CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	0 crisprs	NA	0	0	0
NZ_CP007187	Campylobacter coli RM1875 plasmid pRM1875_3.4kbp, complete sequence	0 crisprs	NA	0	0	0
NZ_CP007183	Campylobacter coli RM1875, complete genome	4 crisprs	csa3,cas4,cas14j,DEDDh	4	15	3
NZ_CP007186	Campylobacter coli RM1875 plasmid pRM1875_3.3kb, complete sequence	0 crisprs	NA	0	0	0
NZ_CP007185	Campylobacter coli RM1875 plasmid pRM1875_2.4kb, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007183_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007183_1

1238861-1239094

Unclear

Consensus_repeat	Method
ATTTTACCATATAAACAATTAATAATAGGCTAAAAC	CRT

3 spacers

The CRISPR arrays of NZ_CP007183_1

>merge|NZ_CP007183|1|1238861-1239094|CRT
ATTTTACCATATAAACAATTAACAATAGGCTAAAACTATCTAACTTAGAACAATTTTGGATTAAAAATTTTACCATACAAACAATTAATAATAGGCTAAAACCGCATACTCAAAATATATATTAAATTAATAATTTTACCATGTAAACAATTAATAATAGGCTAAAACATTTTGCTTGGTTTTATTCAAAAAAATGCCATTTTATCATATAAACAATTAATAATAGGCTAAAAC

>NZ_CP007183|1|1|1238861-1239094|CRT
ATTTTACCATATAAACAATTAACAATAGGCTAAAAC	TATCTAACTTAGAACAATTTTGGATTAAAA
ATTTTACCATACAAACAATTAATAATAGGCTAAAAC	CGCATACTCAAAATATATATTAAATTAATA
ATTTTACCATGTAAACAATTAATAATAGGCTAAAAC	ATTTTGCTTGGTTTTATTCAAAAAAATGCC
ATTTTATCATATAAACAATTAATAATAGGCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007183.1\|WP_038406261.1\|1227976_1229131_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|223810
NZ_CP007183.1\|WP_002840884.1\|1239277_1239766_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840116.1\|1237164_1238103_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|274043
NZ_CP007183.1\|WP_002779694.1\|1238332_1238563_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_038406473.1\|1239914_1240355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839194.1\|1240390_1240999_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840595.1\|1244086_1244869_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002780917.1\|1230681_1231878_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|237615
NZ_CP007183.1\|WP_002794643.1\|1241443_1242610_-\|DNA-primase	unknown	unknown	gnl\|CDD\|273595
NZ_CP007183.1\|WP_002799567.1\|1229174_1229981_-\|ABC-transporter-permease	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839190.1\|1242672_1243170_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002794775.1\|1245355_1245715_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839188.1\|1243213_1243798_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840322.1\|1235549_1236749_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP007183.1\|WP_002780911.1\|1234101_1235202_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP007183.1\|WP_002794777.1\|1244956_1245340_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002780915.1\|1231877_1233110_-\|fibronectin-type-III-domain-containing-protein	unknown	unknown	gnl\|CDD\|225936
NZ_CP007183.1\|WP_002780913.1\|1233057_1234023_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP007183.1\|WP_002839192.1\|1241018_1241384_-\|DUF2493-domain-containing-protein	unknown	unknown	gnl\|CDD\|378473
NZ_CP007183.1\|WP_002784315.1\|1229967_1230633_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222

Protein	Function_ID	Function_description	E-value
NZ_CP007183.1\|WP_038406261.1\|1227976_1229131_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|223810	COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane].	8.23544e-19
NZ_CP007183.1\|WP_002839192.1\|1241018_1241384_-\|DUF2493-domain-containing-protein	gnl\|CDD\|378473	pfam10686, DUF2493, Protein of unknown function (DUF2493). Members of this family are all Proteobacteria. The function is not known.	6.19147e-13
NZ_CP007183.1\|WP_002840322.1\|1235549_1236749_+\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.3004e-56
NZ_CP007183.1\|WP_002780915.1\|1231877_1233110_-\|fibronectin-type-III-domain-containing-protein	gnl\|CDD\|225936	COG3401, COG3401, Fibronectin type 3 domain-containing protein [General function prediction only].	1.72038e-112
NZ_CP007183.1\|WP_002840116.1\|1237164_1238103_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|274043	TIGR02225, Tyrosine_recombinase_XerD, tyrosine recombinase XerD. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerD, one of two closely related chromosomal proteins along with XerC (TIGR02224). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and with homologs of XerD on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerD, as some apparent XerD examples score below the trusted and noise cutoff scores. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	1.14655e-25
NZ_CP007183.1\|WP_002780913.1\|1233057_1234023_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	2.45707e-91
NZ_CP007183.1\|WP_002784315.1\|1229967_1230633_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.13402e-76
NZ_CP007183.1\|WP_002780917.1\|1230681_1231878_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|237615	PRK14121, PRK14121, tRNA (guanine-N(7)-)-methyltransferase; Provisional.	7.53328e-175
NZ_CP007183.1\|WP_002794643.1\|1241443_1242610_-\|DNA-primase	gnl\|CDD\|273595	TIGR01391, DNA_primase, DNA primase, catalytic core. Members of this family are DNA primase, a ubiquitous bacteria protein. Most members of this family contain nearly two hundred additional residues C-terminal to the region represented here, but conservation between species is poor and the C-terminal region was not included in the seed alignment. This protein contains a CHC2 zinc finger (pfam01807) and a Toprim domain (pfam01751). [DNA metabolism, DNA replication, recombination, and repair].	6.46414e-19
NZ_CP007183.1\|WP_002780911.1\|1234101_1235202_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	2.69606e-113

>NZ_CP007183.1|WP_002779694.1|1238332_1238563_+|hypothetical-protein
MEKNTINNENIQKNEILIPKRVLFDEKTLKMIEMMIPTYKDEISNTNKENEKINQMIKLAIEKMFKNDFLNKINNF
>NZ_CP007183.1|WP_002840116.1|1237164_1238103_-|tyrosine-type-recombinase/integrase
MKLKNTTISEDLERWIEAYLKHIQALSYSNNTFLLYRRILLEFVEYSLDYQDEMQINDIKTTFLVNFLNYLENNSKNGNKLSKKTKITYLRVLTSFFSFISDNNDDLFVFSFDMKKIRFRTEKSEEKLNYLNENEIIRLNNVLEKEKAKKEVYNSFRNSLLIKLMLYGGLRISEALNVKLCDFEEVDDEILKISIIGKGGKEQFALIKKEEVDDELEYFKENIQDSDYIMQTSTGKHLNRSNAFLIVNNIYAKALISKKGLHLLRHTLAMRLTAKGTNLVVIQKILRHANLNTTTIYAKATNDTVKAALLNN
>NZ_CP007183.1|WP_002840322.1|1235549_1236749_+|site-specific-integrase
MIIVNDKQLKTLIVKKRTYIKDAYTKNLYIEAKDSLKGTIIFFYFRYRLNKKIQSIKIGKYPTTTLSSAREKANIFNDMLAQKIDPKEQIQDKGVKKSKTVKEIFHEWSQVFYKNNTSYNLSKRLETHIISKYEDKHINELAKNDILLVLDKLYVEGKLETIKRVFLGLKKMLMYAINKEYIENSNILTLDMKALYGSPKKQNLRAITKEERFKELLLAIENYNGSIFTKVALQISPYLFLRSANIRNLEWSEIDFKNLKIIIPANKMKGGEDFIIPLSESVIKLFEFIKPFSFHNSKYVFPSDISKSKTMSENTLNQAIKRLGFGDEMVFHGFRTTASTLLYEFKNLHGQDSEVIELCLDHRERNNVKATYNRSLRLNDRKLLMQYWSDYIDKLKGII
>NZ_CP007183.1|WP_002780911.1|1234101_1235202_+|rod-shape-determining-protein-RodA
MFIPDRRILTHFDYMQPILFVPIILISFFLIFEANAFLAEKQFVYACVGIAAFSVFFLLPIRKLMWLIPIAYWVNIFLLLSTDIFGVEKLGAKRWLEIPFTHFTIQPSEIFKPSFILMLAYLIYQDPPPKNGYKLKQFLKLSFFIILPFLLIAQEPDLGSAMVLLIVGFGVLFIMGVHYKIWLSIIIAIGISSPIIYTHLLKPYQKQRIHDFISEKPSYQVAQSMIAIGNGGLIGKSQDEATQTHFNFLPISTSDFIFAYLIERFGFLGGFVLILLYTLLIFHLLSLNQKLKDDYFARVAINCVALFIFIYAAVNISMTIGFAPVVGIPLPFFSYGGSSFTIFMIFFGILQHLITFRYFWVDNKNK
>NZ_CP007183.1|WP_002780913.1|1233057_1234023_-|RluA-family-pseudouridine-synthase
MQTFLVDEPSRLDIFLAKNLQQSRNQIASMIEKNCVWVNDKIQNKNSFKLKVGDKLVLNLPLVEEAKPKFDIDFDIEILYEDEDLLVLNKPSNLVVHGAKSVKSATLVDWLIEKQYTLSTLGGEVRAGLVHRLDKETSGAILIAKNNFTHQKLSEQLSDKTMGRIYLALIDLPLKEDKIIIDKALIRSSANAIKKIVTNSFVKGSKEAKSAFVNLAKSEEVSLIGAKLFTGRTHQIRAHLASINRHILGDELYGYRGKYECRIMLHAYFLYFIHPRNGEKIFIQAPLMDDFKQILEKKFILGELNEKISLESLLGCFDSFI
>NZ_CP007183.1|WP_002780915.1|1231877_1233110_-|fibronectin-type-III-domain-containing-protein
MKKFHLSLCLGALTLLFSACSVSQLSNIGSNKELLVNESLPKINNLKSLSDISNIAFEWDPLYDDNIKGFYLYRSNDANPEFKLVGTIKNKFQTHYVDTKLEPNTKYYYMMRSFNDQGHISEDGKVIEVKTMPRLEAIPFAQAITNLPSRIKLIWRPHPDPRVASYIIERAKADGQEFKKIAEVKNRLNAEFIDEDLKPEESFNYRIIAVGFDGVQSQPSSILNSTSKALPPQVEHLNASLDGANKVVLTWDAPKYKDFSYYKVYSTSSSFLPYTLLAKTEQNSYEDIVEGAAKSKYYKVTMVDIDELESPMPKDGVEGKTLGIPSSPSIILAQSTSDGIDLEWVDNDSRAVEYEVRRYGGDQNAIFKGVKEKRLKDIKALPGVEYSYEVIAIDSVGLRSEPSKKVKAKQ
>NZ_CP007183.1|WP_002780917.1|1230681_1231878_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MPNFKTRKLKEIILPFEKDGIEFVWMAHNDNVNLIYTRVEEESFFLQIKKGENEFVVKVDKHTKPSKIAYLHKALYIFKQYFCEDVISEAFGIKNNALAEKTPLIANDFEEVLERLEGKIYIEIGFGSGRHLLYQAKNNPQILILGIEIYNPAITQVAKLARAQGIDNILLVQSDARLLLSVLRSDSIEKIFLHFPVPWDKKPHRRVVSKAFCKECARVLTTQGVFELRTDSYEYFDFTFKEFLEFSSPQFSIRKNENLEISSKYEDRWKRQEKDIYDLWVWNLDKEEKNVLSEEFDFSDIHLSKNDLMLLEKNFENFTLKKEDFFLHFENIYKQGESLLLKIAFGAFNKPEHCYLHIGEAISFVFKEPFKIQENLKAIKELKKSVKFHFNMKHFLEN
>NZ_CP007183.1|WP_002784315.1|1229967_1230633_-|ABC-transporter-ATP-binding-protein
MSNLIQAHKLSLGYDELVIKEASFTFKDDDFVFITGKSGSGKSTLLKSFYGDLELLSGQLEVCGSSMRKIGNSELLKLRQQIGIIFQDYRLIQEYSVEKNVMLPLMIKGYSKKVCHDQASKLLKHVNLTFKADKLPNQLSGGEQQRVAMARALAHNPKLLLCDEPTGNLDEYSSDIIWTLLKSARELLGTCVVVVTHRIPSNLRLNYRRFNIENGNMNEIF
>NZ_CP007183.1|WP_002799567.1|1229174_1229981_-|ABC-transporter-permease
MKFFKTHLSLILPLLFMMFAFEFILLTNATLRHYEELVNKDYNIIVASSAELDKNVIKTKLSSFSSLEPLDPKDLIDRLKNDISDKNLKVLRDSLPKFYSIKLDYLPTQNELNTIKNQLLSIPSISKVETFAKTHDKVYSLLVLMKFVFWLFLFIIILLSFVLFLKQMRIWLFEHTERVEIMYLFGAPFWFRSFMLYKIVVLDCFIAFIILFVFFTQIYNLSIVQDSLKAVDIILPPINFIVHLGVIYLVTLFICLFCVNSVMFRVKK
>NZ_CP007183.1|WP_038406261.1|1227976_1229131_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MHANAISEKTKNLEENKRIQEQVNKKLEDLANDILSGEKSLKELSAQIETLNSQTLKLEARAKAQNKDLNLLTSQNTDLLKNKANMEGKLIALMAKDFAYDLSIPQGYVESKESFMAFEVLGGLDKILQDEIFKLSKDYEDISKLIDDKQEQIKKINEDLKDYNTQLAKLQNLRQKQVSEIKKQKTDRAIYAKKLENLQDQQDELRKTLNQLKIIESKQEDKKQSQKTASDSKIVNNTQKIRQIGSSYQGSSTKRYTGKKTIAPLESFTVKQKFGNYIDPVYNIKIFNENVVLRSNKADAVVKSVLDGKIVFAKDTSMLARVVIVEHDNGIHTIYAHLDKIAPNIKVGKNVKKGAVVGRIKNDLTFEVTQKNFHINPLELISLN
>NZ_CP007183.1|WP_002840884.1|1239277_1239766_-|hypothetical-protein
MKDDKILLPQKSQFGDKFWLIRDNLAVCENGRIFNYDELGKLIETQYECILDNVSKASSKKILANIIDLKNIIIDDYFINLIEHTIDGNKFEFSHDMNLIKYKGYVANLNTLEIAGLPQEMEKVGDELILPDFPKRLDENLIREFQALIKLVFRKDCNKIKL
>NZ_CP007183.1|WP_038406473.1|1239914_1240355_-|hypothetical-protein
MRNYYISEGVKALFSVYFKDQTEENFIKALNEFNKENQINSQEIKDEALREIKEELSKLATTDLLNAKIDKVEAKIDKVEASLNAKIDKVEASLNAKIDKVDTRIDKVENKLDSFKTEVKTYVIILAALMFILQPTIFDLIKSIFK
>NZ_CP007183.1|WP_002839194.1|1240390_1240999_-|hypothetical-protein
MKNNEIFTKAFRFTDEGDLVITLTPDFECFLAENQIKNSQDFADKFSDTLDENRYFNIPRILCYKEDLKSTPFEDFDNEYFVFVPNDTNIDLDSLSYAVSALNPSNQKDFLIEAMKTKIKKGEINKENLKENLENEIKYISEQIPIVFEGKVGEDTIEKLLKEKETIVLPNVTKYAKNSINEYFENEKDEILEELNAICKKI
>NZ_CP007183.1|WP_002839192.1|1241018_1241384_-|DUF2493-domain-containing-protein
MKLLVCGGRDYKDVEHFNKEMSNIFSLYQNQIDTIIEGGASGADNMAKNYALKNKIKLIEVKADWQHFGKAAGPIRNQRMLSMLDSNDCVLAFWNGVSKGTKNMIEIARNKNIKVIIINIK
>NZ_CP007183.1|WP_002794643.1|1241443_1242610_-|DNA-primase
MKYDIERLNNIPIMDVLESLGAISDKNKRIIHCFNITAHKNNDHNASLGIYESTNTCHCFACGVGGNPVNVVKTMFNGNFKEACEYLHSQFNIPFLNGIQATYKKVFEKPKPKAKDYVFFDPNKKYVEVEKLAPFVQNYSTLTKAQKLKLVYTTIYRFSLSTEQKAKNLYYLKRGIKDLSLVEKIGFLNFNNIKKLENLLKEYFPIEDLIEFKIFSKEKQAWKYAFNVALVPNFDLYSNMVVGFSLRVIDSAYNGAKEVNISCGNIVFAMPFGLENKLLKECEKIVITEGHIDCLSARNYYKQDSKTLFISFAGTFSFREEILTVFKDKRVMLCFDKDEAGINGEKSLSEKLSLLNIKNYSLTWDIADGKDLNDLLLADKMGSIKLIA
>NZ_CP007183.1|WP_002839190.1|1242672_1243170_-|hypothetical-protein
MKKFTEMSKDLIKHYGLDNAANETEINALAYALQDCCAMYNKKNELSFTDKQIDDFKSYIVEYHIKGDNEPNNEQSVEDIVYSLHYSMLLSSVPEEIVDDIDRDLFINKVEMGIDGRYQASFLCDDAESFLKRIKEYVMLDNELNEYTKFCIKNTDNFCGCEEVF
>NZ_CP007183.1|WP_002839188.1|1243213_1243798_-|hypothetical-protein
MKINVLENMFEKLMHKGSSVFTLDGKKIEIERDEFYNPFDNYENPSFFNLLKRYDIGEKEIDGLNCTDFENIQEIENYLNSKGYIWIRVGAYIHSGIALYSEGNKPRKYSYGWDYGCAGYAYYTKEQVREIFGVKRISAKLKDKLYKDIEFFIKELEAYLEGNIYTLYVDDIPEETFIGYDEEQMLQTLERFAA
>NZ_CP007183.1|WP_002840595.1|1244086_1244869_-|hypothetical-protein
MGTRSFIAKERYDGSVVAKYCHCDGCLSWNGVILNKFYNNKEKVDELFKNSSSLISLKTTVNESEFHENSQHINIFKNSEEYFKNNPLENLLKFSNIEYFYLFRNGNWYVKNYKETNDEVKLLDEILQETHFRKAFSMLRNKKAYSLIGKELKSGKIKALKCQFATHNDEFDDDSRLIFNFKYNNQINKLLKLRHITSLEKDIKNITVFDDEAKNIYFKNEKDFVNSNDEYIYKYLFTLRGSVQVIFNDKYASFMKNNEI
>NZ_CP007183.1|WP_002794777.1|1244956_1245340_-|hypothetical-protein
MEKNYEDFKEALLKGNLALVLTSVSKSGMTRTFKVFYKNKKEQYLPIPDEIAKAVSDRKVDEKGIAIRGCGMDMSFALWLNIASHLKCYDEAYRNYFSYKPNRGNFNPFYPNMETFINEITKNQSID
>NZ_CP007183.1|WP_002794775.1|1245355_1245715_-|hypothetical-protein
MNILLRNDIDDLNLKEFKKFRECEEAFRLRGMKNKNQEIFVKRMAKGEKIIARISCVIDVKEKIKIEILKISRKEKEIKEEILFEESFFTNYHETQFHDFHGFRIYRIIKLFLRDYLKL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007183_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007183_2

1269678-1270044

Unclear

Consensus_repeat	Method
TATTTTATCATACAAACAATTAACAATAGGCTAAAAC	CRISPRCasFinder
ATTTTATCATACAAACAATTAACAATAGGCTAAAAC	CRT

5 spacers

The CRISPR arrays of NZ_CP007183_2

>merge|NZ_CP007183|2|1269678-1270044|CRISPRCasFinder,CRT
TATTTTATCATACAAACAATTAACAATAGGCTAAAACTAAAACAATAGTATTATTGCTCATTGTTTTATTTTATCATACAAACAATTAACAATAGGCTAAAACAGATCCGATAAAAACAGAAAAAGTCCGAATATTTTATCATACAAACAATTAACAATAGGCTAAAACTCTTTGCAATTCTTCCATTAGATTAATGCTATTTTATCATACAAACAATTAACAATAGGCTAAAACATACAAATACAAATTTCAGAATTAAAAAGAATTTTATCATACAAACAATTAACAATAGGCTAAAACACTACATCATAGAACTTGTTTATATAAAAGATTTTACCATACAAACAATTAATAATAGGCTAAAAA

>NZ_CP007183|2|1|1269678-1270044|CRISPRCasFinder
TATTTTATCATACAAACAATTAACAATAGGCTAAAAC	TAAAACAATAGTATTATTGCTCATTGTTT
TATTTTATCATACAAACAATTAACAATAGGCTAAAAC	AGATCCGATAAAAACAGAAAAAGTCCGAA
TATTTTATCATACAAACAATTAACAATAGGCTAAAAC	TCTTTGCAATTCTTCCATTAGATTAATGC
TATTTTATCATACAAACAATTAACAATAGGCTAAAAC	ATACAAATACAAATTTCAGAATTAAAAAG
AATTTTATCATACAAACAATTAACAATAGGCTAAAAC	ACTACATCATAGAACTTGTTTATATAAAA
GATTTTACCATACAAACAATTAATAATAGGCTAAAAA

>NZ_CP007183|2|2|1269679-1270044|CRT
ATTTTATCATACAAACAATTAACAATAGGCTAAAAC	TAAAACAATAGTATTATTGCTCATTGTTTT
ATTTTATCATACAAACAATTAACAATAGGCTAAAAC	AGATCCGATAAAAACAGAAAAAGTCCGAAT
ATTTTATCATACAAACAATTAACAATAGGCTAAAAC	TCTTTGCAATTCTTCCATTAGATTAATGCT
ATTTTATCATACAAACAATTAACAATAGGCTAAAAC	ATACAAATACAAATTTCAGAATTAAAAAGA
ATTTTATCATACAAACAATTAACAATAGGCTAAAAC	ACTACATCATAGAACTTGTTTATATAAAAG
ATTTTACCATACAAACAATTAATAATAGGCTAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007183.1\|WP_002821189.1\|1270064_1270385_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840137.1\|1260094_1260835_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226144
NZ_CP007183.1\|WP_002840261.1\|1274951_1275455_-\|SocA-family-protein	unknown	unknown	gnl\|CDD\|379096
NZ_CP007183.1\|WP_002841103.1\|1257987_1258677_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840681.1\|1271153_1271549_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_025443328.1\|1258695_1259256_+\|Rha-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378235
NZ_CP007183.1\|WP_002840685.1\|1270374_1270716_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_025443331.1\|1275520_1276183_-\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|224777
NZ_CP007183.1\|WP_002793632.1\|1264610_1264907_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840640.1\|1272819_1273824_-\|toxic-anion-resistance-protein	unknown	unknown	gnl\|CDD\|377557
NZ_CP007183.1\|WP_002793634.1\|1264903_1265344_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381603
NZ_CP007183.1\|WP_002840135.1\|1259273_1260077_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_025443330.1\|1271959_1272805_-\|DUF285-domain-containing-protein	unknown	unknown	gnl\|CDD\|308794
NZ_CP007183.1\|WP_002840683.1\|1270717_1271164_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840679.1\|1271550_1271943_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840141.1\|1266472_1266742_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002800915.1\|1266255_1266471_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840259.1\|1274689_1274965_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002793629.1\|1260849_1262217_+\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|274760
NZ_CP007183.1\|WP_002800914.1\|1265362_1266259_+\|HDOD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224554

Protein	Function_ID	Function_description	E-value
NZ_CP007183.1\|WP_002840137.1\|1260094_1260835_+\|hypothetical-protein	gnl\|CDD\|226144	COG3617, COG3617, Prophage antirepressor [Transcription].	2.28887e-25
NZ_CP007183.1\|WP_025443330.1\|1271959_1272805_-\|DUF285-domain-containing-protein	gnl\|CDD\|308794	pfam03382, DUF285, Mycoplasma protein of unknown function, DUF285. This region appears distantly related to leucine rich repeats.	3.35225e-47
NZ_CP007183.1\|WP_002840640.1\|1272819_1273824_-\|toxic-anion-resistance-protein	gnl\|CDD\|377557	pfam05816, TelA, Toxic anion resistance protein (TelA). This family consists of several prokaryotic TelA like proteins. TelA and KlA are associated with tellurite resistance and plasmid fertility inhibition.	6.2858e-22
NZ_CP007183.1\|WP_025443328.1\|1258695_1259256_+\|Rha-family-transcriptional-regulator	gnl\|CDD\|378235	pfam09669, Phage_pRha, Phage regulatory protein Rha (Phage_pRha). Members of this protein family are found in temperate phage and bacterial prophage regions. Members include the product of the rha gene of the lambdoid phage phi-80, a late operon gene. The presence of this gene interferes with infection of bacterial strains that lack integration host factor (IHF), which regulates the rha gene. It is suggested that Rha is a phage regulatory protein.	6.53578e-27
NZ_CP007183.1\|WP_002840261.1\|1274951_1275455_-\|SocA-family-protein	gnl\|CDD\|379096	pfam13274, DUF4065, Protein of unknown function (DUF4065). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and viruses. Proteins in this family are typically between 155 and 202 amino acids in length.	7.79596e-15
NZ_CP007183.1\|WP_025443331.1\|1275520_1276183_-\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|224777	COG1864, NUC1, DNA/RNA endonuclease G, NUC1 [Nucleotide transport and metabolism].	2.18969e-53
NZ_CP007183.1\|WP_002793629.1\|1260849_1262217_+\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|274760	TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. [Mobile and extrachromosomal element functions, Other].	8.85032e-41
NZ_CP007183.1\|WP_002800914.1\|1265362_1266259_+\|HDOD-domain-containing-protein	gnl\|CDD\|224554	COG1639, COG1639, Predicted signal transduction protein [Signal transduction mechanisms].	4.25466e-43
NZ_CP007183.1\|WP_002793634.1\|1264903_1265344_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381603	cd13400, LT_IagB-like, Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	2.86553e-42

>NZ_CP007183.1|WP_002840141.1|1266472_1266742_+|hypothetical-protein
MNTIQKLRRELKIYTAGIIVLPILSIISYMFNNQKLDYNFLIFFALYFGLFFGFCVIGFFSTKKAIKTYSQLIEKSQEEFGEKNENHRI
>NZ_CP007183.1|WP_002800915.1|1266255_1266471_+|hypothetical-protein
MNIVDLVKTIESIENPQNLKIIREGACFYMCLGENKKYFYFFKANSKNKESLPYTLTLDDLKSDEWKILKD
>NZ_CP007183.1|WP_002800914.1|1265362_1266259_+|HDOD-domain-containing-protein
MNNLLEKNINEVNEMLIKSLDDLPPLPETIQKLQEYIATHGSNIVIDEIANIISTDPLITANLLHLTNSAYYGFSKEIKTVNQALVLLGVSNVKNMIIADYAKSSFVINLSPYGIETDRFLALIHEQTNFISTWLMEEDKMLCHNLIPCVMMLRLGIMVFSNFLIQNNIDKKFLLHLSKNNFNNILRLEREFLGVDHISFLSNLFKVWNLDEDLIEIISSLDYLGSTSAKVKKETYALAAIEALFSPEKNAYDEFCVQKAYQILKDAKANGVDFNLENFLNKLPEKFIEILSKSKEQL
>NZ_CP007183.1|WP_002793634.1|1264903_1265344_+|lytic-transglycosylase-domain-containing-protein
MKAIFFLTSLLFANLLFAQKNYFIQAGEKFGINPQLLWTIAYKESRLTPNIISKPNKNGTYDIGIMQINSIHLPRLKKQYGINENDLLRPKINIFVGAEILKMCLDKHGLNEEGITCYNGRIINNPYGKEVIKLLKKARITNGKIN
>NZ_CP007183.1|WP_002793632.1|1264610_1264907_+|hypothetical-protein
MKKRRADLLKKHNSKIVLADTLESEAMVDLAMKANDIFLKLKKTAGVGLDFKDADEMLMLWNLVLVKSSQTLEQISQKIDMKYDEPFTITLAREKLEK
>NZ_CP007183.1|WP_002793629.1|1260849_1262217_+|type-IV-secretion-system-DNA-binding-domain-containing-protein
MFLKKSEEEKTFIGIGFDLEDKKQEKLLEIYQIDDNSKNHTFVFGSTGVGKTRLIEGLIEQDIPKGKNVVIIDPKGDIGLFSKMVEIAKKSNREKELMFLSPIYPEYSIKINPLANYYMEEEIIAHIVSGVPAKDEFFYNVANETTTAVVKALLIIRRYEKLEKPLNFEEIAEKVYYEGLKELQSELKEIQSNGFEDDEIARLLALYDRVLSSPQDYFAKVSSTLRTTLTQMTMGNVGKIIGTAQENTFIKRLQENQGVLLYIMTGSMLTRQVSSIISKVTISMIQSCVGRVYASGKKFDKTLKIYIDEAASSVYRGIETLYAQARGAGVAIMGLTQSAADLAAEIGQDGANRLLELTNTKIIMRLNDTKSSKMISDLGGKKRAYSYFLTVEGGITSREVEELNIEVDDVTNLQKREFFYFGFEGRFKGKTLKVNDGKLVVDMPNVTQKNEDFNV
>NZ_CP007183.1|WP_002840137.1|1260094_1260835_+|hypothetical-protein
MNLENSLQAEVVNNSNIVLFENEELGQVRVALDENNEPLFCLSDICKILDIQDTYKVKQAILREFELSTLSVDSFDTGFGIKEFTMITEPQLYFILMRSDKPNAKHFRHWVTKEVLPSIRKKGFYGSINKNNTTIDSNIYYKELCDRLLIENKELKSENINLKRHINGELYLKFLNKLNTFSKIHFKNSKSKALDYIYKTIAIEFMCPTYSNFDISDLESDPRYLRYAIDLCNDAISNNFLSRKLI
>NZ_CP007183.1|WP_002840135.1|1259273_1260077_+|hypothetical-protein
MENGSGNIGNKGDINSYGSGRFAHPNLDFGELKERQGGSGRHIFHALSEIQRYHVIEDRSEEIPKEYFTIEQILDYLKIGFKSGMFESFIFTGLLCFLQVIYPSYKYYFLDSPLSKNEELFFDLLSYAPILVSTLFMAYISKYYKGLLTRRAIFALMNGRSFSFLLKGFAIFWLFSWLKEISINNPRTVYSWADWTLWLIQYFKPNVSTEQLYVFYYKYAIPALHDASYELLYSMCIFAILPYLTIFYKGYKERVKRFENKDAYENY
>NZ_CP007183.1|WP_025443328.1|1258695_1259256_+|Rha-family-transcriptional-regulator
MNNVVFINNQEVVFENKDEQVFCTSLDVAKVFGKQHKHILELIGEKFNNNEIKNFCEPNFRLSFKTRKIEGFRGKERKYPYYQLTKDGFSFIAMGLTGRKADKFKIEFINAFNEMKNIIRSNNQTTNYSDYEFIKKQNEILNQITCTQSSTIYVLQDSIRFLNNTISSMKEINKELKKIAGIDRFL
>NZ_CP007183.1|WP_002841103.1|1257987_1258677_+|hypothetical-protein
MNFKRASELLQIANNYNIEVSEVFSALKQALEVVLKCGKLHADFSNEKISFYEIIYNRFGEKRKKFVQIKRNNYKAVQDKFISIVISYSLEKKREQVKSLKSMIFKGKIEKVLKSGFEVSSSIGFGFLPKVEILRKDLARMQLGTELYLAIKKLKGSKKAPNGALVFTRKNMNILEHEIIDNMSDCGVYYIEKISARKISIFCTKMPTKDQIKNTMRAANTFLDIQVRN
>NZ_CP007183.1|WP_002821189.1|1270064_1270385_-|hypothetical-protein
MNNDVQISQITNIPYFTIRDWKQKKDNWRGKIYLFLKNTNQEELKEIFSNSINSSNTGLSDSKIAKITTIPLPTLNTWKKDKSTYRKKIYDFLKSCDESRLRNIFL
>NZ_CP007183.1|WP_002840685.1|1270374_1270716_-|hypothetical-protein
MNKISKEELQKATEESLTNVYSYDPNSPSGYRKDLFDISNEDFVEKYEFIDSPTSDDMVKCKQSDEVFQVFYKKDGKIRLLRVSNVQALNHFDKLKGVMTKIILDSGFKPDEQ
>NZ_CP007183.1|WP_002840683.1|1270717_1271164_-|hypothetical-protein
MRNKELKIIEAYGAFMSILFSFLIVYENVWTNILKIFLYTEIQAFFIFFVRIFMILHMILFMGFLLDAKIKAEHNQLIKLLADKKKKLTVIFLIPLQISFLCSVVLVFFCNIFPNIHSLDFSFYTIFICVILLYNLILLYNFTKIIRS
>NZ_CP007183.1|WP_002840681.1|1271153_1271549_-|hypothetical-protein
MIVLIFKILGFIGLWISVIVLFFNPPLGAIFMLLASLLTVVGMIIEEGNTINLSYPIMEWIWNVGKYVLVIFAIMMVFAVVLELIKKIKSNKRVNKKIDIKNKEEQDYKILIIDNTMEDLLVLKKESLYEK
>NZ_CP007183.1|WP_002840679.1|1271550_1271943_-|hypothetical-protein
MKLYMNSDKLNSIENNKLRAIYKDIKEKLIDIIVYMDTINLGNISKGYIEKELNSIILILNQNCKEYFLIKNKLHTSDLERNEERLVQQAQKLFDKLKNLDFKKEINIEKDIKLDHIENSLDNSIKNGVQ
>NZ_CP007183.1|WP_025443330.1|1271959_1272805_-|DUF285-domain-containing-protein
MFELSNELALSFEKIGLYFFIFIISIQTLFIFWSFITSFDFCKKYWKESITFGLKTLMVEKFKKDKVITVVSQNPKILIIDNTMEDLLALKRESFIVEEVKIIKKYKYTPKTKEELQALVKDESIYLGDIDTSEITDMSYLFTGSTRTNFSGIEKWNTGKVKTMRSMFECNKFFNEDIGAWDVGDVRDMAWMFLNCPNFNQNISEWDVKKVETMSGMFWNCESFNQNIRKWNIKKVWDMSYMFKYCKLFNQDLSSWNTKRIRTYNMFSRCPIDDSNKPKYI
>NZ_CP007183.1|WP_002840640.1|1272819_1273824_-|toxic-anion-resistance-protein
MSSTQQYKVMNEKVMVLLKKDSEKSSAVSASPLIKISMDQLKNTDNGEVYKKLDELQVLIDNVSPYRNKSVFGKAGIIPKILSKAFKINHLSRYIDKFENSSKLIDNIILYLNKSKEELENDNKALKLEIEGMAIKRNELKNLIEELSQAQQECDEYLSINKKDEFEINRFKSDTYFPLLQKMTDVKQRVMVMEQSVIAFTTLIANNRELIVSLDRAKEVTVEALGVAILMAQSLSEQERILNSVNGLNRVTSDLIKQTSTQLKNQGASIQMQASSAMLDMQALETSFKECLESFEKIKDFRIKATDDIKKHLQNFDKLMDEINSKNMLINHVK
>NZ_CP007183.1|WP_002840259.1|1274689_1274965_-|hypothetical-protein
MACIENAYDLCKHFNISEDCEIKIHNFFNTHKDNFLKPCTGIFYGIKQQNKIILERENEYPPGIFCVKTNYLKIVYKKENLEIINIDWINS
>NZ_CP007183.1|WP_002840261.1|1274951_1275455_-|SocA-family-protein
MKKIENIIIYIINYFQTNYAPADLGKVKLNKILWFADRAFMYKNYASLTQTSYIKNPQGPVVKKLENILTSLEKNEFIKSIKVNKGEYQQQSFLCLKEPNLDDFTAKEISILDETINKFALKTAKELSEMSHDECWEKTKNGDTMPIESVFLQDIIPATKEDINGLH
>NZ_CP007183.1|WP_025443331.1|1275520_1276183_-|DNA/RNA-non-specific-endonuclease
MKKLMILPLLATLALADYTQYKPSEDFAKYFTKQSCSQVLDKFYYLNCYDYNYKGTKAVAYKLEAENLKGEQIKKRPRFEDDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQKVWNKIEKRERQAALKLGSLEVLNLVNYDNNPQRIRNQIAIPSSYTKILKGENFKECYQVPNHKVENENIKNYKVNCDILTGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007183_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007183_3

1292826-1292920

Orphan

Consensus_repeat	Method
ATTTTACCATATAAACAATTAATAATAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007183_3

>merge|NZ_CP007183|3|1292826-1292920|CRISPRCasFinder
ATTTTACCATATAAACAATTAATAATAGGCTAAAACCGCATACTCAAAATATATATTAAATTAATAATTTTACCATGTAAACAATTAATAATAGG

>NZ_CP007183|3|2|1292826-1292920|CRISPRCasFinder
ATTTTACCATATAAACAATTAATAATAGG	CTAAAACCGCATACTCAAAATATATATTAAATTAATA
ATTTTACCATGTAAACAATTAATAATAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007183.1\|WP_051486326.1\|1291401_1291776_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|379034
NZ_CP007183.1\|WP_002840161.1\|1291777_1292785_+\|DUF3825-domain-containing-protein	unknown	unknown	gnl\|CDD\|378984
NZ_CP007183.1\|WP_002793403.1\|1293215_1294112_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840150.1\|1286476_1287151_+\|chromosome-segregation-protein-ParM	unknown	unknown	gnl\|CDD\|274276
NZ_CP007183.1\|WP_025443332.1\|1289820_1290567_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002794785.1\|1287167_1288166_+\|conjugal-transfer-protein-TraU	unknown	unknown	gnl\|CDD\|377717
NZ_CP007183.1\|WP_002779571.1\|1295007_1295289_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP007183.1\|WP_002840159.1\|1290553_1291336_+\|conjugal-transfer-protein-TraT	unknown	unknown	gnl\|CDD\|377558
NZ_CP007183.1\|WP_002794790.1\|1288866_1289811_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370610
NZ_CP007183.1\|WP_002839469.1\|1296334_1296688_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002782140.1\|1296041_1296323_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP007183.1\|WP_002790355.1\|1295827_1296055_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002840153.1\|1288188_1288851_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP007183.1\|WP_002840381.1\|1283733_1284165_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002794781.1\|1285693_1286464_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372692
NZ_CP007183.1\|WP_002816687.1\|1299854_1302020_-\|conjugal-transfer-protein-TraN	unknown	unknown	gnl\|CDD\|237072
NZ_CP007183.1\|WP_002815664.1\|1302016_1302355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002779572.1\|1294773_1295007_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002896916.1\|1302341_1302698_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839470.1\|1296762_1299591_-\|conjugal-transfer-protein-TraG	unknown	unknown	gnl\|CDD\|369594

Protein	Function_ID	Function_description	E-value
NZ_CP007183.1\|WP_051486326.1\|1291401_1291776_+\|thioredoxin-family-protein	gnl\|CDD\|379034	pfam13098, Thioredoxin_2, Thioredoxin-like domain.	4.12343e-07
NZ_CP007183.1\|WP_002840161.1\|1291777_1292785_+\|DUF3825-domain-containing-protein	gnl\|CDD\|378984	pfam12873, DUF3825, Domain of unknown function (DUF3825). Potential uncharacterized enzymatic domain associated with bacterial pfam12872 domains. Has conserved residues suggestive of an enzymatic role probably related to RNA metabolism.	2.40259e-18
NZ_CP007183.1\|WP_002840150.1\|1286476_1287151_+\|chromosome-segregation-protein-ParM	gnl\|CDD\|274276	TIGR02743, hypothetical_protein, type-F conjugative transfer system protein TraW. This protein is an essential component of the F-type conjugative transfer sytem for plasmid DNA transfer and has been shown to be localized to the periplasm.	2.49057e-23
NZ_CP007183.1\|WP_002794785.1\|1287167_1288166_+\|conjugal-transfer-protein-TraU	gnl\|CDD\|377717	pfam06834, TraU, TraU protein. This family consists of several bacterial TraU proteins. TraU appears to be more essential to conjugal DNA transfer than to assembly of pilus filaments.	1.56982e-113
NZ_CP007183.1\|WP_002779571.1\|1295007_1295289_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	5.03286e-06
NZ_CP007183.1\|WP_002840159.1\|1290553_1291336_+\|conjugal-transfer-protein-TraT	gnl\|CDD\|377558	pfam05818, TraT, Enterobacterial TraT complement resistance protein. The traT gene is one of the F factor transfer genes and encodes an outer membrane protein which is involved in interactions between an Escherichia coli and its surroundings.	1.15245e-76
NZ_CP007183.1\|WP_002794790.1\|1288866_1289811_+\|hypothetical-protein	gnl\|CDD\|370610	pfam09673, TrbC_Ftype, Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous.	1.39649e-16
NZ_CP007183.1\|WP_002839470.1\|1296762_1299591_-\|conjugal-transfer-protein-TraG	gnl\|CDD\|369594	pfam07916, TraG_N, TraG-like protein, N-terminal region. The bacterial sequences found in this family are similar to the N-terminal region of the TraG protein. This is a membrane-spanning protein, with three predicted transmembrane segments and two periplasmic regions. TraG protein is known to be essential for DNA transfer in the process of conjugation, with the N-terminal portion being required for F pilus assembly. The protein is thought to interact with the periplasmic domain of TraN to stabilize mating-cell interactions.	9.00835e-27
NZ_CP007183.1\|WP_002782140.1\|1296041_1296323_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	9.63936e-27
NZ_CP007183.1\|WP_002840153.1\|1288188_1288851_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	5.31247e-10
NZ_CP007183.1\|WP_002794781.1\|1285693_1286464_+\|hypothetical-protein	gnl\|CDD\|372692	pfam13728, TraF, F plasmid transfer operon protein. TraF protein undergoes proteolytic processing associated with export. The 19 amino acids at the amino terminus of the polypeptides appear to constitute a typical membrane leader peptide - not included in this family, while the remainder of the molecule is predicted to be primarily hydrophilic in character. F plasmid TraF and TraH are required for F pilus assembly and F plasmid transfer, and they are both localized to the outer membrane in the presence of the complete F transfer region, especially TraV, the putative anchor.	1.67591e-19
NZ_CP007183.1\|WP_002816687.1\|1299854_1302020_-\|conjugal-transfer-protein-TraN	gnl\|CDD\|237072	PRK12355, PRK12355, type-F conjugative transfer system mating-pair stabilization protein TraN.	4.64832e-47

>NZ_CP007183.1|WP_002840161.1|1291777_1292785_+|DUF3825-domain-containing-protein
MEKNIEKLILEAYEDSKTKFDHVTTGHISQYLKRKYDLKINCSKALIEAGFDLEKDENEPSLVYVKKAITRNKTSNRDQIQNKVEEKPLLFQFAYFPNFLNTLQELSNITQKEFWGNGNNILFSYLFKYFEFIYENKSYPDIITYNKDKTKACFNTGLYSTGVFPIFAYFEKQENGGYIFRKFCSNGDRVLDDLEIPKSLSDYDTFKNEIIFDSKLDFRVNHLHLFERKERLPEIVKKLNDRFIGHIINGELKIIKDNYNLQKMIIPAAYKQRVVLYIPLKLQEESVDTIVVVEKEEVKNEQYYAVRTILNPHDNIYKTARVLSIVESEWVKNTI
>NZ_CP007183.1|WP_051486326.1|1291401_1291776_+|thioredoxin-family-protein
MVLEAKIYDDVYVAQKQALKEAKLMIFFVVSNTCEYCHKLMNDVLNNRDLMEYLNKNFIVAISDLNANGLIPKDLLFNGVTPTTYILTPTGKVIGTPIEGAVDSDILFGLLKGLEDYKKGQLGF
>NZ_CP007183.1|WP_002840159.1|1290553_1291336_+|conjugal-transfer-protein-TraT
MKINKTIFKTGMCSVLAASLLTGCLTTTLQTNATMSQSIFLDPVAKEKRIVFLNIKNTSGHDVNLEPKLRSALEAKGYKVIDDPDKANYILSTNILYCDKKQENNAVGGAVAGGATGVAVSGYNGGGAGGMVAAGAAGALVGGLLGKLTEDTIWQMQVDINIKQKADGKVLTSSGNVSGQASVRDSQSSGFLNSFGGNVRSDKVGHLNSNQINNTQQTYEGKYIEKNTIIFAEAVKTGLKLPEATPILEDKIANQIAGLF
>NZ_CP007183.1|WP_025443332.1|1289820_1290567_+|hypothetical-protein
MNCFKKLKEKIILIKIEKEKANKEKFLKECEIKEAEIRMEILEKRKDDLFKQREELIHSILDEASFNALTEVRDLKCLDKSINELEEEEDKQVEILKRKKTNSHIKKEEKMEKNAVEILNNIKTDEFSNTINIIKVIEIENILEFKDLVDIFVNDKYKIEAKAMKYLEVVLNKTEFFRTYLESKISKEFSEYHAKEQEKDYFGKFLKTLEKGLDNLTGETEEDRAKFKKHVKEIFEKIFNKKENNENK
>NZ_CP007183.1|WP_002794790.1|1288866_1289811_+|hypothetical-protein
MKKQIIGSILLCSSLFAIDDNLTKEQIFHNKYLKDKAAMQNKISVDELYKNTKDFNLSSMRQDMNLTKDEIKKRYDIKFNQSAEANKSAKIVSDMRRSDAFEKKIVDNQNYILYDKSMNFNEYLGEYSQNTKDMINQMENSKHLISTNKYLNPNEKIFIVISSSMDKSSIQNYFKLLENVKTDITFVLRGLVGNDARYINPTFSYLQDLLVKDPNNKNKEDKNNFYYYNIEINPKVTRRFNITKVPAVIFIKNYDPIVEDYQKMTNTPADTNEEYFVAYGETSINYALSEINKQAKSDGLARFIQNMNSNFYTK
>NZ_CP007183.1|WP_002840153.1|1288188_1288851_+|helix-turn-helix-transcriptional-regulator
MFIKELRERLNLTQSEFAKNLNINQAIVSRYENKKLRPTSEFIIRLIKTFNANPNFIFFGKEPCLNENTYKNEISQELNQLIDELSLYENEKNIISELENSALEKIISLVSDKEIWEKLFSLLFKIDRKLYTITLFICRVSKRLEEKSEAHKAYLASIINSFDDKDFSKLNECMKMDLITLFNEKFTEEEANIIIEDCLVVFKHIEKTAPIHKMIELGKN
>NZ_CP007183.1|WP_002794785.1|1287167_1288166_+|conjugal-transfer-protein-TraU
MKFKAHLISAVAAACLFFHPSETKAVCAPNPSQILISLTELCWECIFPISIAGIQVIQGPMPDPQGSVGSPICICPAPPPLFFRIGIPIGYFEPSRMLDSVKDPYCFVGLGFGMPEMLTASKGTKGDGHDRARVFYQSHYYIYPIIGMVGILIDAACMNITSGVDIAYMTEVDPLWQDDELTALINPEALLFGNPISNLACMADSVSAQANVALDPLFWCKGSWGNAYPLSGNTGSKDYVEDAASVAGSMIYKLHRELILWESAGQLGLCGEYPMPIWRKSSYRLQILAPVPHPMGMGIGQSGILWSFAKNYPVAGDNFTFMVFKKKECCAF
>NZ_CP007183.1|WP_002840150.1|1286476_1287151_+|chromosome-segregation-protein-ParM
MKKIFFSTIILASVLYAGGSKEMILGKTKDFAERDMIELIQEFIEKNKAQIEQKAFKTREQARENVKNYQPKGLIPLKPALEDKIFYPDLTYTLDQDIKNANGDILYPKGFKFNPADYVKLSYAMVVINGNNKKEVEWFKKSGFSNQVSYRLLLSEGSYYDLNQELKQEVFYLNPQIREKFKIEKTPSIIKQIDNKIQIHEICIPCMENNKTKIVDNNLSIKEI
>NZ_CP007183.1|WP_002794781.1|1285693_1286464_+|hypothetical-protein
MKISTTILVLACFLQASTFFGDSKRGWFYYELADNNNTQEKNETKIQKRMNADDLFIASIPLNNLDLLTAEEFTETFEKVRKIAIMNPTKTNVMTMQIMNKWQVDQSEKFAKVWALNLLENPNLEYPEIRDDKFGRSEMFRQKQEKINNFYKAHQDDFSYVVFVSDLNKEINEKQKGIYRSLQSDYGVNVEYVNVDERKDLISKFKLATTPENFFVYRNSKGEAIWQRVKSGLTNKDDIINNTLFLFDNAILEKDK
>NZ_CP007183.1|WP_002840381.1|1283733_1284165_-|hypothetical-protein
MPKTDTKPNAKNRIYKAIETWFTKIYLNKIIHNAKDTSIFINKSSCLAFILSIYGKTDENKSKMTPAVIAYIKKTKNTFIAKLKRVKNHESIIDLQAKYPKLDIVSAYQFLTLKDKFKITKSEIQDFETLIDILSKNAQKSKK
>NZ_CP007183.1|WP_002793403.1|1293215_1294112_-|hypothetical-protein
MLEKIKLYLENYRIQKVLFELLNLDLKELNYSWNDNINCFSFSGGIIKLLKLNEYYIKSSLVYIKDGQWLQKQDDFIGLLSNLFKQDEYKEIDDFDLGVVKSISCSSSNNETNYFANINLYESNIDPRDIIYLFGFDTFRALNKKGGWDLQSCIKHFQEDKILEFTYYEWADWYEWNNHNGSHHFAVALYHLRNNQDKYKVKARIKIEKLNQYNLKKLLEEYEIFITHEDNIYKINSLFNQIFTAQDYKNYKLNNDKTYAIVFKKNKINNFILNILNKLDSKYFFYWNRELKKHSNPK
>NZ_CP007183.1|WP_002779572.1|1294773_1295007_+|hypothetical-protein
MHTITITSDNIDFIKSLECLSKNAGAIFKISKNDLEATLDNYEDNRTLDEVKKEAEETLLHYKQGKLSVTPLGSEWL
>NZ_CP007183.1|WP_002779571.1|1295007_1295289_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKIVESDKFKKELNNILAFIAKDSVSAKNYFSKSLKDAILCIDNMPYKFRKSTLFNDENIRDFIFKKYVIPYYIDSKNDKILLITIYKNNLVK
>NZ_CP007183.1|WP_002790355.1|1295827_1296055_+|hypothetical-protein
MTLIIENVNENFLPAFKGLAKSINAKCKISKPKLSSFESRILNASKELDKEKKVNTALSFNSHQDFVKAYQNGKI
>NZ_CP007183.1|WP_002782140.1|1296041_1296323_+|type-II-toxin-antitoxin-system-YafQ-family-toxin
MAKYKIYYHKDFIKAYKKISDEERKITDEVIVKLSNDENLEPKYKDHQLKGVLKDFRECHIKSNLLLIYQKHNNELELNILKLGSHSKLFKKY
>NZ_CP007183.1|WP_002839469.1|1296334_1296688_+|hypothetical-protein
MDKVEVKLKKSKMTTTEKLILTLWLSCGVAAIVLLLVYLKIITSFIGILGLLSVSSLVIAFVLFLAKNIKIVPYDEKKHGGYRSDNNTHFSEFLDGYATGYSMSIHGIDGEALHSDK
>NZ_CP007183.1|WP_002839470.1|1296762_1299591_-|conjugal-transfer-protein-TraG
MKRFYFLFFSTLFFAPSFLFGATNIANSNLIYTWGYGDVMNEIMQAVKGITTETDYIVNAALAISLLLFSIKKAMDGQTNPVFEFGKMFMLFAVVWYMFLRAPNDNNHRFMIHDEVTSKDYVISQIPIGIGKSFALMTQFEKVILEAMEKHFTTPQSTNFSNAGLGFSLQVMSTLPSVKLSAIDATLQKNIDFYFRNCVSVGILLNQQGRNLFQNSDNLMQDLFTNIGNGSQLTPLFENNNNIEKQSVVPCSDAGPQIVEMIKNDTDEAMKIHAALLGMANDMANYEQKFLGAAQIYNEQAVSARSYLQQSMIMLASQDAIINTAKSVGLNPASVAANTAYADQQFYASMQAQGHMAQTYLPLAKAYLTAIIIGLSWLVALLSIVFGSYAHIKMFFTLCIWIVLWTPILCIINFINDFNLMKVAQVITGGKAALSLGDNILIFKEVASRSNFMNYLVMSTPVLAYAIAKASEQGFVTFASGLSQALTGASRAAGSFANQQALSTQTSIAAPRGDEVWAMNAGVVSLQSAMSAGGGRFSMSAITGGGTTVKDVNTNTNFALGSNGEITNMSIAGLDAKHAQSETQTRQDSLANSIADTHKTGINQGITSNYLRNHGAGVEDTKAIEKAEAQALRETMSEVLGDKSSFNEADKKALEGSVGAYASGSAGLEIFGSGGKIGGEIKGIASIGTGSTETQEYSRSLSKEGQAAFDKMYAEKLGNIIKSSDSVASAYSNALSTSTGSEFADAKQKAHSYSEASQYSEAIQTSNLPNMAENYIAENNLGGTREQQVAAAAKGLENLAARGDLQGLLHYANMNTAKPNADGIHDVSNKSYYSPSSVGANNAHNNDTVANQNSLNNLGTAGGNNIRNEFSQQSGAAISNFKNQGTSTSNVVNNSAKDAIVEQNANRRMGVNPSSYTIQDASKSGNELAKEAQGLFEAMSKK
>NZ_CP007183.1|WP_002816687.1|1299854_1302020_-|conjugal-transfer-protein-TraN
MKNYNLLRFFSKNTSVEQITPKTLRLAILLSASLSFSQAAIQCTDYNDFKQFNGHYYTATVQKMTFEDARKLAEDSGGYLAIPDSKAENDFLSSLFRGGQYAWIGVYDPSYISNYCVEGNSGCIYDDSRFKTVKGNPLTYKNWAQTQPDNLLKKYDIVDGKERVSPLGEHWVAMASPSGQWSDQGNHFGDTNNPVRNYALLEFDKIPDCAGGGSDGGDNGHTATDAMQCNTNFSDDPNFKPANGQGQSIACLQNSQQKYFCPAQLTQCVNSDDAVDGSSKKIEGGVLKTGKTKVRLTFSKSIGYNAWQVVTNDIYITDIDAIDSFKLVYAGADDWVVPFAPNSTVAVVGNKPNNTKDALDYIPYRPNNDNYGELSKFSGKNLNIELKQYLHTGINKSVAFFATVGSGGWQLTYEATGKDISCSNFGRNLNCTEESETIPFSAYKYTCPAGYQPKEQGGVCSPQSVDDLIDTNGDGIGDSCNSSIAPAKNCLGVTRTCPFNSSRECVLIDNKYQCSPFPCFKGVSDVENTDTPVGVNDANNNGWNDDGTCSGQIIIFNGQDNRCKNWDMFGGLLGGGCCDKDNVFLGLVACKEDEKKLAKLNDAGKCHEVGTYCSKKVSLGFTKICVEKKKSFCCFNSKLGRIFNEQGRPQLGKGWGSAEGPQCKGFTPEEFQKLDFSEIDLSEFIADIVGSFDTGKIQADSVKIQEKIQNNIENATKKPTN
>NZ_CP007183.1|WP_002815664.1|1302016_1302355_-|hypothetical-protein
MKTFNCNIEINKNKTKQPKFSFNDKGLFDSQKYDITDVGNLIFASSINKIFGFTTKSFKEMIIKCNTNNLLKNESAFESIELKKEEEEKFTLDFLIESNKTSVLSVFKGKII
>NZ_CP007183.1|WP_002896916.1|1302341_1302698_-|hypothetical-protein
MFKIKTTPKVVSLWSRALQKAVSYFLDLKNIFLISSLKSVINTAVTAMNVFRKSIVDSFLGVISSRIPNLIAKKKARPFLRIELLSHLQGSVKPLLSIYLMDKNIITQNSKKGNDENI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007183_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007183_4

1756103-1756191

Orphan

Consensus_repeat	Method
TTACCGCTTTCATAATCATTTAAAGCCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007183_4

>merge|NZ_CP007183|4|1756103-1756191|CRISPRCasFinder
TTACCGCTTTCATAATCATTTAAAGCCTTATGTAGTTCTTGTTTTGTTTCTTGCCAACTTTTACCGCTTTCATAATCATTTAAAGCCTT

>NZ_CP007183|4|3|1756103-1756191|CRISPRCasFinder
TTACCGCTTTCATAATCATTTAAAGCCTT	ATGTAGTTCTTGTTTTGTTTCTTGCCAACTT
TTACCGCTTTCATAATCATTTAAAGCCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007183.1\|WP_002786245.1\|1748851_1749364_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|236272
NZ_CP007183.1\|WP_002839444.1\|1752099_1753017_-\|methionyl-tRNA-formyltransferase	unknown	unknown	gnl\|CDD\|234567
NZ_CP007183.1\|WP_002779404.1\|1751483_1752137_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|236273
NZ_CP007183.1\|WP_002839955.1\|1762434_1762803_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374224
NZ_CP007183.1\|WP_002812168.1\|1754460_1755216_-\|glutamate-5-kinase	unknown	unknown	gnl\|CDD\|183430
NZ_CP007183.1\|WP_002785040.1\|1749860_1750697_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_CP007183.1\|WP_002779403.1\|1750701_1751487_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|379293
NZ_CP007183.1\|WP_002839966.1\|1756702_1757071_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002782344.1\|1755778_1756066_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP007183.1\|WP_002779406.1\|1753158_1753551_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_025443347.1\|1759466_1760594_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002779407.1\|1753465_1754194_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839962.1\|1760899_1761082_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP007183.1\|WP_025443348.1\|1762241_1762424_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002779401.1\|1749376_1749802_-\|F0F1-ATP-synthase-subunit-B'	unknown	unknown	gnl\|CDD\|181442
NZ_CP007183.1\|WP_002839965.1\|1757227_1757434_+\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|369382
NZ_CP007183.1\|WP_002839960.1\|1761374_1762136_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002782640.1\|1760595_1760889_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839953.1\|1763051_1763387_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007183.1\|WP_002839964.1\|1758289_1759483_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|316042

Protein	Function_ID	Function_description	E-value
NZ_CP007183.1\|WP_002839955.1\|1762434_1762803_-\|hypothetical-protein	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	8.52377e-08
NZ_CP007183.1\|WP_002839444.1\|1752099_1753017_-\|methionyl-tRNA-formyltransferase	gnl\|CDD\|234567	PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed.	6.58284e-141
NZ_CP007183.1\|WP_002839962.1\|1760899_1761082_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	9.60145e-08
NZ_CP007183.1\|WP_002812168.1\|1754460_1755216_-\|glutamate-5-kinase	gnl\|CDD\|183430	PRK12314, PRK12314, gamma-glutamyl kinase; Provisional.	3.35657e-127
NZ_CP007183.1\|WP_002785040.1\|1749860_1750697_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	1.85042e-67
NZ_CP007183.1\|WP_002779403.1\|1750701_1751487_-\|ParA-family-protein	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	4.96378e-87
NZ_CP007183.1\|WP_002782344.1\|1755778_1756066_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	0.00445178
NZ_CP007183.1\|WP_002786245.1\|1748851_1749364_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|236272	PRK08475, PRK08475, F0F1 ATP synthase subunit B; Validated.	3.68094e-60
NZ_CP007183.1\|WP_002779401.1\|1749376_1749802_-\|F0F1-ATP-synthase-subunit-B'	gnl\|CDD\|181442	PRK08476, PRK08476, F0F1 ATP synthase subunit B'; Validated.	8.05232e-49
NZ_CP007183.1\|WP_002839965.1\|1757227_1757434_+\|acyl-carrier-protein	gnl\|CDD\|369382	pfam07471, Phage_Nu1, Phage DNA packaging protein Nu1. Terminase, the DNA packaging enzyme of bacteriophage lambda, is a heteromultimer composed of subunits Nu1 and A. The smaller Nu1 terminase subunit has a low-affinity ATPase stimulated by non-specific DNA.	0.00431775
NZ_CP007183.1\|WP_002839964.1\|1758289_1759483_-\|AAA-family-ATPase	gnl\|CDD\|316042	pfam13481, AAA_25, AAA domain. This AAA domain is found in a wide variety of presumed DNA repair proteins.	3.42254e-15
NZ_CP007183.1\|WP_002779404.1\|1751483_1752137_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|236273	PRK08477, PRK08477, biotin--[acetyl-CoA-carboxylase] ligase.	1.82625e-114

>NZ_CP007183.1|WP_002782344.1|1755778_1756066_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MQILESDLFTNELNIILSFIVRKESIKVKNTFKNDLYKALKKLDFMPYKFRKSLAFDDENVRDFIFKGYVIPYKIDKEKDLIIILGIYKENLPNF
>NZ_CP007183.1|WP_002812168.1|1754460_1755216_-|glutamate-5-kinase
MQRIVVKVGSHVISDENLLNLKRFENLVAFLAKLMQKYKVILVTSAAISAGCTKLHIDRKNLINKQVLAAIGQPFLISVYNEFLAKFGKMGGQILLTGKDFDSRKATKHAKNAIDAMIDLGILPIINENDATAIEEIVFGDNDSLSAYATHFFEADLLVILSDIDGFYDKNPSEFSDAKRLERVEFIKEEWLNVSVKTGSEHGTGGIVTKLKAAKFLLENHKKMFLASGFDLSVAKAFLLENKQIGGTLFE
>NZ_CP007183.1|WP_002779407.1|1753465_1754194_-|hypothetical-protein
MSILVNAVDTFYSTKNEAVFSASKSENIKRNVADFNTDNNTKNSVYFFSDDKEISLNLSNESMELLTNHFSANDFLKLSNGNIGLSGKAAAFVEGWYKDIMINRNFLNADRDKNGRIENNEHLSLKNSVEDVAKNQDLSKNFGAVVLRMTQSTTGYVENTISDKSLSIEALIDESIKSDRNFDGIITRLEYSAKGGTDMQGYTNWAIDALNDILDDSDKAKNSFSCRSYKQNLAFVCRQNIK
>NZ_CP007183.1|WP_002779406.1|1753158_1753551_-|hypothetical-protein
MIAIKPKIHLVVDPTSKIWHSYAGKTLNEVKAYYDNPFRATSGTSASGFLNIVIEEPRILPSNDLENEKEQLLNEFPEFRALIQNNPNITKEKLLKLKNQQRITHNYQDHQKQDLQKEFTQNFFKTDLKA
>NZ_CP007183.1|WP_002839444.1|1752099_1753017_-|methionyl-tRNA-formyltransferase
MKKIIFMGTPSYATCILKALLEDENFELLALFTQPDKAVGRKQILTPSDTKAFLLQKAPQIPIFTPNSLKDESVIEQIYALKPDFIVVAAYGKILPKAILDIAPCINLHASLLPKYRGASPIQSAILNADEKSGVCTMLMEEGLDTGAVLESVECDIRDKNVNEVFEILANLAAKLTLSTLLNYEKLLPKKQDESLATHCKKIKKEDGLVSLDNAREIYQKYLAFTPWPGVFLENGLKFIELELVDELKQNAKMGEILELEKESFLLACKQGILRIKKLQESGKKALDGRTYLNGKRLKSADSLC
>NZ_CP007183.1|WP_002779404.1|1751483_1752137_-|biotin--[acetyl-CoA-carboxylase]-ligase
MEKGLKVQIACVESIDSTHLFLCEQIRSGKINENFALYALNQTKGVGSRENSWQSSSGNLHLSFCIKEGDLPSDLPLASVSIYFAYLLKEILQEKGSRIWLKWPNDLYLDDKKVGGVISTKISDFIVGGMGLNLKFAPHDAALCDVEILLKDLIQEFLQRLEKKFLWKHIFSKYMLEFEKSRQFSVHYEGKVFSLENAFLYEDGSILLGDKRVYSLR
>NZ_CP007183.1|WP_002779403.1|1750701_1751487_-|ParA-family-protein
MSEIITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANATTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENNEKKMILKNQIQEVLDEYDFIIIDSPPALGSITINAFVASDSVIIPIQCEFYALEGVAMVLNTIKIIKKTINPKLKVRGFLPTMYSSQNNLSKDVVEDLKQNFKKQLFTINGNEDDFIVIPRNVKLAESPSFGKPIILYDIKSPGSLAYQNLAYSILG
>NZ_CP007183.1|WP_002785040.1|1749860_1750697_-|ParB/RepB/Spo0J-family-partition-protein
MGLNKNRGLSTLMGDVGEVYSRELGLDKNQVSLIEISKITPNPFQPRKTFDEIALNELANSIKEHGLIQPIIVLKKNDSFILVAGERRLRATQILGKENILAFVSDSDESKLRELALIENIQRENLNPIELANSYKDLIEVYNITQENLAELIHKSRTQITNTLRLLNLDPKTQDLIASGKISQGHAKVLVGLDKEDEKVLVDSILGQKLSVRDTERLVQKVKNKENTEDVEFENSMQSLKQTLNKLGFASKNNKKELIIRLDNIEKIKKLTEILNKF
>NZ_CP007183.1|WP_002779401.1|1749376_1749802_-|F0F1-ATP-synthase-subunit-B'
MFEDMHPSIMLATMAIFLAMIVILNTMLYRPLLKFMDERNDSIKNDENKVKENSQEMLGANDEVEAIHVSTREEIHKIKQNAINAAKEEAQQAIKAKKEELERKMANFYTELVSQKKELQDHLSAHLPDLKQALQNNIKQH
>NZ_CP007183.1|WP_002786245.1|1748851_1749364_-|F0F1-ATP-synthase-subunit-B
MKKLFYFIFLLPLCAFGASNGSGEYDIVPRTINFLIFVAILYYFVANPFKAFYKNRILRISLKLDEIQKKLLESKAKKLDTMKKLEEAKANAAAALVVAKKEAEVLAQKIKEETQNELALLEKHFEEQKDYEFRKMEKEVVSLTLKEIFEDSNIALKQNEIIDIMMKKVS
>NZ_CP007183.1|WP_002839966.1|1756702_1757071_-|hypothetical-protein
MEKVDYCRMSCLDGKINAFKYLLDLFLSDLENENDVKTCNMFENDTSIEYVKDMLMMMLDKIKEIVIDQDNCHHNIDMYASVYHEIIKDELGKEFTPKELKELHKKQEERLLKELFEESKKK
>NZ_CP007183.1|WP_002839965.1|1757227_1757434_+|acyl-carrier-protein
MTKEKFNQLLKQANLNKKQLADISGIPYPTINAWGSTTSYPPYIAFLLENYIKAQKYNKIKDLIKDDL
>NZ_CP007183.1|WP_002839964.1|1758289_1759483_-|AAA-family-ATPase
MKDYIKEINDLKKIKSQDIDKLDFKEFENIKSKINESSCNPSKIISQKNANIKNNSFVDLTQWAIRSVDLEKIEFTSLIDDFLDKGSISFLTSEANKGKTFLSFAICKHLLEFNKIRKIIYFDGDNSKITIKSRIKKSMQIGGYYFLDYPGFNYIQTSNALECGTDEIEVDFNFIVEKYLEPLMQSGGLVNVFIVFDSLFNFFNGDMNDNKKVAEFMKIIKKISHKGEATFLFIHHKGKSAESEFMGGVNFLNATDNLFKIQTSNNDGEILNIELNTKKARNFLPYNLKVDIDLNTLDLKIERAVNENDTNFLIKAKEIIEQKGEILQGELLELLEKSKTDTHAIKKLESGKGLYFNIIEKSRATGGKALKYYVPLKENKTIINGIEINAEQTLFSE
>NZ_CP007183.1|WP_025443347.1|1759466_1760594_-|hypothetical-protein
MSISLFNDEIKAYIKNYYSIVDFLYLRYGLEFDKQGNEKHNKSLKIKTNTCLITDFNGSFSGDIIDFIAFKENVGLKEALIIFSDFNRLPTQKVGSFKPQKEPLKDNSYLKNIAYSLQANFNLANSDFIECKALEKAFFNDFRLFMHLCKLNFLKDDEFESILKDYFAFSKDDKSLAFILKDKNEIKSVAIREKLFKNELVKWFKVKGSSNKFIKLIKAKEKGLLKDYCFIFSGIKEIIVSELLGLNAVCFQSDSMMKNIHSHEQINELLNLIDNKRIVFIVENDESSFKANLELLKELIQINPLKKGYCVFNYDEVKNADFIDFLAYLMKELRQDYQRDKKGLNSFFSYMEKYFKNYFNKKINLFLKVKNERLY
>NZ_CP007183.1|WP_002782640.1|1760595_1760889_-|hypothetical-protein
MNDRQALEYLKDELLFIFNVRFKYFDFSMFSLLKDKLRPLLKNTSFEKEIKELLSVLEVHKKSFLENKVFTKKEQKRIILLNACKATYEALKHKLKT
>NZ_CP007183.1|WP_002839962.1|1760899_1761082_-|helix-turn-helix-domain-containing-protein
MQHTNKDFLTIQEVITLYSLSKDTQNKYRMQKKIPYVKIGKKIFYEKVKLDEWFRNHTIN
>NZ_CP007183.1|WP_002839960.1|1761374_1762136_-|hypothetical-protein
MIDKNILHTRTIMVNISDFNPTAEFNEELKKAKDNKDYLKIFICNGLKNSKSNFYLENKLIIDEFTEKNSRFWNDLDIFNKLKPEVKVEIKEDLLIKINSLLFYARNLKDINSQHKNKLEKDLSILETLIKNYEKELNIKKTNIECAFKTLENIFYYIDNDTKEKISFQIGLKEFYKKAYIEITDMSVYPILILMCDIIYNKSILYCIEKKFNKTKTFNDFMLEMQEKYKLNSKKIKRKELLNTIIKAFKDFS
>NZ_CP007183.1|WP_025443348.1|1762241_1762424_-|hypothetical-protein
MNLILENPSEKLIKAVKAMAKIAKSKASVLNDYELKAYKEYLESGKKATLASNLYKELGL
>NZ_CP007183.1|WP_002839955.1|1762434_1762803_-|hypothetical-protein
MKKDINYYLNLPYKINLVKLDDGDYLAQFDDKELNKLVLMAGDGKTPNEATEDLKNAFACYLEEALAKNEFIPEPMQKDKSKNLAITLKNSLVDEIDFYSKKMGLSRSAFLAVSAKAYIKTL
>NZ_CP007183.1|WP_002839953.1|1763051_1763387_-|hypothetical-protein
MQNKILDLRAFDFRKYSSSNRNFFIYENTKQGFDNIDKVNIVLNLLHTLRNRACHFENLLKIRENDNKLYPRISTKEKGTNIGLMPDKIENFLNDLICLINKDLLDYLNRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	NZ_CP007184.1	14607-14635	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NZ_CP007184.1	14311-14339	1.0
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	NZ_CP007184.1	14607-14636	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NZ_CP007184.1	14311-14340	1.0

1. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to position: 14607-14635, mismatch: 0, identity: 1.0

taaaacaatagtattattgctcattgttt	CRISPR spacer
taaaacaatagtattattgctcattgttt	Protospacer
*****************************

2. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to position: 14311-14339, mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

3. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to position: 14607-14636, mismatch: 0, identity: 1.0

taaaacaatagtattattgctcattgtttt	CRISPR spacer
taaaacaatagtattattgctcattgtttt	Protospacer
******************************

4. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to position: 14311-14340, mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP045792	Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence	19421-19450	0	1.0
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP023547	Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence	1605-1634	0	1.0
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP011016	Campylobacter coli strain FB1 plasmid pCC42, complete sequence	5807-5836	0	1.0
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP017874	Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence	23098-23127	0	1.0
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	14607-14635	0	1.0
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	3718-3746	0	1.0
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_CP038863	Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence	34010-34038	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP046318	Campylobacter coli strain FDAARGOS_735 plasmid unnamed1, complete sequence	1172-1200	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	CP013736	Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence	16478-16506	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP017874	Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence	16109-16137	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_MH634990	Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence	3828-3856	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_MH634987	Campylobacter coli strain P118 plasmid pCCDM18M, complete sequence	17238-17266	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP028188	Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence	10979-11007	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP045792	Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence	1351-1379	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP023547	Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence	8581-8609	0	1.0
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NC_022656	Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence	4222-4250	0	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_017284	Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence	3373-3401	0	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	3376-3404	0	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	8922-8950	0	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NZ_CP014746	Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence	13894-13922	0	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	14311-14339	0	1.0
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NZ_CP038864	Campylobacter jejuni strain SCJK2 plasmid p2, complete sequence	20041-20069	0	1.0
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	14607-14636	0	1.0
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	3717-3746	0	1.0
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_CP038863	Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence	34009-34038	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP045792	Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence	1350-1379	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP046318	Campylobacter coli strain FDAARGOS_735 plasmid unnamed1, complete sequence	1172-1201	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP023547	Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence	8580-8609	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	CP013736	Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence	16478-16507	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP017874	Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence	16109-16138	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NC_022656	Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence	4221-4250	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_MH634990	Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence	3828-3857	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_MH634987	Campylobacter coli strain P118 plasmid pCCDM18M, complete sequence	17238-17267	0	1.0
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP028188	Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence	10979-11008	0	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NZ_CP014746	Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence	13894-13923	0	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	14311-14340	0	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NZ_CP038864	Campylobacter jejuni strain SCJK2 plasmid p2, complete sequence	20041-20070	0	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_017284	Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence	3372-3401	0	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	3375-3404	0	1.0
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	8921-8950	0	1.0
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP040242	Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence	6331-6360	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NC_022656	Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence	23704-23733	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP017876	Campylobacter coli strain ZV1224 plasmid pCCDM224S, complete sequence	17790-17819	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	CP013736	Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence	25295-25324	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP017867	Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence	15930-15959	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP017880	Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence	21144-21173	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP044172	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-2	2609-2638	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_MH634990	Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence	10827-10856	1	0.967
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP028188	Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence	20222-20251	1	0.967
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	4014-4042	1	0.966
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	4013-4042	1	0.967
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP040242	Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence	13447-13475	2	0.931
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP017867	Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence	8936-8964	2	0.931
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP017880	Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence	14148-14176	2	0.931
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP038863	Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence	3221-3249	2	0.931
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP040242	Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence	13446-13475	2	0.933
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP017867	Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence	8936-8965	2	0.933
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP017880	Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence	14148-14177	2	0.933
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP038863	Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence	3221-3250	2	0.933
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	3080-3108	3	0.897
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	8626-8654	3	0.897
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP017876	Campylobacter coli strain ZV1224 plasmid pCCDM224S, complete sequence	9347-9376	3	0.9
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	3079-3108	4	0.867
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	8625-8654	4	0.867
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_LR215015	Mycoplasma canis strain NCTC10146 plasmid 6	4227-4256	5	0.833
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	258206-258235	5	0.833
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP041349	Komagataeibacter xylinus strain CGMCC 17276 plasmid pA, complete sequence	138411-138440	5	0.833
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP021468	Komagataeibacter europaeus strain SRCM101446 plasmid pKE1446-1	189129-189158	5	0.833
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP004365	Komagataeibacter xylinus E25 plasmid pGX5, complete sequence	267569-267598	5	0.833
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NC_016037	Komagataeibacter medellinensis NBRC 3288 plasmid pGXY010, complete sequence	116885-116914	5	0.833
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	MH617573	Microviridae sp. isolate ctbf823, complete genome	3222-3250	5	0.828
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP045792	Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence	19414-19450	5	0.865
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP023547	Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence	1598-1634	5	0.865
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP017874	Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence	23098-23134	5	0.865
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP017876	Campylobacter coli strain ZV1224 plasmid pCCDM224S, complete sequence	17790-17826	5	0.865
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP044172	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-2	2609-2645	5	0.865
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP028188	Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence	20222-20258	5	0.865
NZ_CP007183_1	1.1\|1238897\|30\|NZ_CP007183\|CRT	1238897-1238926	30	NC_022111	Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence	1115863-1115892	6	0.8
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP019366	Borrelia turicatae 91E135 isolate Oz1 plasmid lpF33.5, complete sequence	11999-12028	6	0.8
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	MT325768	Psychrobacillus phage Perkons, complete genome	28070-28098	6	0.793
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP015943	Legionella pneumophila strain C9_S plasmid unamed2, complete sequence	38531-38559	6	0.793
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP021278	Legionella pneumophila subsp. fraseri strain D-4058 plasmid unnamed, complete sequence	58178-58206	6	0.793
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP021276	Legionella pneumophila strain D-4040 plasmid unnamed2, complete sequence	24887-24915	6	0.793
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP015952	Legionella pneumophila strain E5_N plasmid unnamed1, complete sequence	7549-7577	6	0.793
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP015948	Legionella pneumophila strain E2_N plasmid unnamed1, complete sequence	28670-28698	6	0.793
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_CP023350	Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence	64295-64324	6	0.8
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_CP024241	Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1	62648-62677	6	0.8
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_CP024238	Escherichia coli O15:H11 strain 90-9272 plasmid unnamed	250762-250791	6	0.8
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	MN693533	Marine virus AFVG_25M450, complete genome	15364-15393	6	0.8
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	MH617573	Microviridae sp. isolate ctbf823, complete genome	3222-3251	6	0.8
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP040242	Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence	6324-6360	6	0.838
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NC_022656	Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence	23697-23733	6	0.838
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	CP013736	Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence	25295-25331	6	0.838
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP017867	Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence	15930-15966	6	0.838
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP017880	Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence	21144-21180	6	0.838
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_MH634990	Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence	10827-10863	6	0.838
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	MN694478	Marine virus AFVG_250M504, complete genome	19978-20008	6	0.806
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	MN694270	Marine virus AFVG_250M505, complete genome	20095-20125	6	0.806
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	MN694656	Marine virus AFVG_250M501, complete genome	19707-19737	6	0.806
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	MN693919	Marine virus AFVG_250M503, complete genome	16185-16215	6	0.806
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	MN694712	Marine virus AFVG_250M502, complete genome	16183-16213	6	0.806
NZ_CP007183_1	1.1\|1238897\|30\|NZ_CP007183\|CRT	1238897-1238926	30	MN855965	Siphoviridae sp. isolate 340, complete genome	2671-2700	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NC_015419	Clostridium botulinum BKT015925 plasmid p5BKT015925, complete sequence	8426-8455	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NC_012219	Clostridium botulinum plasmid pC2C203U28 DNA, complete sequence, serotype: type C, strain: (C)-203U28	48584-48613	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP029459	Clostridium novyi strain 150557 plasmid pCN1, complete sequence	77307-77336	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP031319	Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence	17388-17417	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP029350	Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence	25692-25721	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	1070-1099	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	33945-33974	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP046661	Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence	1084-1113	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_MH454107	Escherichia coli strain 417957 plasmid p417957-CTXM, complete sequence	15633-15662	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_MF156714	Escherichia coli strain 15061806 plasmid p61806-dfrA, complete sequence	87307-87336	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP035016	Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence	18657-18686	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	18821-18850	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	51694-51723	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP019723	Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence	7054-7083	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP053913	Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence	14432-14461	7	0.767
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	MK250016	Prevotella phage Lak-A1, complete genome	342227-342256	7	0.767
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP008809	Campylobacter fetus subsp. fetus 04/554 plasmid pCFF04554, complete sequence	15475-15504	7	0.767
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP018792	Campylobacter sp. RM8964 plasmid pVIC8964, complete sequence	3667-3696	7	0.767
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP018794	Campylobacter sp. RM12175 plasmid pVIC12175-1, complete sequence	3672-3701	7	0.767
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP007741	Bacillus methanolicus MGA3 plasmid pBM19, complete sequence	10088-10117	7	0.767
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	LT615366	Enterococcus phage VPE25 genome assembly, chromosome: VPE25	17910-17938	7	0.759
NZ_CP007183_2	2.1\|1269715\|29\|NZ_CP007183\|CRISPRCasFinder	1269715-1269743	29	LT546030	Enterococcus phage VPE25 genome assembly, chromosome: I	17910-17938	7	0.759
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_CP053838	Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence	115826-115854	7	0.759
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_LT993739	Chlamydia sp. H15-1957-10C plasmid II, complete sequence	6739-6767	7	0.759
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP031399	Borreliella burgdorferi strain MM1 plasmid plsm_cp9, complete sequence	5468-5496	7	0.759
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NC_001904	Borreliella burgdorferi B31 plasmid cp9, complete sequence	5626-5654	7	0.759
NZ_CP007183_2	2.3\|1269847\|29\|NZ_CP007183\|CRISPRCasFinder	1269847-1269875	29	NZ_CP017210	Borreliella burgdorferi strain B331 plasmid B331_cp9, complete sequence	5639-5667	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	154281-154309	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	157463-157491	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_011252	Borrelia recurrentis A1 plasmid pl23, complete sequence	9054-9082	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_011257	Borrelia duttonii Ly plasmid pl23, complete sequence	9060-9088	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	AJ630128	Bacteriophage S-PM2 complete genome	195247-195275	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_006820	Synechococcus phage S-PM2, complete genome	195247-195275	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	LN828717	Synechococcus phage S-PM2 spontaneous deletion mutant, complete genome	185703-185731	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NZ_CP018790	Campylobacter sp. RM6137 plasmid pSUIS6137, complete sequence	3767-3795	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	KY554772	Lactococcus phage AM5, complete genome	24354-24382	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	KY554777	Lactococcus phage LW81, complete genome	25512-25540	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_049856	Lactococcus phage AM4, complete genome	106894-106922	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_027341	Lactococcus phage WRP3, complete genome	23993-24021	7	0.759
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	NC_049857	Lactococcus phage P1048, complete genome	17031-17059	7	0.759
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	LT615366	Enterococcus phage VPE25 genome assembly, chromosome: VPE25	17910-17939	7	0.767
NZ_CP007183_2	2.6\|1269715\|30\|NZ_CP007183\|CRT	1269715-1269744	30	LT546030	Enterococcus phage VPE25 genome assembly, chromosome: I	17910-17939	7	0.767
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_CP053838	Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence	115826-115855	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_011252	Borrelia recurrentis A1 plasmid pl23, complete sequence	9054-9083	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_011257	Borrelia duttonii Ly plasmid pl23, complete sequence	9060-9089	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	AJ630128	Bacteriophage S-PM2 complete genome	195247-195276	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_006820	Synechococcus phage S-PM2, complete genome	195247-195276	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	LN828717	Synechococcus phage S-PM2 spontaneous deletion mutant, complete genome	185703-185732	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	MT325768	Psychrobacillus phage Perkons, complete genome	28070-28099	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	KY554772	Lactococcus phage AM5, complete genome	24354-24383	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	KY554777	Lactococcus phage LW81, complete genome	25512-25541	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_049856	Lactococcus phage AM4, complete genome	106894-106923	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_027341	Lactococcus phage WRP3, complete genome	23993-24022	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_049857	Lactococcus phage P1048, complete genome	17031-17060	7	0.767
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NZ_CP018790	Campylobacter sp. RM6137 plasmid pSUIS6137, complete sequence	3766-3795	7	0.767
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP021278	Legionella pneumophila subsp. fraseri strain D-4058 plasmid unnamed, complete sequence	58177-58206	7	0.767
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP015948	Legionella pneumophila strain E2_N plasmid unnamed1, complete sequence	28669-28698	7	0.767
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP015943	Legionella pneumophila strain C9_S plasmid unamed2, complete sequence	38531-38560	7	0.767
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP021276	Legionella pneumophila strain D-4040 plasmid unnamed2, complete sequence	24887-24916	7	0.767
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP015952	Legionella pneumophila strain E5_N plasmid unnamed1, complete sequence	7549-7578	7	0.767
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_CP011016	Campylobacter coli strain FB1 plasmid pCC42, complete sequence	5800-5836	7	0.811
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_CP017773	Paenibacillus crassostreae strain LPB0068 plasmid pPC03, complete sequence	32644-32674	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	60582-60612	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	94640-94670	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	MN657144	Pedobacter sp. strain ANT_H27B plasmid pA27BH1, complete sequence	51151-51181	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	87344-87374	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	189029-189059	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	87693-87723	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	87693-87723	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	31164-31194	7	0.774
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	93188-93218	7	0.774
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP028874	Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence	9481-9510	8	0.733
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	123000-123029	8	0.733
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	KT895374	Bacillus phage vB_BpuM-BpSp, complete genome	156022-156051	8	0.733
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP042559	Acinetobacter baumannii strain E47 plasmid pE47_003, complete sequence	7517-7546	8	0.733
NZ_CP007183_1	1.2\|1238963\|30\|NZ_CP007183\|CRT	1238963-1238992	30	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	423886-423915	8	0.733
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_CP023350	Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence	64295-64323	8	0.724
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_CP024241	Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1	62648-62676	8	0.724
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_CP024238	Escherichia coli O15:H11 strain 90-9272 plasmid unnamed	250762-250790	8	0.724
NZ_CP007183_2	2.2\|1269781\|29\|NZ_CP007183\|CRISPRCasFinder	1269781-1269809	29	NZ_CP040462	Enterococcus sp. M190262 plasmid pM190262, complete sequence	46787-46815	8	0.724
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	KJ019094	Synechococcus phage ACG-2014e isolate Syn7803US33, complete genome	90571-90599	8	0.724
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	KJ019156	Synechococcus phage ACG-2014e isolate Syn7803C2, complete genome	90567-90595	8	0.724
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	KJ019054	Synechococcus phage ACG-2014e isolate Syn7803C85, complete genome	90662-90690	8	0.724
NZ_CP007183_2	2.4\|1269913\|29\|NZ_CP007183\|CRISPRCasFinder	1269913-1269941	29	KJ019082	Synechococcus phage ACG-2014i isolate Syn7803US120, complete genome	90413-90441	8	0.724
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP017030	Campylobacter jejuni subsp. jejuni strain 14980A plasmid pCJ14980A, complete sequence	4022-4050	8	0.724
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP017877	Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence	43792-43820	8	0.724
NZ_CP007183_2	2.5\|1269979\|29\|NZ_CP007183\|CRISPRCasFinder	1269979-1270007	29	NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	16097-16125	8	0.724
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_CP040462	Enterococcus sp. M190262 plasmid pM190262, complete sequence	46786-46815	8	0.733
NZ_CP007183_2	2.7\|1269781\|30\|NZ_CP007183\|CRT	1269781-1269810	30	NZ_LT993739	Chlamydia sp. H15-1957-10C plasmid II, complete sequence	6739-6768	8	0.733
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP031399	Borreliella burgdorferi strain MM1 plasmid plsm_cp9, complete sequence	5468-5497	8	0.733
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NC_001904	Borreliella burgdorferi B31 plasmid cp9, complete sequence	5626-5655	8	0.733
NZ_CP007183_2	2.8\|1269847\|30\|NZ_CP007183\|CRT	1269847-1269876	30	NZ_CP017210	Borreliella burgdorferi strain B331 plasmid B331_cp9, complete sequence	5639-5668	8	0.733
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	154280-154309	8	0.733
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	157462-157491	8	0.733
NZ_CP007183_4	4.1\|1756132\|31\|NZ_CP007183\|CRISPRCasFinder	1756132-1756162	31	NC_019774	Anabaena cylindrica PCC 7122 plasmid pANACY.04, complete sequence	26535-26565	8	0.742
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	MN694139	Marine virus AFVG_250M1132, complete genome	22515-22544	9	0.7
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP048637	Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence	194215-194244	9	0.7
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP039920	Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626c, complete sequence	86383-86412	9	0.7
NZ_CP007183_1	1.3\|1239029\|30\|NZ_CP007183\|CRT	1239029-1239058	30	NZ_CP039913	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence	36698-36727	9	0.7
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	KJ019094	Synechococcus phage ACG-2014e isolate Syn7803US33, complete genome	90571-90600	9	0.7
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	KJ019156	Synechococcus phage ACG-2014e isolate Syn7803C2, complete genome	90567-90596	9	0.7
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	KJ019054	Synechococcus phage ACG-2014e isolate Syn7803C85, complete genome	90662-90691	9	0.7
NZ_CP007183_2	2.9\|1269913\|30\|NZ_CP007183\|CRT	1269913-1269942	30	KJ019082	Synechococcus phage ACG-2014i isolate Syn7803US120, complete genome	90413-90442	9	0.7
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP017030	Campylobacter jejuni subsp. jejuni strain 14980A plasmid pCJ14980A, complete sequence	4021-4050	9	0.7
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP017877	Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence	43791-43820	9	0.7
NZ_CP007183_2	2.10\|1269979\|30\|NZ_CP007183\|CRT	1269979-1270008	30	NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	16096-16125	9	0.7
NZ_CP007183_3	3.1\|1292855\|37\|NZ_CP007183\|CRISPRCasFinder	1292855-1292891	37	NZ_LR215015	Mycoplasma canis strain NCTC10146 plasmid 6	4220-4256	9	0.757

1. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP045792 (Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatactcaaaatatatattaaattaata	CRISPR spacer
cgcatactcaaaatatatattaaattaata	Protospacer
******************************

2. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP023547 (Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatactcaaaatatatattaaattaata	CRISPR spacer
cgcatactcaaaatatatattaaattaata	Protospacer
******************************

3. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP011016 (Campylobacter coli strain FB1 plasmid pCC42, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatactcaaaatatatattaaattaata	CRISPR spacer
cgcatactcaaaatatatattaaattaata	Protospacer
******************************

4. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP017874 (Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatactcaaaatatatattaaattaata	CRISPR spacer
cgcatactcaaaatatatattaaattaata	Protospacer
******************************

5. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 0, identity: 1.0

taaaacaatagtattattgctcattgttt	CRISPR spacer
taaaacaatagtattattgctcattgttt	Protospacer
*****************************

6. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 0, identity: 1.0

taaaacaatagtattattgctcattgttt	CRISPR spacer
taaaacaatagtattattgctcattgttt	Protospacer
*****************************

7. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP038863 (Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
agatccgataaaaacagaaaaagtccgaa	Protospacer
*****************************

8. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP046318 (Campylobacter coli strain FDAARGOS_735 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

9. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to CP013736 (Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

10. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017874 (Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

11. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_MH634990 (Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

12. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_MH634987 (Campylobacter coli strain P118 plasmid pCCDM18M, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

13. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP028188 (Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

14. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP045792 (Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

15. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP023547 (Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

16. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NC_022656 (Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgc	CRISPR spacer
tctttgcaattcttccattagattaatgc	Protospacer
*****************************

17. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_017284 (Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

18. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

19. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

20. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP014746 (Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

21. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

22. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP038864 (Campylobacter jejuni strain SCJK2 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atacaaatacaaatttcagaattaaaaag	Protospacer
*****************************

23. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 0, identity: 1.0

taaaacaatagtattattgctcattgtttt	CRISPR spacer
taaaacaatagtattattgctcattgtttt	Protospacer
******************************

24. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 0, identity: 1.0

taaaacaatagtattattgctcattgtttt	CRISPR spacer
taaaacaatagtattattgctcattgtttt	Protospacer
******************************

25. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_CP038863 (Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agatccgataaaaacagaaaaagtccgaat	CRISPR spacer
agatccgataaaaacagaaaaagtccgaat	Protospacer
******************************

26. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP045792 (Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

27. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP046318 (Campylobacter coli strain FDAARGOS_735 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

28. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP023547 (Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

29. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to CP013736 (Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

30. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP017874 (Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

31. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NC_022656 (Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

32. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_MH634990 (Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

33. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_MH634987 (Campylobacter coli strain P118 plasmid pCCDM18M, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

34. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP028188 (Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence) position: , mismatch: 0, identity: 1.0

tctttgcaattcttccattagattaatgct	CRISPR spacer
tctttgcaattcttccattagattaatgct	Protospacer
******************************

35. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NZ_CP014746 (Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

36. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

37. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NZ_CP038864 (Campylobacter jejuni strain SCJK2 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

38. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_017284 (Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

39. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

40. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 0, identity: 1.0

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atacaaatacaaatttcagaattaaaaaga	Protospacer
******************************

41. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP040242 (Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattaaattaata	Protospacer
.*****************************

42. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NC_022656 (Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattaaattaata	Protospacer
.*****************************

43. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP017876 (Campylobacter coli strain ZV1224 plasmid pCCDM224S, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
agcatactcaaaatatatattaaattaata	Protospacer
 *****************************

44. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to CP013736 (Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattaaattaata	Protospacer
.*****************************

45. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP017867 (Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattaaattaata	Protospacer
.*****************************

46. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP017880 (Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattaaattaata	Protospacer
.*****************************

47. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP044172 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-2) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
agcatactcaaaatatatattaaattaata	Protospacer
 *****************************

48. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_MH634990 (Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattaaattaata	Protospacer
.*****************************

49. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP028188 (Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence) position: , mismatch: 1, identity: 0.967

cgcatactcaaaatatatattaaattaata	CRISPR spacer
agcatactcaaaatatatattaaattaata	Protospacer
 *****************************

50. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 1, identity: 0.966

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
atgcaaatacaaatttcagaattaaaaag	Protospacer
**.**************************

51. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 1, identity: 0.967

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
atgcaaatacaaatttcagaattaaaaaga	Protospacer
**.***************************

52. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040242 (Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence) position: , mismatch: 2, identity: 0.931

tctttgcaattcttccattagattaatgc	CRISPR spacer
cttttgcaattcttccattagattaatgc	Protospacer
..***************************

53. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017867 (Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence) position: , mismatch: 2, identity: 0.931

tctttgcaattcttccattagattaatgc	CRISPR spacer
tttttgtaattcttccattagattaatgc	Protospacer
*.****.**********************

54. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017880 (Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence) position: , mismatch: 2, identity: 0.931

tctttgcaattcttccattagattaatgc	CRISPR spacer
tttttgtaattcttccattagattaatgc	Protospacer
*.****.**********************

55. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP038863 (Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.931

actacatcatagaacttgtttatataaaa	CRISPR spacer
actacattatagaacttgtttatacaaaa	Protospacer
*******.****************.****

56. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP040242 (Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence) position: , mismatch: 2, identity: 0.933

tctttgcaattcttccattagattaatgct	CRISPR spacer
cttttgcaattcttccattagattaatgct	Protospacer
..****************************

57. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP017867 (Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence) position: , mismatch: 2, identity: 0.933

tctttgcaattcttccattagattaatgct	CRISPR spacer
tttttgtaattcttccattagattaatgct	Protospacer
*.****.***********************

58. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP017880 (Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence) position: , mismatch: 2, identity: 0.933

tctttgcaattcttccattagattaatgct	CRISPR spacer
tttttgtaattcttccattagattaatgct	Protospacer
*.****.***********************

59. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP038863 (Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

actacatcatagaacttgtttatataaaag	CRISPR spacer
actacattatagaacttgtttatacaaaag	Protospacer
*******.****************.*****

60. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 3, identity: 0.897

taaaacaatagtattattgctcattgttt	CRISPR spacer
taaaacaatagtattattactcattctct	Protospacer
******************.****** *.*

61. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 3, identity: 0.897

taaaacaatagtattattgctcattgttt	CRISPR spacer
taaaacaatagtattattactcattctct	Protospacer
******************.****** *.*

62. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP017876 (Campylobacter coli strain ZV1224 plasmid pCCDM224S, complete sequence) position: , mismatch: 3, identity: 0.9

tctttgcaa---ttcttccattagattaatgct	CRISPR spacer
---ttgcaattcttcttccattagattaatgct	Protospacer
   ******   *********************

63. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 4, identity: 0.867

taaaacaatagtattattgctcattgtttt	CRISPR spacer
taaaacaatagtattattactcattctcta	Protospacer
******************.****** *.*

64. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 4, identity: 0.867

taaaacaatagtattattgctcattgtttt	CRISPR spacer
taaaacaatagtattattactcattctcta	Protospacer
******************.****** *.*

65. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_LR215015 (Mycoplasma canis strain NCTC10146 plasmid 6) position: , mismatch: 5, identity: 0.833

cgcatactcaaaatatatattaaattaata	CRISPR spacer
taaatattaaaaatatatattaaattaata	Protospacer
.. ***.* *********************

66. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 5, identity: 0.833

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ctcctactcaaactatataataaattaatc	Protospacer
* * ******** ****** *********

67. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP041349 (Komagataeibacter xylinus strain CGMCC 17276 plasmid pA, complete sequence) position: , mismatch: 5, identity: 0.833

-cgcatactcaaaatatatattaaattaata	CRISPR spacer
ccactta-tcaaaatatatattgaattaatg	Protospacer
 *.* ** **************.*******.

68. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP021468 (Komagataeibacter europaeus strain SRCM101446 plasmid pKE1446-1) position: , mismatch: 5, identity: 0.833

-cgcatactcaaaatatatattaaattaata	CRISPR spacer
ccactta-tcaaaatatatattgaattaatg	Protospacer
 *.* ** **************.*******.

69. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP004365 (Komagataeibacter xylinus E25 plasmid pGX5, complete sequence) position: , mismatch: 5, identity: 0.833

-cgcatactcaaaatatatattaaattaata	CRISPR spacer
ccactta-tcaaaatatatattgaattaatg	Protospacer
 *.* ** **************.*******.

70. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NC_016037 (Komagataeibacter medellinensis NBRC 3288 plasmid pGXY010, complete sequence) position: , mismatch: 5, identity: 0.833

-cgcatactcaaaatatatattaaattaata	CRISPR spacer
ccactta-tcaaaatatatattgaattaatg	Protospacer
 *.* ** **************.*******.

71. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to MH617573 (Microviridae sp. isolate ctbf823, complete genome) position: , mismatch: 5, identity: 0.828

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
aaaacagataaaaacagaaatagtccaaa	Protospacer
*.* * ************** *****.**

72. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP045792 (Campylobacter coli strain CFSAN032805 plasmid p2CFSAN032805, complete sequence) position: , mismatch: 5, identity: 0.865

-----ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
tgtttct-----cgcatactcaaaatatatattaaattaata	Protospacer
     **     ******************************

73. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP023547 (Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_2, complete sequence) position: , mismatch: 5, identity: 0.865

-----ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
tgtttct-----cgcatactcaaaatatatattaaattaata	Protospacer
     **     ******************************

74. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017874 (Campylobacter coli strain WA333 plasmid pCCDM33S, complete sequence) position: , mismatch: 5, identity: 0.865

-----ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
tgtttct-----cgcatactcaaaatatatattaaattaata	Protospacer
     **     ******************************

75. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017876 (Campylobacter coli strain ZV1224 plasmid pCCDM224S, complete sequence) position: , mismatch: 5, identity: 0.865

-----ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
tgtttcta-----gcatactcaaaatatatattaaattaata	Protospacer
     ***     *****************************

76. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP044172 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-2) position: , mismatch: 5, identity: 0.865

-----ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
catttcta-----gcatactcaaaatatatattaaattaata	Protospacer
     ***     *****************************

77. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP028188 (Campylobacter coli strain CFSAN054106 plasmid pGMI16-001, complete sequence) position: , mismatch: 5, identity: 0.865

-----ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
tgtttcta-----gcatactcaaaatatatattaaattaata	Protospacer
     ***     *****************************

78. spacer 1.1|1238897|30|NZ_CP007183|CRT matches to NC_022111 (Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

tatctaacttagaacaattttggattaaaa	CRISPR spacer
aagttgaattagaacaattttggattcaaa	Protospacer
 * .*.* ****************** ***

79. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP019366 (Borrelia turicatae 91E135 isolate Oz1 plasmid lpF33.5, complete sequence) position: , mismatch: 6, identity: 0.8

-cgcatactcaaaatatatattaaattaata	CRISPR spacer
ttggata-acaaaatagatattaaattaatg	Protospacer
 .* ***  ******* *************.

80. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to MT325768 (Psychrobacillus phage Perkons, complete genome) position: , mismatch: 6, identity: 0.793

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
tcacaaattccaatttcagaattaaataa	Protospacer
 .****** * *************** *.

81. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP015943 (Legionella pneumophila strain C9_S plasmid unamed2, complete sequence) position: , mismatch: 6, identity: 0.793

actacatcatagaacttgtttatataaaa	CRISPR spacer
tttacattatagaacttgtttgtattaca	Protospacer
 .*****.*************.*** * *

82. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP021278 (Legionella pneumophila subsp. fraseri strain D-4058 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

actacatcatagaacttgtttatataaaa	CRISPR spacer
tttacattatagaacttgtttgtattaca	Protospacer
 .*****.*************.*** * *

83. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP021276 (Legionella pneumophila strain D-4040 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

actacatcatagaacttgtttatataaaa	CRISPR spacer
tttacattatagaacttgtttgtattaca	Protospacer
 .*****.*************.*** * *

84. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP015952 (Legionella pneumophila strain E5_N plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

actacatcatagaacttgtttatataaaa	CRISPR spacer
tttacattatagaacttgtttgtattaca	Protospacer
 .*****.*************.*** * *

85. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP015948 (Legionella pneumophila strain E2_N plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

actacatcatagaacttgtttatataaaa	CRISPR spacer
tttacattatagaacttgtttgtattaca	Protospacer
 .*****.*************.*** * *

86. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_CP023350 (Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agatccgataaaaacagaaaaagtccgaat--	CRISPR spacer
atgtccgatataaacagaaaaagt--aaattc	Protospacer
* .******* *************  .***

87. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_CP024241 (Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

agatccgataaaaacagaaaaagtccgaat--	CRISPR spacer
atgtccgatataaacagaaaaagt--aaattc	Protospacer
* .******* *************  .***

88. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_CP024238 (Escherichia coli O15:H11 strain 90-9272 plasmid unnamed) position: , mismatch: 6, identity: 0.8

agatccgataaaaacagaaaaagtccgaat--	CRISPR spacer
atgtccgatataaacagaaaaagt--aaattc	Protospacer
* .******* *************  .***

89. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to MN693533 (Marine virus AFVG_25M450, complete genome) position: , mismatch: 6, identity: 0.8

---agatccgataaaaacagaaaaagtccgaat	CRISPR spacer
caaaaat---ataaaaacagaaaaaatccaaat	Protospacer
   *.**   ***************.***.***

90. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to MH617573 (Microviridae sp. isolate ctbf823, complete genome) position: , mismatch: 6, identity: 0.8

agatccgataaaaacagaaaaagtccgaat	CRISPR spacer
aaaacagataaaaacagaaatagtccaaaa	Protospacer
*.* * ************** *****.**

91. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040242 (Campylobacter coli strain S9 plasmid pCcS9_3, complete sequence) position: , mismatch: 6, identity: 0.838

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
ctttttttgcatactcaaaatatatattaaattaata	Protospacer
**    ..*****************************

92. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NC_022656 (Campylobacter coli 15-537360 plasmid pCC42yr, complete sequence) position: , mismatch: 6, identity: 0.838

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
ctttttttgcatactcaaaatatatattaaattaata	Protospacer
**    ..*****************************

93. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to CP013736 (Campylobacter coli strain OR12 plasmid pOR12CC42, complete sequence) position: , mismatch: 6, identity: 0.838

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
ctttttttgcatactcaaaatatatattaaattaata	Protospacer
**    ..*****************************

94. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017867 (Campylobacter coli strain YF2105 plasmid pCCDM105S, complete sequence) position: , mismatch: 6, identity: 0.838

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
ctttttttgcatactcaaaatatatattaaattaata	Protospacer
**    ..*****************************

95. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017880 (Campylobacter coli strain BG2108 plasmid pCCDM108S, complete sequence) position: , mismatch: 6, identity: 0.838

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
ctttttttgcatactcaaaatatatattaaattaata	Protospacer
**    ..*****************************

96. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_MH634990 (Campylobacter coli strain XK3140 plasmid pCCDM140S, complete sequence) position: , mismatch: 6, identity: 0.838

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
ctttttttgcatactcaaaatatatattaaattaata	Protospacer
**    ..*****************************

97. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to MN694478 (Marine virus AFVG_250M504, complete genome) position: , mismatch: 6, identity: 0.806

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
cttttcttcttgttttgttttttgcccactt	Protospacer
 * *  **************.***** ****

98. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to MN694270 (Marine virus AFVG_250M505, complete genome) position: , mismatch: 6, identity: 0.806

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
cttttcttcttgttttgttttttgcccactt	Protospacer
 * *  **************.***** ****

99. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to MN694656 (Marine virus AFVG_250M501, complete genome) position: , mismatch: 6, identity: 0.806

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
cttttcttcttgttttgttttttgcccactt	Protospacer
 * *  **************.***** ****

100. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to MN693919 (Marine virus AFVG_250M503, complete genome) position: , mismatch: 6, identity: 0.806

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
cttttcttcttgttttgttttttgcccactt	Protospacer
 * *  **************.***** ****

101. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to MN694712 (Marine virus AFVG_250M502, complete genome) position: , mismatch: 6, identity: 0.806

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
cttttcttcttgttttgttttttgcccactt	Protospacer
 * *  **************.***** ****

102. spacer 1.1|1238897|30|NZ_CP007183|CRT matches to MN855965 (Siphoviridae sp. isolate 340, complete genome) position: , mismatch: 7, identity: 0.767

tatctaacttagaacaattttggattaaaa	CRISPR spacer
tatcaaacttagaacaatttttaaatgatc	Protospacer
**** **************** .* *.*

103. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NC_015419 (Clostridium botulinum BKT015925 plasmid p5BKT015925, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattatccttttc	Protospacer
.*********************  .*  *

104. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NC_012219 (Clostridium botulinum plasmid pC2C203U28 DNA, complete sequence, serotype: type C, strain: (C)-203U28) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattattcttttc	Protospacer
.*********************  .*  *

105. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP029459 (Clostridium novyi strain 150557 plasmid pCN1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgcatactcaaaatatatattattcttttc	Protospacer
.*********************  .*  *

106. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP031319 (Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

107. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP029350 (Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

108. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

109. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

110. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP046661 (Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

111. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_MH454107 (Escherichia coli strain 417957 plasmid p417957-CTXM, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgaatactcaaaatatttattaaaatatcc	Protospacer
.* ************* ******* ** .

112. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_MF156714 (Escherichia coli strain 15061806 plasmid p61806-dfrA, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
tgaatactcaaaatatttattaaaatatcc	Protospacer
.* ************* ******* ** .

113. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP035016 (Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

114. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

115. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

116. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP019723 (Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

117. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP053913 (Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ggtaggtgcaaaatatatattaaaataata	Protospacer
 *.* .. **************** *****

118. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to MK250016 (Prevotella phage Lak-A1, complete genome) position: , mismatch: 7, identity: 0.767

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ctgatactcaatatatacattaaatttagg	Protospacer
*  ******** *****.******** * .

119. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP008809 (Campylobacter fetus subsp. fetus 04/554 plasmid pCFF04554, complete sequence) position: , mismatch: 7, identity: 0.767

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
aatttggttgtttttattcaaaaaattaaa	Protospacer
* **** *** ************** *.

120. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP018792 (Campylobacter sp. RM8964 plasmid pVIC8964, complete sequence) position: , mismatch: 7, identity: 0.767

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
aatttggttgtttttattcaaaaaattaaa	Protospacer
* **** *** ************** *.

121. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP018794 (Campylobacter sp. RM12175 plasmid pVIC12175-1, complete sequence) position: , mismatch: 7, identity: 0.767

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
aatttggttgtttttattcaaaaaattaaa	Protospacer
* **** *** ************** *.

122. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP007741 (Bacillus methanolicus MGA3 plasmid pBM19, complete sequence) position: , mismatch: 7, identity: 0.767

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
ctcttctgtggatttattcaaaaaaatgct	Protospacer
 *.** . *** *****************.

123. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to LT615366 (Enterococcus phage VPE25 genome assembly, chromosome: VPE25) position: , mismatch: 7, identity: 0.759

taaaacaatagtattattgctcattgttt	CRISPR spacer
gaaaacaataatattattgctgatcctga	Protospacer
 *********.********** **. *

124. spacer 2.1|1269715|29|NZ_CP007183|CRISPRCasFinder matches to LT546030 (Enterococcus phage VPE25 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.759

taaaacaatagtattattgctcattgttt	CRISPR spacer
gaaaacaataatattattgctgatcctga	Protospacer
 *********.********** **. *

125. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP053838 (Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence) position: , mismatch: 7, identity: 0.759

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
agagcagataaaaacagaaaaagagaaac	Protospacer
*** * *****************   .*

126. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_LT993739 (Chlamydia sp. H15-1957-10C plasmid II, complete sequence) position: , mismatch: 7, identity: 0.759

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
ttttttgataaaaacagaaaaagtgcaaa	Protospacer
   *..****************** *.**

127. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP031399 (Borreliella burgdorferi strain MM1 plasmid plsm_cp9, complete sequence) position: , mismatch: 7, identity: 0.759

tctttgcaattcttccattagattaatgc	CRISPR spacer
accatgcaattcttgcaatagattaatta	Protospacer
 *. ********** ** *********

128. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NC_001904 (Borreliella burgdorferi B31 plasmid cp9, complete sequence) position: , mismatch: 7, identity: 0.759

tctttgcaattcttccattagattaatgc	CRISPR spacer
accatgcaattcttgcaatagattaatta	Protospacer
 *. ********** ** *********

129. spacer 2.3|1269847|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017210 (Borreliella burgdorferi strain B331 plasmid B331_cp9, complete sequence) position: , mismatch: 7, identity: 0.759

tctttgcaattcttccattagattaatgc	CRISPR spacer
accatgcaattcttgcaatagattaatta	Protospacer
 *. ********** ** *********

130. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
tgggaaatacaaatttctggattaaaaat	Protospacer
  . ************* *.********

131. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
tgggaaatacaaatttctggattaaaaat	Protospacer
  . ************* *.********

132. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_011252 (Borrelia recurrentis A1 plasmid pl23, complete sequence) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
ttttcaatacaaatttaagaattaaaatc	Protospacer
 * . *********** **********

133. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_011257 (Borrelia duttonii Ly plasmid pl23, complete sequence) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
tttttaatacaaatttaagaattaaaatc	Protospacer
 * . *********** **********

134. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to AJ630128 (Bacteriophage S-PM2 complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
ctacaaaaacaagtttcagaattaactga	Protospacer
 ****** ****.************  ..

135. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_006820 (Synechococcus phage S-PM2, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
ctacaaaaacaagtttcagaattaactga	Protospacer
 ****** ****.************  ..

136. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to LN828717 (Synechococcus phage S-PM2 spontaneous deletion mutant, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
ctacaaaaacaagtttcagaattaactga	Protospacer
 ****** ****.************  ..

137. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP018790 (Campylobacter sp. RM6137 plasmid pSUIS6137, complete sequence) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
tttgatttagaaatttcagaattaaaaaa	Protospacer
 *  *  ** ******************.

138. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to KY554772 (Lactococcus phage AM5, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaaga	Protospacer
.*  ****. *****************..

139. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to KY554777 (Lactococcus phage LW81, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaaga	Protospacer
.*  ****. *****************..

140. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_049856 (Lactococcus phage AM4, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaaga	Protospacer
.*  ****. *****************..

141. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_027341 (Lactococcus phage WRP3, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaaga	Protospacer
.*  ****. *****************..

142. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to NC_049857 (Lactococcus phage P1048, complete genome) position: , mismatch: 7, identity: 0.759

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
tttaaaatgaaaatttcagaattaaaaga	Protospacer
 *  ****. *****************..

143. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to LT615366 (Enterococcus phage VPE25 genome assembly, chromosome: VPE25) position: , mismatch: 7, identity: 0.767

taaaacaatagtattattgctcattgtttt	CRISPR spacer
gaaaacaataatattattgctgatcctgat	Protospacer
 *********.********** **. *  *

144. spacer 2.6|1269715|30|NZ_CP007183|CRT matches to LT546030 (Enterococcus phage VPE25 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.767

taaaacaatagtattattgctcattgtttt	CRISPR spacer
gaaaacaataatattattgctgatcctgat	Protospacer
 *********.********** **. *  *

145. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_CP053838 (Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence) position: , mismatch: 7, identity: 0.767

agatccgataaaaacagaaaaagtccgaat	CRISPR spacer
agagcagataaaaacagaaaaagagaaact	Protospacer
*** * *****************   .* *

146. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_011252 (Borrelia recurrentis A1 plasmid pl23, complete sequence) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
ttttcaatacaaatttaagaattaaaatca	Protospacer
 * . *********** **********  *

147. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_011257 (Borrelia duttonii Ly plasmid pl23, complete sequence) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
tttttaatacaaatttaagaattaaaatca	Protospacer
 * . *********** **********  *

148. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to AJ630128 (Bacteriophage S-PM2 complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
ctacaaaaacaagtttcagaattaactgaa	Protospacer
 ****** ****.************  ..*

149. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_006820 (Synechococcus phage S-PM2, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
ctacaaaaacaagtttcagaattaactgaa	Protospacer
 ****** ****.************  ..*

150. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to LN828717 (Synechococcus phage S-PM2 spontaneous deletion mutant, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
ctacaaaaacaagtttcagaattaactgaa	Protospacer
 ****** ****.************  ..*

151. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to MT325768 (Psychrobacillus phage Perkons, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
tcacaaattccaatttcagaattaaataat	Protospacer
 .****** * *************** *.

152. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to KY554772 (Lactococcus phage AM5, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaagaa	Protospacer
.*  ****. *****************..*

153. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to KY554777 (Lactococcus phage LW81, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaagaa	Protospacer
.*  ****. *****************..*

154. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_049856 (Lactococcus phage AM4, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaagaa	Protospacer
.*  ****. *****************..*

155. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_027341 (Lactococcus phage WRP3, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
gtcaaaatgaaaatttcagaattaaaagaa	Protospacer
.*  ****. *****************..*

156. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_049857 (Lactococcus phage P1048, complete genome) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
tttaaaatgaaaatttcagaattaaaagaa	Protospacer
 *  ****. *****************..*

157. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NZ_CP018790 (Campylobacter sp. RM6137 plasmid pSUIS6137, complete sequence) position: , mismatch: 7, identity: 0.767

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
tttgatttagaaatttcagaattaaaaaaa	Protospacer
 *  *  ** ******************.*

158. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP021278 (Legionella pneumophila subsp. fraseri strain D-4058 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

actacatcatagaacttgtttatataaaag	CRISPR spacer
tttacattatagaacttgtttgtattacaa	Protospacer
 .*****.*************.*** * *.

159. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP015948 (Legionella pneumophila strain E2_N plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

actacatcatagaacttgtttatataaaag	CRISPR spacer
tttacattatagaacttgtttgtattacaa	Protospacer
 .*****.*************.*** * *.

160. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP015943 (Legionella pneumophila strain C9_S plasmid unamed2, complete sequence) position: , mismatch: 7, identity: 0.767

actacatcatagaacttgtttatataaaag	CRISPR spacer
tttacattatagaacttgtttgtattacaa	Protospacer
 .*****.*************.*** * *.

161. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP021276 (Legionella pneumophila strain D-4040 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

actacatcatagaacttgtttatataaaag	CRISPR spacer
tttacattatagaacttgtttgtattacaa	Protospacer
 .*****.*************.*** * *.

162. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP015952 (Legionella pneumophila strain E5_N plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

actacatcatagaacttgtttatataaaag	CRISPR spacer
tttacattatagaacttgtttgtattacaa	Protospacer
 .*****.*************.*** * *.

163. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_CP011016 (Campylobacter coli strain FB1 plasmid pCC42, complete sequence) position: , mismatch: 7, identity: 0.811

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
tctttctcgcatactcaaaatatatattaaattaata	Protospacer
..    .******************************

164. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017773 (Paenibacillus crassostreae strain LPB0068 plasmid pPC03, complete sequence) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgc----caactt	CRISPR spacer
ttgtagttcttgttgtgtttgttgcattgca----	Protospacer
 ************* ***** ****    **

165. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

166. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

167. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to MN657144 (Pedobacter sp. strain ANT_H27B plasmid pA27BH1, complete sequence) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtaggtcttgttttgttttttggtagcat	Protospacer
 ***** *************.*** .*.* *

168. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

169. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

170. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

171. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

172. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

173. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 7, identity: 0.774

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
ctgtatttcttgatttgtttcttgaaagatt	Protospacer
 **** ****** ***********  *. **

174. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP028874 (Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatactcaaaatatatattaaattaata	CRISPR spacer
aataacaacaatatatatattaaattaata	Protospacer
 ..*    *** ******************

175. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatactcaaaatatatattaaattaata	CRISPR spacer
gtcggtatcaaaaaatatattcaattaata	Protospacer
  *.   ****** ******* ********

176. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to KT895374 (Bacillus phage vB_BpuM-BpSp, complete genome) position: , mismatch: 8, identity: 0.733

cgcatactcaaaatatatattaaattaata	CRISPR spacer
atcaaactcaaaatatatactaaatggttt	Protospacer
  ** **************.***** . *

177. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP042559 (Acinetobacter baumannii strain E47 plasmid pE47_003, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatactcaaaatatatattaaattaata	CRISPR spacer
ctacaaaaaaaaatatatagtaaattaata	Protospacer
*    *   ********** **********

178. spacer 1.2|1238963|30|NZ_CP007183|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatactcaaaatatatattaaattaata	CRISPR spacer
gtcggtatcaaaaaatatattcaattaata	Protospacer
  *.   ****** ******* ********

179. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP023350 (Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
atgtccgatataaacagaaaaagtaaatt	Protospacer
* .******* *************  .

180. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP024241 (Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1) position: , mismatch: 8, identity: 0.724

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
atgtccgatataaacagaaaaagtaaatt	Protospacer
* .******* *************  .

181. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP024238 (Escherichia coli O15:H11 strain 90-9272 plasmid unnamed) position: , mismatch: 8, identity: 0.724

agatccgataaaaacagaaaaagtccgaa	CRISPR spacer
atgtccgatataaacagaaaaagtaaatt	Protospacer
* .******* *************  .

182. spacer 2.2|1269781|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP040462 (Enterococcus sp. M190262 plasmid pM190262, complete sequence) position: , mismatch: 8, identity: 0.724

agatccgataaaaacagaaaaa---gtccgaa	CRISPR spacer
cgatccgaaaaaaacagaaaaatatattt---	Protospacer
 ******* *************   .*..

183. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to KJ019094 (Synechococcus phage ACG-2014e isolate Syn7803US33, complete genome) position: , mismatch: 8, identity: 0.724

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
attcaaatacacatttcagaattcctgct	Protospacer
** ******** ***********   .

184. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to KJ019156 (Synechococcus phage ACG-2014e isolate Syn7803C2, complete genome) position: , mismatch: 8, identity: 0.724

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
attcaaatacacatttcagaattcctgct	Protospacer
** ******** ***********   .

185. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to KJ019054 (Synechococcus phage ACG-2014e isolate Syn7803C85, complete genome) position: , mismatch: 8, identity: 0.724

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
attcaaatacacatttcagaattcctgct	Protospacer
** ******** ***********   .

186. spacer 2.4|1269913|29|NZ_CP007183|CRISPRCasFinder matches to KJ019082 (Synechococcus phage ACG-2014i isolate Syn7803US120, complete genome) position: , mismatch: 8, identity: 0.724

atacaaatacaaatttcagaattaaaaag	CRISPR spacer
attcaaatacacatttcagaattcctgct	Protospacer
** ******** ***********   .

187. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017030 (Campylobacter jejuni subsp. jejuni strain 14980A plasmid pCJ14980A, complete sequence) position: , mismatch: 8, identity: 0.724

actacatcatagaacttgtttatataaaa	CRISPR spacer
gaatgatcatagaaattatttatataaat	Protospacer
.    ********* **.**********

188. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP017877 (Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence) position: , mismatch: 8, identity: 0.724

actacatcatagaacttgtttatataaaa	CRISPR spacer
gaatgatcatagaaattatttatataaat	Protospacer
.    ********* **.**********

189. spacer 2.5|1269979|29|NZ_CP007183|CRISPRCasFinder matches to NZ_CP044170 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence) position: , mismatch: 8, identity: 0.724

actacatcatagaacttgtttatataaaa	CRISPR spacer
gaatgatcatagaaattatttatataaat	Protospacer
.    ********* **.**********

190. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_CP040462 (Enterococcus sp. M190262 plasmid pM190262, complete sequence) position: , mismatch: 8, identity: 0.733

agatccgataaaaacagaaaaagtccgaat---	CRISPR spacer
cgatccgaaaaaaacagaaaaa---tatatttc	Protospacer
 ******* *************   .. **

191. spacer 2.7|1269781|30|NZ_CP007183|CRT matches to NZ_LT993739 (Chlamydia sp. H15-1957-10C plasmid II, complete sequence) position: , mismatch: 8, identity: 0.733

agatccgataaaaacagaaaaagtccgaat	CRISPR spacer
ttttttgataaaaacagaaaaagtgcaaaa	Protospacer
   *..****************** *.**

192. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP031399 (Borreliella burgdorferi strain MM1 plasmid plsm_cp9, complete sequence) position: , mismatch: 8, identity: 0.733

tctttgcaattcttccattagattaatgct	CRISPR spacer
accatgcaattcttgcaatagattaattag	Protospacer
 *. ********** ** *********

193. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NC_001904 (Borreliella burgdorferi B31 plasmid cp9, complete sequence) position: , mismatch: 8, identity: 0.733

tctttgcaattcttccattagattaatgct	CRISPR spacer
accatgcaattcttgcaatagattaattag	Protospacer
 *. ********** ** *********

194. spacer 2.8|1269847|30|NZ_CP007183|CRT matches to NZ_CP017210 (Borreliella burgdorferi strain B331 plasmid B331_cp9, complete sequence) position: , mismatch: 8, identity: 0.733

tctttgcaattcttccattagattaatgct	CRISPR spacer
accatgcaattcttgcaatagattaattag	Protospacer
 *. ********** ** *********

195. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 8, identity: 0.733

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
tgggaaatacaaatttctggattaaaaatt	Protospacer
  . ************* *.********

196. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 8, identity: 0.733

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
tgggaaatacaaatttctggattaaaaatt	Protospacer
  . ************* *.********

197. spacer 4.1|1756132|31|NZ_CP007183|CRISPRCasFinder matches to NC_019774 (Anabaena cylindrica PCC 7122 plasmid pANACY.04, complete sequence) position: , mismatch: 8, identity: 0.742

atgtagttcttgttttgtttcttgccaactt	CRISPR spacer
gttaagctcttgttttgattcttgccatagt	Protospacer
.*  **.********** *********   *

198. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to MN694139 (Marine virus AFVG_250M1132, complete genome) position: , mismatch: 9, identity: 0.7

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
taaacacttggtttcattcaaaaaaatgta	Protospacer
    ..********.*************.

199. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP048637 (Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence) position: , mismatch: 9, identity: 0.7

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
cgcatgcttgtttttattgaaaaaaattaa	Protospacer
  . ****** ******* ********

200. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP039920 (Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626c, complete sequence) position: , mismatch: 9, identity: 0.7

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
cgcatgcttgtttttattgaaaaaaattaa	Protospacer
  . ****** ******* ********

201. spacer 1.3|1239029|30|NZ_CP007183|CRT matches to NZ_CP039913 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence) position: , mismatch: 9, identity: 0.7

attttgcttggttttattcaaaaaaatgcc	CRISPR spacer
cgcatgcttgtttttattgaaaaaaattaa	Protospacer
  . ****** ******* ********

202. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to KJ019094 (Synechococcus phage ACG-2014e isolate Syn7803US33, complete genome) position: , mismatch: 9, identity: 0.7

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
attcaaatacacatttcagaattcctgctg	Protospacer
** ******** ***********   .  .

203. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to KJ019156 (Synechococcus phage ACG-2014e isolate Syn7803C2, complete genome) position: , mismatch: 9, identity: 0.7

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
attcaaatacacatttcagaattcctgctg	Protospacer
** ******** ***********   .  .

204. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to KJ019054 (Synechococcus phage ACG-2014e isolate Syn7803C85, complete genome) position: , mismatch: 9, identity: 0.7

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
attcaaatacacatttcagaattcctgctg	Protospacer
** ******** ***********   .  .

205. spacer 2.9|1269913|30|NZ_CP007183|CRT matches to KJ019082 (Synechococcus phage ACG-2014i isolate Syn7803US120, complete genome) position: , mismatch: 9, identity: 0.7

atacaaatacaaatttcagaattaaaaaga	CRISPR spacer
attcaaatacacatttcagaattcctgctg	Protospacer
** ******** ***********   .  .

206. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP017030 (Campylobacter jejuni subsp. jejuni strain 14980A plasmid pCJ14980A, complete sequence) position: , mismatch: 9, identity: 0.7

actacatcatagaacttgtttatataaaag	CRISPR spacer
gaatgatcatagaaattatttatataaata	Protospacer
.    ********* **.********** .

207. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP017877 (Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence) position: , mismatch: 9, identity: 0.7

actacatcatagaacttgtttatataaaag	CRISPR spacer
gaatgatcatagaaattatttatataaata	Protospacer
.    ********* **.********** .

208. spacer 2.10|1269979|30|NZ_CP007183|CRT matches to NZ_CP044170 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence) position: , mismatch: 9, identity: 0.7

actacatcatagaacttgtttatataaaag	CRISPR spacer
gaatgatcatagaaattatttatataaata	Protospacer
.    ********* **.********** .

209. spacer 3.1|1292855|37|NZ_CP007183|CRISPRCasFinder matches to NZ_LR215015 (Mycoplasma canis strain NCTC10146 plasmid 6) position: , mismatch: 9, identity: 0.757

ctaaaaccgcatactcaaaatatatattaaattaata	CRISPR spacer
caatatttaaatattaaaaatatatattaaattaata	Protospacer
* * * ... ***.* *********************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

347531 : 355260

Synechococcus_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002839740.1\|347531_348074_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D7XFA9	Escherichia_phage	1.4e-14	30.7
WP_002839742.1\|348077_349133_+	GDP-L-fucose synthase	A7IWS0	Paramecium_bursaria_Chlorella_virus	2.5e-68	41.4
WP_002839744.1\|349129_350161_+	GDP-mannose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	4.2e-145	73.0
WP_025443280.1\|350164_351184_+	dehydrogenase	A0A222YW25	Synechococcus_phage	4.4e-54	37.8
WP_002839748.1\|351171_351777_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.6e-14	35.1
WP_002839750.1\|351764_352448_+	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	1.1e-08	24.1
WP_025443281.1\|352419_353010_+	hypothetical protein	NA	NA	NA	NA
WP_038406335.1\|353009_353954_+	hypothetical protein	NA	NA	NA	NA
WP_002826785.1\|354582_355260_+	acylneuraminate cytidylyltransferase	E3T536	Cafeteria_roenbergensis_virus	9.3e-08	24.4

DBSCAN-SWA_2

637292 : 648706

Catovirus(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002780616.1\|637292_638246_+	ADP-glyceromanno-heptose 6-epimerase	E3SL51	Synechococcus_phage	1.1e-22	35.4
WP_002786305.1\|638238_639624_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A0K0KVL9	Prochlorococcus_phage	9.4e-23	43.1
WP_002806601.1\|639620_640181_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	4.1e-17	36.7
WP_002839073.1\|640180_640936_+	glycosyltransferase family 25 protein	M1PHE5	Moumouvirus	4.3e-14	31.3
WP_002839071.1\|640942_641896_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_002839069.1\|641954_642791_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002839068.1\|642800_643679_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	8.4e-102	62.5
WP_002839067.1\|643682_644714_+	dTDP-glucose 4,6-dehydratase	H9NC62	Sphingomonas_phage	1.1e-73	45.5
WP_002839065.1\|644710_645112_+	WxcM-like domain-containing protein	NA	NA	NA	NA
WP_002806621.1\|645101_645545_+	N-acetyltransferase	NA	NA	NA	NA
WP_002799671.1\|645545_646550_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	8.9e-07	40.0
WP_025443298.1\|646542_647607_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.1e-10	38.5
WP_002839900.1\|647611_648706_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	4.3e-39	33.1

DBSCAN-SWA_3

826049 : 833385

Campylobacter_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002841106.1\|826049_826247_-	hypothetical protein	X2KPN2	Campylobacter_phage	9.2e-25	93.8
WP_002841104.1\|826200_826584_-	DUF1374 domain-containing protein	X2KX19	Campylobacter_phage	4.1e-45	84.3
WP_002839041.1\|826815_827277_-	hypothetical protein	X2KRD2	Campylobacter_phage	2.4e-76	90.2
WP_002818612.1\|827266_827740_-	hypothetical protein	NA	NA	NA	NA
WP_002785085.1\|827736_828117_-	hypothetical protein	X2KXD5	Campylobacter_phage	3.6e-57	93.6
WP_002839040.1\|828113_828746_-	DUF4376 domain-containing protein	X2KRD7	Campylobacter_phage	2.5e-87	90.0
WP_002839038.1\|828762_829125_-	hypothetical protein	NA	NA	NA	NA
WP_025443309.1\|829126_830104_-	hypothetical protein	X2KLU0	Campylobacter_phage	7.3e-30	75.9
WP_002840969.1\|830107_831769_-	hypothetical protein	NA	NA	NA	NA
WP_002782214.1\|831771_831966_-	hypothetical protein	NA	NA	NA	NA
WP_002782213.1\|831946_832351_-	hypothetical protein	NA	NA	NA	NA
WP_002840973.1\|832350_833385_-	hypothetical protein	A0A2I7SBK1	Pseudomonas_phage	2.0e-17	30.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007184

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP007183

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection