA	NA	NA	NA
WP_025359381.1\|6814000_6816142_-\|plate	putative baseplate assembly protein	NA	NA	NA	NA
WP_025359382.1\|6816161_6816548_-	GPW/gp25 family protein	A0A060AMS0	Cronobacter_phage	1.6e-09	30.4
WP_025359383.1\|6816614_6817826_+	DUF4157 domain-containing protein	NA	NA	NA	NA
WP_025359384.1\|6817891_6819355_-	hypothetical protein	NA	NA	NA	NA
WP_025359385.1\|6819360_6820032_-	hypothetical protein	NA	NA	NA	NA
WP_025359386.1\|6820031_6821117_-	phage late control D family protein	NA	NA	NA	NA
WP_158510844.1\|6821109_6821283_-	hypothetical protein	NA	NA	NA	NA
WP_025359388.1\|6821279_6822521_-	hypothetical protein	NA	NA	NA	NA
WP_025359389.1\|6822517_6823018_-\|tail	phage tail protein	NA	NA	NA	NA
WP_025359390.1\|6823004_6824873_-\|tail	phage tail sheath family protein	NA	NA	NA	NA
WP_025359391.1\|6824869_6825325_-\|tail	phage tail protein	NA	NA	NA	NA
WP_025359392.1\|6825337_6827131_-\|tail	phage tail sheath family protein	J9PVC2	Bacillus_phage	4.4e-41	32.3

DBSCAN-SWA_8

8206787 : 8248222

Neodiprion_lecontei_nucleopolyhedrovirus(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035966957.1\|8206787_8207636_-\|protease	serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	1.6e-25	35.5
WP_025360445.1\|8207836_8208460_+	LysE family translocator	NA	NA	NA	NA
WP_025360446.1\|8208512_8209319_-\|protease	serine protease	G9E4M4	Emiliania_huxleyi_virus	4.6e-06	25.0
WP_148309783.1\|8209428_8210184_-\|protease	trypsin-like serine protease	I6WTR7	Cotesia_sesamiae_Mombasa_bracovirus	1.1e-22	32.1
WP_025360448.1\|8210354_8211065_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_025360449.1\|8211071_8212265_+	cytochrome P450	NA	NA	NA	NA
WP_148309784.1\|8212357_8213320_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_158510870.1\|8213401_8214226_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_025360452.1\|8214343_8215453_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	1.5e-10	24.6
WP_158510872.1\|8215471_8216551_+	glycosyl hydrolase	NA	NA	NA	NA
WP_081789690.1\|8216631_8217456_-	DUF222 domain-containing protein	NA	NA	NA	NA
WP_025353938.1\|8218742_8219834_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_025360455.1\|8219830_8220118_-	hypothetical protein	NA	NA	NA	NA
WP_025360456.1\|8220301_8223967_-	cobaltochelatase subunit CobN	NA	NA	NA	NA
WP_025360457.1\|8224128_8225634_-	amino acid permease	NA	NA	NA	NA
WP_025360458.1\|8225761_8226574_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_025360459.1\|8226762_8229126_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	8.5e-125	37.1
WP_030107807.1\|8229169_8229886_-	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_025360461.1\|8229956_8231513_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_025360462.1\|8231462_8232410_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_025360463.1\|8232502_8233084_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_025360464.1\|8233080_8233854_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_025360465.1\|8234013_8235138_+	VanZ family protein	NA	NA	NA	NA
WP_025360466.1\|8235134_8235677_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_025360467.1\|8235744_8237118_+	mycothione reductase	A0A2K5B2C5	Erysipelothrix_phage	9.3e-47	27.2
WP_042221145.1\|8237123_8238377_-	MFS transporter	NA	NA	NA	NA
WP_025360469.1\|8238518_8239202_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_025360470.1\|8239278_8239734_+	chorismate mutase	NA	NA	NA	NA
WP_148309786.1\|8239790_8241362_-	cobyric acid synthase	NA	NA	NA	NA
WP_025360472.1\|8241372_8242077_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_025360473.1\|8242063_8242921_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_030107800.1\|8242980_8244762_-	penicillin-binding protein	NA	NA	NA	NA
WP_025360475.1\|8244874_8245729_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025360476.1\|8245809_8246961_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_025360477.1\|8246998_8248222_-\|protease	site-2 protease family protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007155

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection