CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_022906	Brucella ceti TE10759-12 chromosome 2, complete sequence	2 crisprs	DEDDh,csa3,cas3	0	0	0	0
NC_022905	Brucella ceti TE10759-12 chromosome 1, complete sequence	1 crisprs	WYL,csa3,DEDDh	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_022906_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022906_1

286110-286210

Orphan

Consensus_repeat	Method
GCTGCCAGCGCCAGCAATGCTGGCTGTTCCCACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022906_1

>merge|NC_022906|1|286110-286210|CRISPRCasFinder
GCTGCCAGCGCCAGCAATGCTGGCTGTTCCCACGGGCTGTTCCCACGCAGGATGCACAAGAATAACCGCTGCCAGCGCCAGCAATGCTGGCTGTTCCCACG

>NC_022906|1|1|286110-286210|CRISPRCasFinder
GCTGCCAGCGCCAGCAATGCTGGCTGTTCCCACG	GGCTGTTCCCACGCAGGATGCACAAGAATAACC
GCTGCCAGCGCCAGCAATGCTGGCTGTTCCCACG

Protein	Signature genes	Signature genes Name	Protein_function
NC_022906.1\|WP_002965637.1\|290802_291561_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187603
NC_022906.1\|WP_006175143.1\|291583_293062_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173859
NC_022906.1\|WP_002965629.1\|284524_284659_-\|50S-ribosomal-protein-L34	unknown	unknown	gnl\|CDD\|179004
NC_022906.1\|WP_002965630.1\|284659_284884_-\|hypothetical-protein	unknown	unknown	unknown
NC_022906.1\|WP_004687040.1\|280324_281215_-\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NC_022906.1\|WP_002965635.1\|288604_289291_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NC_022906.1\|WP_134792420.1\|295950_296826_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NC_022906.1\|WP_004682439.1\|284966_285311_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100007
NC_022906.1\|WP_006175148.1\|296839_298228_+\|amidase	unknown	unknown	gnl\|CDD\|235915
NC_022906.1\|WP_006161737.1\|289274_290768_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143427
NC_022906.1\|WP_032449965.1\|284049_284475_-\|ribonuclease-P-protein-component	unknown	unknown	gnl\|CDD\|234940
NC_022906.1\|WP_014489664.1\|286390_286621_+\|hypothetical-protein	unknown	unknown	unknown
NC_022906.1\|WP_002965622.1\|277581_278436_-\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	unknown	unknown	gnl\|CDD\|236996
NC_022906.1\|WP_002969378.1\|278645_279485_+\|LOG-family-protein	unknown	unknown	gnl\|CDD\|224527
NC_022906.1\|WP_002967375.1\|279546_280251_-\|pyrimidine-5'-nucleotidase	unknown	unknown	gnl\|CDD\|273917
NC_022906.1\|WP_004682426.1\|293159_294113_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_022906.1\|WP_002965640.1\|294109_294970_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_022906.1\|WP_006175139.1\|281385_282189_-\|YihA-family-ribosome-biogenesis-GTP-binding-protein	unknown	unknown	gnl\|CDD\|234770
NC_022906.1\|WP_006175142.1\|286855_288235_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NC_022906.1\|WP_006175140.1\|282230_284060_-\|membrane-protein-insertase-YidC	unknown	unknown	gnl\|CDD\|234942

Protein	Function_ID	Function_description	E-value
NC_022906.1\|WP_002965637.1\|290802_291561_+\|SDR-family-oxidoreductase	gnl\|CDD\|187603	cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR. This subgroup includes the putative Brucella melitensis biovar Abortus 2308 BKR, FabG, Mesorhizobium loti MAFF303099 FabG, and other classical SDRs. BKR, a member of the SDR family, catalyzes the NADPH-dependent reduction of acyl carrier protein in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of 4 elongation steps, which are repeated to extend the fatty acid chain thru the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I Fas utilizes one or 2 multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.61856e-141
NC_022906.1\|WP_006175143.1\|291583_293062_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173859	cd08494, PBP2_NikA_DppA_OppA_like_6, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_022906.1\|WP_002965629.1\|284524_284659_-\|50S-ribosomal-protein-L34	gnl\|CDD\|179004	PRK00399, rpmH, 50S ribosomal protein L34; Reviewed.	1.9679e-09
NC_022906.1\|WP_004687040.1\|280324_281215_-\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	2.46643e-158
NC_022906.1\|WP_002965635.1\|288604_289291_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	9.09221e-49
NC_022906.1\|WP_134792420.1\|295950_296826_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	5.06759e-114
NC_022906.1\|WP_004682439.1\|284966_285311_+\|RidA-family-protein	gnl\|CDD\|100007	cd06150, YjgF_YER057c_UK114_like_2, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	1.7316e-54
NC_022906.1\|WP_006175148.1\|296839_298228_+\|amidase	gnl\|CDD\|235915	PRK07042, PRK07042, amidase; Provisional.	0
NC_022906.1\|WP_006161737.1\|289274_290768_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143427	cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like. Uncharacterized aldehyde dehydrogenase of Saccharopolyspora spinosa (AAS00426) and other similar sequences, are present in this CD.	0
NC_022906.1\|WP_032449965.1\|284049_284475_-\|ribonuclease-P-protein-component	gnl\|CDD\|234940	PRK01313, rnpA, ribonuclease P protein component.	3.50666e-56
NC_022906.1\|WP_002965622.1\|277581_278436_-\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	gnl\|CDD\|236996	PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional.	0
NC_022906.1\|WP_002969378.1\|278645_279485_+\|LOG-family-protein	gnl\|CDD\|224527	COG1611, COG1611, Predicted Rossmann fold nucleotide-binding protein [General function prediction only].	4.29792e-62
NC_022906.1\|WP_002967375.1\|279546_280251_-\|pyrimidine-5'-nucleotidase	gnl\|CDD\|273917	TIGR01993, Suppressor_of_disruption_of_TFIIS, pyrimidine 5'-nucleotidase. This family of proteins includes the SDT1/SSM1 gene from yeast which has been shown to code for a pyrimidine (UMP/CMP) 5'nucleotidase. The family spans plants, fungi and a small number of bacteria. These enzymes are members of the haloacid dehalogenase (HAD) superfamily of hydrolases, specifically the IA subfamily (variant 3, TIGR01509).	1.17498e-95
NC_022906.1\|WP_004682426.1\|293159_294113_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.95136e-121
NC_022906.1\|WP_002965640.1\|294109_294970_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.84466e-95
NC_022906.1\|WP_006175139.1\|281385_282189_-\|YihA-family-ribosome-biogenesis-GTP-binding-protein	gnl\|CDD\|234770	PRK00454, engB, GTP-binding protein YsxC; Reviewed.	9.13107e-97
NC_022906.1\|WP_006175142.1\|286855_288235_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.40317e-57
NC_022906.1\|WP_006175140.1\|282230_284060_-\|membrane-protein-insertase-YidC	gnl\|CDD\|234942	PRK01318, PRK01318, membrane protein insertase; Provisional.	0

>NC_022906.1|WP_004682439.1|284966_285311_+|RidA-family-protein
MSIRRIEAGPRMSQAVIHGNTAYLAGQVGNPGASVTEQTKAVLAEVERLLKEVGSDKTKILQAIIWLADMKDFAEMNAVWDAWVDPAHTPARATGEAKLATPDYKVEIIITAAV
>NC_022906.1|WP_002965630.1|284659_284884_-|hypothetical-protein
MAMPTLRGLTLFSPPPIRRVTFAPAGLRTVYAVRCRVEPAPVQSMIPEDEKQFSDKIVFKRKTESRRAAHRGIK
>NC_022906.1|WP_002965629.1|284524_284659_-|50S-ribosomal-protein-L34
MKRTYQPSKIVRKRRHGFRARMATTGGRKVLAARRTRGRKRLSA
>NC_022906.1|WP_032449965.1|284049_284475_-|ribonuclease-P-protein-component
MKSKKQILRLRKRAEFLTVRNGEKRRGPLFLMEVRERTEEESNAAKTGDNPRVGFTVTKKNGNAVIRNRIRRRLKEAIRCHAGRDMAPSTDYVIVAREQALNAPFSQLTEELSRRIMAKGERRSGGKRRTERPEPGPVNGK
>NC_022906.1|WP_006175140.1|282230_284060_-|membrane-protein-insertase-YidC
MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSTGDTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPSTPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLMQPKMTEIREKYADDKMKQQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKGLFRRKPKEANK
>NC_022906.1|WP_006175139.1|281385_282189_-|YihA-family-ribosome-biogenesis-GTP-binding-protein
MGRAVDNGAHCIDACTQQNTLTGIEPLSEQDKKQAAIKAAQAAADAVREAQAALAEEGRLLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRTQELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVYVLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKLDKIKPAGVPRLLEETHKLTYKRAACFPGIIATSSEKGQGLDDLRAAIALLLKEY
>NC_022906.1|WP_004687040.1|280324_281215_-|acetylglutamate-kinase
MTTLENPEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQIQAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKTVIDPDSNIEKVLDLGFVGEPAEVDRTLLDLLARSEMIPVIAPVAPGRDGHTYNINADTFAGAIAGALAATRLLFLTDVPGVLDKDKKLIKELSVADAQALIRDGTISGGMIPKVETCIDAIRRGVEGVVILNGKTPHSVLLELFTEHGAGTLIVP
>NC_022906.1|WP_002967375.1|279546_280251_-|pyrimidine-5'-nucleotidase
MTDIPDRAAFAHVTDWVFDLDNTLYPHAANLFAQIDVKMTSYVEALLKLPRDEARKVQKQFYLEYGTTLKGLMECHQIDPDDFLQKVHDIDYTWLKPDPALGQAIKALPGRRFIFTNGDRGHAERAARRLGILDNFDDIFDIVAAGLTPKPERATYDRFLGAFGVDATRAVMFEDLARNLVVPKALGMKTVLVVPNNFEPAFSEIWESDPEFTDQVDYVTDNLTRFLEQISPDR
>NC_022906.1|WP_002969378.1|278645_279485_+|LOG-family-protein
MNPMEKSGWTPFPNSEEAVKQARTVPQTPQTEAPAYRLAFMDDEFMTRRDLRPIRLQLELLKPEMILADRGIKSTVVMFGGARIPEPGGEAWAAKNEVQKKNLQANSHYYEEARKFARLCSEYSATTYYREFIVVTGGGPGVMEAGNRGAADVGAPTIGLNIVLPHEQAPNAYVTPDLCFNFHYFAIRKMHFLMRAKAVCVFPGGFGTMDELFEAMTLIQTNRMERMPLILFGKEFWTKAINIEFLAEQGTISPADIELLNFVETADEAWGHIKDFYKL
>NC_022906.1|WP_002965622.1|277581_278436_-|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase
MTKPDLASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLKKAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTMPGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD
>NC_022906.1|WP_014489664.1|286390_286621_+|hypothetical-protein
MHSVFAGSMRRLSLWMRNLRRYWHDLACNVMGYCGQASKIPGGSAYIWVFVPGIPVRASSPAQKSKNPGQSRDFET
>NC_022906.1|WP_006175142.1|286855_288235_-|MFS-transporter
MKHKTAIQQGVSLAPDGLPRPRIYWAWATLMVGLTLAVIDGTIANVALPTIAADFSAGPAASIWIVNGYQLAIVITMLPLAALGEIYGYRRVYVAGVALFTIASIGCVFSRSLEALTLARIIQGLGAAGLMSVNTALLRYTVPQAKFGTAIGLNALFVAVSSTIGPSLAGVMLSSLSWPWLFVINIPLGIAAVLMGLRSLPDNDRSARKFDVVSAILCAVTFGLLITTIDSAGNKIGSLAVMLQALCCLLAGIWLTRRSFHMSDPLLPLDLLRIPVFTLSICTSIMSFLAQMMAFISLPFLFQTVFGFRPIEVGFLMMPWPIALALVAPLSGKLSDKYSPAILGLLGLITFSVGLALVGLLPGHPTIPDICWRMAICGIGFGLFQAPNNRMMITSTPRARSGAASGMLGTARLLGQSVGTALVAFLLSQWGVEGTPYILFLVSGFALFASVISISRLRH
>NC_022906.1|WP_002965635.1|288604_289291_+|GntR-family-transcriptional-regulator
MSAYEWRSQTRLLDEVAEALRERIYAGDYAPGAILRQEHIATEFGISRTPLREALRVLERDGLVIHLPGRGGRVASADLTRLIDAYAVREVLDGVAARFAAERASDADIAKLRAHVAGQDKVVDPWDPKAYTQSNVDFHMAVMNTAGNASLIAFVPLLRMTSQVFAPSFSLSVDRARDAIREHAAIVEAIAARDGEEAERLARAHIRATTARLEAERPHRENDNDARK
>NC_022906.1|WP_006161737.1|289274_290768_+|aldehyde-dehydrogenase-family-protein
MTQENKMGKHENKAGGASLLHYGNFIAGQWQDAVGGEHITLKNPSDGSDLALIARGAKADIDLAVVAARSALSGDWGKLTATERGRILHRISEEVLKNIDLLTDLESKDVGKPVTQARADVVALARYLEFYGASADKVHGDTLPYQNGFTVLSIYEPHGVTGHIIPWNYPMQILGRSLGAALAMGNAAVVKPAEEACLTILEFARIAEKAGLPKGALNVVTGFGAEAGAALCEHPDVNHISFTGSVRTGEVVQAAAAKNTVPVTLELGGKSPQIVFADADLDRALPFLVNAGIQNAGQTCSASSRILVERSIYEEVIARMSERYRALKVGPASADLSVGPVVSQRQKAIVDGYLDLAKESGLAIAAQGVLAEGAPEGGAYVLPTLIRDVPADHRLAQEEIFGPVQVILPFDTEEEAIAIANGTHYGLVCGIWTNDGGRQFRLAHAIHSGQVFINNYGAGGGIELPFGGVKKSGHGREKGFEALYGFASLKTISVYHG
>NC_022906.1|WP_002965637.1|290802_291561_+|SDR-family-oxidoreductase
MSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEIGDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGHKPQNAELVEPEEFDRIVGVNVRGVYLMTRKLIPHFKENGAKGQECVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMGEDSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI
>NC_022906.1|WP_006175143.1|291583_293062_+|ABC-transporter-substrate-binding-protein
MGNLLKAGLITAAMLASINGAFAKDTLVVGEVLEPPGLDPTANAAAGIRQVTYANLYEGLVRIVEDGTVKPLLAESWTISDDKKTYRFKLRQGVKFHDGTPFDCSIVKFSYERAVAPDSTNAQKGLFEPIASTECPDPATAVVTLKRPTSNFLFNMGWGDAVMVAPNSAAGNKTKPVGTGPFKFKRWVQGDRVELERNPDYWGEPAKLSAVTFRFVSDPSAADAAILAGDIDAFPMFQAPELISRFKSDDKLQVEVGDTAGKVLLSLNNAKAPFNNVKVRQALAHAIDSKALIEGTYSGFGTPIGSHYAPVDPGYVDLSQTYPYDPAKAKQMLEEAGVPAGTQITITLPPPAYARRGGEIIAAMLAEVGIQANLVPIEFAQWLDQVFKRSDFDATIIAHTEARDLDIYARDKYYFNYNSPEYKALYKAYAEAGSEEEQLKLVKALQEKLAADEPNIFLYALPKIGVWNKNVKGLWKNMPIPADDVTQAYWAE
>NC_022906.1|WP_004682426.1|293159_294113_+|ABC-transporter-permease
MLAYISGRLVSLLLTTLAASVIVFLLMQVLPGDPAAVILGINAQPETLAALHKQLGLDQPLWWRYLEWIGGFLKGDFGTSYTYSVPISELLGPRIMVTLPLALLSMVLSVAVAIPVGVYAASRRGKTGDVLSMGVAQVGVAIPNFWLGLLLILLFALQLGWFPASGFAGWEGGFWNGIRSLFLPALALALPLAAILARVTRSAVIETLGEDFVRTARAKGLTRKAALWRHAVPNALIPVVTIIGLQFSFLLAGTIIIENVFNLPGLGRLVFQAIAQRDLVTVQSLVTLLAASVIGVNFIVDLVYGFIDPRLSTGGSR
>NC_022906.1|WP_002965640.1|294109_294970_+|ABC-transporter-permease
MSEAQVLPKPGVFKTVLLSRSLLIGSLITIILVAMAVVSYVWTPYSPTAMNFRDKLQGPGLSHLFGTDNFGRDVFSMIMVGARNSIAVSIIAVLVGAGIGIPLGSLAAARGGLIDGFVMRMTDLAFAFPALLTAVIITAIFGPGAVNAMIAIGIFNIPVFARVTRGASLGLWKREYVQAARCAGRGDISITLLHVLPNINHVLIVQATIQFALAIVAEAGLSYVGLGTQPPSPSWGKMLNDAQTYIYDAPWLAIFPGLAITLAVLGLNMLGDGLRDVLDPRVRRQR
>NC_022906.1|WP_134792420.1|295950_296826_+|ABC-transporter-ATP-binding-protein
MRAVSLRPDAPTPCSIAWHIPMRAGFLQRRRMARRSYATAPPEDLALREAGQSLGIVGESGSGKSTLARAVMGLERPQSGQILINGQDIYALDRSGLREARKGFQAIFQDPYGSLDPRHTVKRIISEPIVSLERGTSARERDDRVAEVLEAVGLPKASAEKYPHEFSGGQRQRIAIARALITRPALIVADEPVSALDVSIQAQVLNLMMDLQEKFGLSYLFISHDLGVVRAITDRVAVIYRGNIVEEGPTAEVFDHPRHDYTRALVDAVPKPFSGRRKRARRLNPMNSLPE
>NC_022906.1|WP_006175148.1|296839_298228_+|amidase
MSHLADLSAVELVSSYKAKALSPVEVTEAVIGRIEAYEPKLNALWAYDPEAARLAAKASEARWAKGEPAGPIDGVPLTIKENIATKGTPVPLGCAALPLKPAAADAPPAARTREAGGVLLAKTTMPDLGMLSSGLSSFHKLARNPWDIATNPGGSSAGAGSAAAAGYGPLHIGTDIGGSVRLPAGWCGLVGLKPSFGRIPIDPPFLGRVAGPMTRTVADNALYMSVLSRPDRRDGMSLPYQDIDWMNLDIEVKGLKIGLWLDAGFGEPVEGETRAAVEAAAKLFADAGAIIEPVAPFLNRTMIDGLDRFWRARSWSDIKKMTPENQAKILPYIYQWTETAEGLSGEEAYLGFAQMDAMRNAALAASKDFDFIISPTAPMPTYPAEWASPINDPQRPFEHIAFTVAMNMSEQPAISINCGYTAKGLPIGLQIFGQRFDDLGVLRLAKAYEDMRPVQRLWPVIA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022906_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022906_2

1030976-1031093

Orphan

Consensus_repeat	Method
CGGCGGTTATAATCCGGCATTTCGCCATCTATGCCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022906_2

>merge|NC_022906|2|1030976-1031093|CRISPRCasFinder
CGGCGGTTATAATCCGGCATTTCGCCATCTATGCCCATGGCGTGCCATCCGGTCGAAGTTCAAGCGCGGCGGTTATAATCCCGGCGGTTATAATCCGGCATTTCGCCATCTATGCCCA

>NC_022906|2|2|1030976-1031093|CRISPRCasFinder
CGGCGGTTATAATCCGGCATTTCGCCATCTATGCCCA	TGGCGTGCCATCCGGTCGAAGTTCAAGCGCGGCGGTTATAATCC
CGGCGGTTATAATCCGGCATTTCGCCATCTATGCCCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_022906.1\|WP_004686845.1\|1037243_1037951_+\|type-1-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153235
NC_022906.1\|WP_002966348.1\|1028232_1029126_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|307170
NC_022906.1\|WP_002966341.1\|1022954_1023110_+\|hypothetical-protein	unknown	unknown	unknown
NC_022906.1\|WP_002966356.1\|1037996_1038461_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133413
NC_022906.1\|WP_006175749.1\|1035000_1035678_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_022906.1\|WP_006175738.1\|1023166_1023640_+\|hemerythrin-domain-containing-protein	unknown	unknown	gnl\|CDD\|376622
NC_022906.1\|WP_004688868.1\|1026252_1027215_-\|dihydrodipicolinate-synthase-family-protein	unknown	unknown	gnl\|CDD\|223406
NC_022906.1\|WP_002966361.1\|1043822_1044677_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NC_022906.1\|WP_006175736.1\|1022281_1022851_-\|cytochrome-c-oxidase-subunit-3	unknown	unknown	gnl\|CDD\|239213
NC_022906.1\|WP_002966353.1\|1034464_1034860_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|227878
NC_022906.1\|WP_004688862.1\|1041267_1042797_-\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|236211
NC_022906.1\|WP_006138797.1\|1031611_1033816_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|99798
NC_022906.1\|WP_006175752.1\|1042801_1043587_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236162
NC_022906.1\|WP_006175741.1\|1023647_1024916_-\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|225153
NC_022906.1\|WP_006641719.1\|1039803_1041045_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NC_022906.1\|WP_006175746.1\|1029408_1030584_+\|sensor-domain-containing-diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NC_022906.1\|WP_002966339.1\|1021995_1022274_-\|cytochrome-C-oxidase-subunit-IV-family-protein	unknown	unknown	gnl\|CDD\|377083
NC_022906.1\|WP_006175743.1\|1025152_1026190_+\|Ldh-family-oxidoreductase	unknown	unknown	gnl\|CDD\|224966
NC_022906.1\|WP_006175748.1\|1033826_1034297_-\|DUF2271-domain-containing-protein	unknown	unknown	gnl\|CDD\|378361
NC_022906.1\|WP_002966347.1\|1027315_1028017_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715

Protein	Function_ID	Function_description	E-value
NC_022906.1\|WP_004686845.1\|1037243_1037951_+\|type-1-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|153235	cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31). This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein. EcHsp31 has chaperone activity. Ydr533c is upregulated in response to various stress conditions along with the heat shock family. EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain. For Ydr533c a catalytic triad forms from the conserved Cys together with a different His and Glu from that of the typical GATase1domain. Ydr533c protein and EcHsp31 are homodimers.	7.71877e-105
NC_022906.1\|WP_002966348.1\|1028232_1029126_+\|DMT-family-transporter	gnl\|CDD\|307170	pfam00892, EamA, EamA-like transporter family. This family includes many hypothetical membrane proteins of unknown function. Many of the proteins contain two copies of the aligned region. The family used to be known as DUF6. Members of this family usually carry 5+5 transmembrane domains, and this domain attempts to model five of these.	8.89491e-09
NC_022906.1\|WP_002966353.1\|1034464_1034860_-\|PepSY-domain-containing-protein	gnl\|CDD\|227878	COG5591, COG5591, Uncharacterized conserved protein [Function unknown].	5.48722e-42
NC_022906.1\|WP_002966356.1\|1037996_1038461_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133413	cd04786, HTH_MerR-like_sg7, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 7) with a conserved cysteine present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	8.03311e-75
NC_022906.1\|WP_006175749.1\|1035000_1035678_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	2.0429e-80
NC_022906.1\|WP_006175738.1\|1023166_1023640_+\|hemerythrin-domain-containing-protein	gnl\|CDD\|376622	pfam01814, Hemerythrin, Hemerythrin HHE cation binding domain. Iteration of the HHE family found it to be related to Hemerythrin. It also demonstrated that what has been described as a single domain in fact consists of two cation binding domains. Members of this family occur all across nature and are involved in a variety of processes. For instance, in Nereis diversicolor hemerythrin binds Cadmium so as to protect the organism from toxicity. However Hemerythrin is classically described as Oxygen-binding through two attached Fe2+ ions. And the bacterial NorA is a regulator of response to NO, which suggests yet another set-up for its metal ligands. In Staphylococcus aureus the iron-sulfur cluster repair protein ScdA has been noted to be important when the organism switches to living in environments with low oxygen concentrations; perhaps this protein acts as an oxygen store or scavenger.	1.66776e-09
NC_022906.1\|WP_004688868.1\|1026252_1027215_-\|dihydrodipicolinate-synthase-family-protein	gnl\|CDD\|223406	COG0329, DapA, Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane].	5.56478e-80
NC_022906.1\|WP_002966361.1\|1043822_1044677_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.17568e-66
NC_022906.1\|WP_006175736.1\|1022281_1022851_-\|cytochrome-c-oxidase-subunit-3	gnl\|CDD\|239213	cd02862, NorE_like, NorE_like subfamily of heme-copper oxidase subunit III. Heme-copper oxidases include cytochrome c and ubiquinol oxidases. Alcaligenes faecalis norE is found in a gene cluster containing norCB. norCB encodes the cytochrome c and cytochrome b subunits of nitric oxide reductase (NOR). Based on this and on its similarity to subunit III of cytochrome c oxidase (CcO) and ubiquinol oxidase, NorE has been speculated to be a subunit of NOR.	1.66167e-57
NC_022906.1\|WP_004688862.1\|1041267_1042797_-\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|236211	PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated.	0
NC_022906.1\|WP_006138797.1\|1031611_1033816_-\|PepSY-domain-containing-protein	gnl\|CDD\|99798	cd06201, SiR_like2, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	2.92198e-152
NC_022906.1\|WP_006175752.1\|1042801_1043587_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236162	PRK08138, PRK08138, enoyl-CoA hydratase; Provisional.	5.49643e-164
NC_022906.1\|WP_006175741.1\|1023647_1024916_-\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|225153	COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only].	1.41061e-17
NC_022906.1\|WP_006641719.1\|1039803_1041045_-\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	2.67516e-174
NC_022906.1\|WP_006175746.1\|1029408_1030584_+\|sensor-domain-containing-diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.64545e-56
NC_022906.1\|WP_002966339.1\|1021995_1022274_-\|cytochrome-C-oxidase-subunit-IV-family-protein	gnl\|CDD\|377083	pfam03626, COX4_pro, Prokaryotic Cytochrome C oxidase subunit IV. Cytochrome c oxidase (COX) is a multi-subunit enzyme complex that catalyzes the final step of electron transfer through the respiratory chain on the mitochondrial inner membrane. This family is composed of cytochrome c oxidase subunit 4 from prokaryotes.	0.00818273
NC_022906.1\|WP_006175743.1\|1025152_1026190_+\|Ldh-family-oxidoreductase	gnl\|CDD\|224966	COG2055, COG2055, Malate/L-lactate dehydrogenases [Energy production and conversion].	1.01163e-150
NC_022906.1\|WP_006175748.1\|1033826_1034297_-\|DUF2271-domain-containing-protein	gnl\|CDD\|378361	pfam10029, DUF2271, Predicted periplasmic protein (DUF2271). This domain, found in various hypothetical bacterial proteins and misannotated lysozyme proteins, it has no known function.	9.03742e-38
NC_022906.1\|WP_002966347.1\|1027315_1028017_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	8.26449e-48

>NC_022906.1|WP_006175746.1|1029408_1030584_+|sensor-domain-containing-diguanylate-cyclase
MTSSQCFLCLILLLLFIGFAAFAIPRILVNRKVHKAIVDLKDYVSHASNQNVRMTGEVDILRAIVKRHPLEQTLTMLCRFVEKQIPGTRCSVLILDPSGKKAGKSIAPSLPTHYNKALIGLEIGPNIGSCGAAMFLRRPVIISDIATHPNWLSFRDLALPCGLRACWSMPAINGAGKVLGAFAIYSDTPRTPAQNELMVGQIAVELSMIAVDTAQTQERLASQAMHDDLTQLPNRRYIGKLLTQKKSARDGLSRDGFLLLIDLDDFKPVNDTYGHLTGDEVLKEVAQRLLRIVCEEDTVARMGGDEFMIVLNGGTSKEQTDIIASRIIREVSKPIEVSQHKPVKVGCSIGIVSTREWRSNKYIFDCADKAMYSAKSKGKNRFEYFEEKQAA
>NC_022906.1|WP_002966348.1|1028232_1029126_+|DMT-family-transporter
MPIYELAALGAATCWALTGLISAWPAGQLGALTFNRIRQVFVTGLLAVYVLATGAWHQMSAENIWPLLLSGFIGIFVGDTLLFATLNRVGPRRSGILFAMNAPMTAILGWFVLGETLSLAAVAGIAITVFGVSLAIFFGKRRTQQHPWESVKGSLWVGIGLGLLAALGQAVGSIIARPVMETGLDPFVGSLLRVGIAACCLTALAQLPLPAVKPRNPLTFKVAAMTALTGFLSLALGMTMLLFALSGGKAGIVSTISATTPVILLPLLWLRTGECPAAGAWIGAFFVVIGMALIFLR
>NC_022906.1|WP_002966347.1|1027315_1028017_-|GntR-family-transcriptional-regulator
MTESEQNPMERKRGSGVRMVYDLLRDEILDLKLAPGSPIDEVQLAERFGMSRTPIREALVRLSSEGLVETLPNRSTMVSNIDFLNMHTFFDALVLMYRVTTRLAAQYHRPEDLRIIHELQAQFTAAVDAQNALGMIATNAAFHAAIADAGRNAYFTGLFNRLLDEGRRIMRLYYQSYDDRLPRRFVEEHEEIIAAIEARDVAQADRLGKIHAEQIVEQVRKLFERKAVLDIEL
>NC_022906.1|WP_004688868.1|1026252_1027215_-|dihydrodipicolinate-synthase-family-protein
MKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSVIAAQKAHFKAILSAAPDLPAVIYNSPYYGFATRADLFFALRAEHPNLVGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
>NC_022906.1|WP_006175743.1|1025152_1026190_+|Ldh-family-oxidoreductase
MTDGTNLTIEKLHARVEEIFRKAGLNAIQAGAVARVIVAGERDHCKSHGIYRIEGALRTVKAGKVKPDAVPELVAQEASAIVRVDAKGGFANPAFELGVPVLAERARSHGLAALVINDCTHFFALWPEVEALTEKGLAGLVMCPSYATVAPTGGSKPLLGTNSFAFGWPRRDNPPYVFDFATSVAARGEIELHRRAGKQLPEGWAIDKDGKPTTDPETALEGAMLPFGGHKRSAISTMIELLAGIMIGDRTSPEVLDFLGTTTLSPVHGELIIAFSPEAFAAGRPGDPFARAEAFFEAIVGQGARLPSQRRFTARAASQSEGITLNKAEIDYLDQLAEKGLDAVS
>NC_022906.1|WP_006175741.1|1023647_1024916_-|lipopolysaccharide-biosynthesis-protein
MLAKALRKFSGDRVALLRDYLSLFSGSAGRLVVSLVYFIALANTLPTSDFGIFATASGTGVMLSRLVSLGFNSLLYRIATVKPRLLGVYTAGYLAALVVSLPLLFLASWLVYLAFFDRDVAFLPFALVVIVAEALFWRSMEIIIIVNNGLNRFLIGAGLVIFGTMTRAVAAVLFMWMTTTHDIAHWAWWYAGANAAGLIVALWFYPRIRLRFKPGLYMRRISDSIAVMGAELLFYLQSELDKLLVLGIGGPATAGLYAIIMRLVDLTALPIRSFNMMLVQKLMRTPDMLSSLRIRTGLEVAVFAISVAGLGALAIFLWIFPNALGSNVAPIVGLLPLVLLVPGFRNLIEYQTEILYARGQSGLRTLNLALMTGAKALLVWQLLSHFGESRDWLLGLNVVFAGLYILSLVFTYTSIRRPAKRI
>NC_022906.1|WP_006175738.1|1023166_1023640_+|hemerythrin-domain-containing-protein
MENLSELHAADINRLEAHHQTLLDLCLQLEEAAEDVQTPGSPQDYIKLADAIPRLLDETHELEETVLFPDFHRQSDSYFAGVVIERLKAEHRCDRLSAEELSRTLRTVANGQCKLAPDTVAYMVRGFLESLRRHILSEKLMLEALLAAKSEQREVFG
>NC_022906.1|WP_002966341.1|1022954_1023110_+|hypothetical-protein
MTDAQIGLLVAAPAIICFSLILYRMGALQGAGTISAVTASVIIAAVLFFGQ
>NC_022906.1|WP_006175736.1|1022281_1022851_-|cytochrome-c-oxidase-subunit-3
MLRSEDNAIAALAAGEGQEEEDSLLLWVLVWSELITFAILLVAFMVMSVVDPQGVGLLRAHLSPGLAATNTVILLMSGWQAALAVRRRNNPKAVRRPLLFAALFGFCFVAMKLLEYSHEARFAGDEAAGSFFELYFLITGFHLLHVLFGSVILMLVAWRPSRSNVLLIATLWHAIDLVWLVMFPILYLA
>NC_022906.1|WP_002966339.1|1021995_1022274_-|cytochrome-C-oxidase-subunit-IV-family-protein
MTDTTVHGSLNRTLAILLVLAVSGALIASFLGTYLAGIVVVLILAYAKACFVILDFMEMRGTRGALRPALLTWPAILLTLALARSVAVSLLG
>NC_022906.1|WP_006138797.1|1031611_1033816_-|PepSY-domain-containing-protein
MIRWLHRWSGIIAAVLLMVLALSGAALSVFPAMERLSAPQAETGLSVADLMARIQANYPAVEQVRRTPSGKITAYWFDDGAPQAAVIEPATGKSVAPANPNRLEQWLKGLHRSLFLGDSGRIVMAIGALIMLGLSISGAFLIARRTGGWKNWFKPLRGAASGRLHTEVARIAVLGLLLSSTTAVWMSASTFDLLPKSPVVAEPTGVSGETGMKPALIAKLEETPVSSFKELSFPYPGDATDMFVLKTDRGTGYLDQGTGAVLDWHDYTVWQRISQTVKMLHTGKGAALLGIILGLASLTVPFLGITGIVLWFAGLRGRPRIRDNAAAGKAETIVLVGSEGGSTWGFAATLHAALREAGQSVHVGPMSSFNPARYGKAQRILIFAATYGNGDAPASAKGFLDRLAALPKSPAAPLAVLGFGDRSFPDYCAFAKAIADGARAKGWKELIPFETVDRQSTQDFARWGRDLGAAIGIKLELVHQPVIPAVAALTLVSRRDYGADVQAPTAILRFALPKPTFWQQLSGAGFSRFEAGDLLGIVPEGSAVPRFYSLASGSRDGFVEIVVKKHPAGLCSGQLFELQPGDTMRAFLRRNANFHAGKGRTPLILVGAGTGIGPLAGIVRANRQHRPVHLFFGMRHPESDFFYHEDLQEWQGEGRLQNLTTACSRVHNPSYVQDALRKDAAEIARLVNKGARVMVCGGRDMAAGVSEALADILAPAGLTPAVLKAEGRYVEDVY
>NC_022906.1|WP_006175748.1|1033826_1034297_-|DUF2271-domain-containing-protein
MKSLLSALAITTALTFPGLALAQPVTLSTTLNNYGGDGAYIALYVTDAQGAYAGSLWMAGGKSKYYQHLSGWYRATGGDTAEIDGITGASVGAGRKLEITLDLADALFDTGYTLHVDAAVEDMQDSPDEIALPLTSKGSGVPVRGRRYIANFTYTK
>NC_022906.1|WP_002966353.1|1034464_1034860_-|PepSY-domain-containing-protein
MKKIILMTALIAAIAAPQAALADNDCNVPMDKWQSRDAVQQMAASLGWNVKRIKIDDGCYEIKGLNEAGKPFKAKINPQSLAIMKLKVKGMDDDRDHRRNRQQHGDAPGPLDGVPANKLIQKGSTPKVQVQ
>NC_022906.1|WP_006175749.1|1035000_1035678_+|response-regulator-transcription-factor
MRIILIEDDPILGAAVRDHIAAEGHCVDWVSRLDTAHDYMESARYDLVLLDLMLPDGQGLSFLRDLRTKGCSTPVIILTALDQISDRIQGLNAGADDYLTKPFDLSELSARLNAVARRYSGNPNPLIEIGGLQIDLAAKSVMRDGRALCLTAREWALLEAFLQHPGQTLSKAQFEEHLYSFDTEVESNTMEVHVSRLRKKLGHAIIETVRGIGYRLGNSKSKAAR
>NC_022906.1|WP_004686845.1|1037243_1037951_+|type-1-glutamine-amidotransferase-domain-containing-protein
MGKRVLHVVTNVAHYADPSQPTGLWLSELSHAHDVFAAKGYDQHIVSPKGGVSPLEPRALKWPLLDTSAKAWLADPARMALLTTTARPDQIDPADYDAIYFTGGHAVMWDFPDSQGLQNITRAIWEQGGIVSSVCHGYCGLLNTRLSDGSLLAAGKRLTGFSWMEEILAGVSSRMPYNAEQEMKRRGAHYQKAFLPFISYVVADGRLVTGQNPASAKATAEKVVALMEMRSNPLF
>NC_022906.1|WP_002966356.1|1037996_1038461_-|MerR-family-transcriptional-regulator
MKIGELAKRSGLAASRIRFYESIGLLKTVDRRSNGYRTYPEEAVLVLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALIEVLRRKVADIEALEARLARSKLQLLGLISDIEAKPDDMACADNARRVLSRLMAEEMEAPASLQDEGRPHRRTTI
>NC_022906.1|WP_006641719.1|1039803_1041045_-|CoA-transferase
MGALTGYRVLDMSRVLAGPWCGQILADLGAEVIKIERPRTGDDTRDWGPPWMKDEQGNPTREASYYQSANRGKFSVALNIASPEGQDLLRKMVAECDVLIENYKAASLAKYGLDYETLSAINPGLVYCSVTGFGQTGPRAPEPGYDFIIQGIGGLMSITGERDDKPGGGPQKVGVAVADLMTGLYSAIAIEAALLSRAKTGKGQHIDMALLDVQVAALCNQSQNYLASGRPPGRYGNAHANIVPYQVFRASDRDFIIACGNDAQFVSLCDAIGLPDLPKDPRFTRNSDRVIHRDEIIGILAAHFLTGTADEWIGRIHPRSVPVGAINDIARALDEPQVKARNMLVQIPHPLNKDFVTVGSPIKLSGTPVEYKRAAPMLGEHTDTLLQQLAKLDDDRLNDLKSRGIIEQFNSGE
>NC_022906.1|WP_004688862.1|1041267_1042797_-|3-hydroxyacyl-CoA-dehydrogenase
MERSINHIAIVGAGVMGTGIAQIAAQAGLVTQIFDAREGAAAASRDRLASTLAKLAEKGKISAEDAQTAVSRIEICSSIQELADCDLVVEAIVEKLDAKQALFLELEAVVSGNCILATNTSSLSVTSIARVCRHPERVAGFHFFNPVPLMKVVEVIDGLTTDPAVGDALLVLAKRMGHHGIRAKDMPGFIINHAGRAYGTEALKILGECVAPRGDIDRILRESAGFRMGPLELFDLTGLDVSHPVMESIYNQFYQEPRYRPSALTRQMLEGGYVGRKVGQGFYRYEDGKMVAPPVPQPVPAVDIMPSVWISADCDEDKEQLYALLRSLGATVETGALPSAEALCLLAPYGYDATTACELAGSDPARTVCIDMLPGLDRHRTLMMTPATSPAFRDAAHALLARDGVNVTVIRDSVGFVAQRTLAAIVNLACDIAQQGIATADDIDQAVRLGLGYPQGPLAWGDALGASRILKILSRMLELTGDPRYRPSPWLRRRAALGLSLRSAEPDID
>NC_022906.1|WP_006175752.1|1042801_1043587_-|enoyl-CoA-hydratase/isomerase-family-protein
MAASEDRFVSVERHADGVATVRINRPEARNALNLTTRQQLAEHFRALSGDESVRAIVLTGGETCFVAGADVREFASAGPIEMYLRHTEYLWDVIASCAKPVIAAVNGYALGGGCELAMHCDIIVAGEGAVFGQPEVKLGLMPGAGGTQRLIRAVGKFQAMRIALTGCMVPAAEALSIGMISEMTANERTLPRAHELAVEIARLPALAVAQIKEVMLVGADLPLDGALALERKAFQLLFDSKDQKEGAAAFLEKRKPAYNGR
>NC_022906.1|WP_002966361.1|1043822_1044677_+|IclR-family-transcriptional-regulator
MRSRTGSDASRRQERSAEMRKPTMLTPLEAGVEEEDRQFVTALARGLEVLRCFTPTENTLGNQEIAHKTGLPKPTVSRLTHTLVRLGYLRQDALSGLYQLDIGILRLGYAMLSNLMIRTVASPLMQVLADYAKAAVAMAARDRLSMVYLDVVQGEGNMTMRRQIGSTLPLAGSSVGRACLAAMPEDERTFILEHIREREPENWPSIRKGLDRALRDFEDYGYCLSIGEWHRDVNSVAVPLVHKQYGVLVFNCGGPSFQLPREKLEDDIGPRLIEMVHNISSAVP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_022905_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022905_1

1349860-1349942

Orphan

Consensus_repeat	Method
CCGAACACCGCTTCGCACTTTTCGGGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022905_1

>merge|NC_022905|1|1349860-1349942|CRISPRCasFinder
CCGAACACCGCTTCGCACTTTTCGGGATACAGATCTTTCCTTGCGCGCATCTTATCCGAAAACCGCTTCGCACTTTTCGGGAT

>NC_022905|1|1|1349860-1349942|CRISPRCasFinder
CCGAACACCGCTTCGCACTTTTCGGGAT	ACAGATCTTTCCTTGCGCGCATCTTAT
CCGAAAACCGCTTCGCACTTTTCGGGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_022905.1\|WP_002963797.1\|1344663_1345242_-\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|273579
NC_022905.1\|WP_006165262.1\|1347742_1348144_-\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|234744
NC_022905.1\|WP_006173966.1\|1355755_1356844_-\|porin	unknown	unknown	gnl\|CDD\|308243
NC_022905.1\|WP_002971509.1\|1353998_1354655_-\|endonuclease	unknown	unknown	gnl\|CDD\|237082
NC_022905.1\|WP_002963791.1\|1349954_1350431_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NC_022905.1\|WP_002963789.1\|1351878_1353936_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381604
NC_022905.1\|WP_006173973.1\|1340639_1341851_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031
NC_022905.1\|WP_041597578.1\|1354733_1354916_-\|hypothetical-protein	unknown	unknown	unknown
NC_022905.1\|WP_006173970.1\|1343748_1344504_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|236494
NC_022905.1\|WP_002963792.1\|1349146_1349818_+\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381681
NC_022905.1\|WP_002963803.1\|1338522_1338927_-\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NC_022905.1\|WP_006173961.1\|1361484_1361859_+\|DUF423-domain-containing-protein	unknown	unknown	gnl\|CDD\|225238
NC_022905.1\|WP_006173963.1\|1359044_1359971_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NC_022905.1\|WP_004688165.1\|1345249_1347502_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NC_022905.1\|WP_004689573.1\|1350521_1351403_-\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
NC_022905.1\|WP_002966733.1\|1338923_1339499_-\|DUF2062-domain-containing-protein	unknown	unknown	gnl\|CDD\|225757
NC_022905.1\|WP_006167160.1\|1361903_1362554_-\|hypothetical-protein	unknown	unknown	unknown
NC_022905.1\|WP_006173968.1\|1348540_1349116_+\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350235
NC_022905.1\|WP_002971501.1\|1339548_1340388_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NC_022905.1\|WP_004689567.1\|1360333_1361467_+\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|181255

Protein	Function_ID	Function_description	E-value
NC_022905.1\|WP_002963797.1\|1344663_1345242_-\|orotate-phosphoribosyltransferase	gnl\|CDD\|273579	TIGR01367, Orotate_phosphoribosyltransferase, orotate phosphoribosyltransferase, Thermus family. This model represents a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori, Mesorhizobium loti, and related species. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	2.00708e-76
NC_022905.1\|WP_006165262.1\|1347742_1348144_-\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|234744	PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed.	3.07577e-25
NC_022905.1\|WP_006173966.1\|1355755_1356844_-\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	1.047e-116
NC_022905.1\|WP_002971509.1\|1353998_1354655_-\|endonuclease	gnl\|CDD\|237082	PRK12373, PRK12373, NADH-quinone oxidoreductase subunit E.	2.3845e-28
NC_022905.1\|WP_002963791.1\|1349954_1350431_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	1.57135e-88
NC_022905.1\|WP_002963789.1\|1351878_1353936_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381604	cd13401, Slt70-like, 70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	2.60661e-60
NC_022905.1\|WP_006173973.1\|1340639_1341851_+\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.11946e-109
NC_022905.1\|WP_006173970.1\|1343748_1344504_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|236494	PRK09391, fixK, transcriptional regulator FixK; Provisional.	2.42543e-48
NC_022905.1\|WP_002963792.1\|1349146_1349818_+\|uracil-DNA-glycosylase	gnl\|CDD\|381681	cd10031, UDG-F5_TTUDGB_like, Uracil DNA glycosylase family 5, includes Thermotoga maritima TTUDGB and similar proteins. Uracil DNA glycosylase family 5 includes Thermus thermophilus HB8 TTUDGB (also called UDGb) which is not only a UDG acting on double-stranded uracil-containing DNA, but also a hypoxanthine DNA glycosylase acting on double-stranded hypoxanthine-containing DNA (except for the C/I base pair), as well as a xanthine DNA glycosylase acting on both, double-stranded and single-stranded xanthine-containing DNA. TTUDGB also excises thymine from G:T mismatched DNA, and removes analogs of uracil from DNA, including 5-hydroxymethyluracil (hmU) and 5-fluorouracil (fU). This subfamily also contains Bradyrhizobium diazoefficiens family 5 homolog Blr5068 (UdgB) which has been found to efficiently excise uracil from ssDNA and dsDNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Similar to family 4 UDGs, members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	7.75632e-104
NC_022905.1\|WP_002963803.1\|1338522_1338927_-\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	7.50792e-67
NC_022905.1\|WP_006173961.1\|1361484_1361859_+\|DUF423-domain-containing-protein	gnl\|CDD\|225238	COG2363, COG2363, Uncharacterized small membrane protein [Function unknown].	1.65119e-29
NC_022905.1\|WP_006173963.1\|1359044_1359971_+\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.40926e-42
NC_022905.1\|WP_004688165.1\|1345249_1347502_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NC_022905.1\|WP_004689573.1\|1350521_1351403_-\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	3.51802e-178
NC_022905.1\|WP_002966733.1\|1338923_1339499_-\|DUF2062-domain-containing-protein	gnl\|CDD\|225757	COG3216, COG3216, Uncharacterized protein conserved in bacteria [Function unknown].	5.43979e-83
NC_022905.1\|WP_006173968.1\|1348540_1349116_+\|NYN-domain-containing-protein	gnl\|CDD\|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.5122e-61
NC_022905.1\|WP_002971501.1\|1339548_1340388_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.72308e-33
NC_022905.1\|WP_004689567.1\|1360333_1361467_+\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|181255	PRK08153, PRK08153, pyridoxal phosphate-dependent aminotransferase.	0

>NC_022905.1|WP_002963792.1|1349146_1349818_+|uracil-DNA-glycosylase
MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDEDVRLLIVGLAPGLRGANRTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDACIVNAVRCVPPENKPVGSEINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVPVSRHPFGHGKATDIGPLRIFSSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGSARLSV
>NC_022905.1|WP_006173968.1|1348540_1349116_+|NYN-domain-containing-protein
MFDSREKIALFIDGANLYAASKTLGFDIDYRKLLKAFQKRGYLLRAYYYTALVEDQEYSSIRPLIDWLDYNGYKVVTKAAKEFTDSTGRRKVKGNMDIELTVDAKQLTDTVDHFVIFSGDGDFRSLVEALQRKGRKVSVVSTLTTQPAMISDELRRQADHFIDLVSLKAEIGRDPSERAPRRQEEDFDESY
>NC_022905.1|WP_006165262.1|1347742_1348144_-|DNA-directed-RNA-polymerase-subunit-omega
MARVTVEDCVDKVENRFELVLLAGHRARQISQGAPITVDRDNDKNPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEAAPAQIANAAEEIAEGIAEAGEEDVVTFDRMSEEELLAGIEGLVAPEKNDDF
>NC_022905.1|WP_004688165.1|1345249_1347502_-|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDPYFSHPLEVAAILTDMHLDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTKLKKLDLVSKKAVQAENLRKLLLAISEDVRVLLVKLADRLHNMRTLGVMREDKRLRIAEETMDIYAPLAGRMGMQDMREELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIETDLSEIFEKNGIKASVKSRQKKPWSVFRKMETKGLSFEQLSDIFGFRVMVDTVQDCYRALGLIHTTWSMVPGRFKDYISTPKQNDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFGVAAHSIYKDRGSANNPHKISTETNAYAWLRQTIEQLSEGDNPEEFLEHTKLELFQDQVFCFTPKGRLIALPRGATPIDFAYAVHTDIGDSCVGAKVNGRIMPLMTELKNGDEVDIIRSKAQVPPAAWESLVATGKARAAIRRATRSAVRKQYSGLGMRILERAFERAGKPFSKDILKPGLPRLARKDVEDVLAAVGRGELPSTDVVKAVYPDYQDTRVTTQNNPAKAGEKGWFNIQNAAGMIFKVPEGGEGAAAKVDPAATTPKPGKRALPIRGTNPDLPVRFAPEGAVPGDRIVGILQPGAGITIYPIQSPALTAYDDQPERWIDVRWDIDDQMSERFPARISVSAINSPGSLAEIAQIAAANDANIHNLSMVRTAPDFTEMIIDVEVWDLKHLNRIISQLKESASVSSAKRVNG
>NC_022905.1|WP_002963797.1|1344663_1345242_-|orotate-phosphoribosyltransferase
MNTDDVLAVFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADLGPIDYVVGPAIGGLIPSYETSRHLGVPSVWVERENGVFRLRRFDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIVDRSAGKADVGTRLISLAEYEVPAYPADKLPPELAAIPAVKPGSRNI
>NC_022905.1|WP_006173970.1|1343748_1344504_-|helix-turn-helix-domain-containing-protein
MVVVPFALDQNQKLAARTPCNVCEDCCVRSMAVCSALDDGDLAALEAIMTSKKLDTNEMLVEEGEPKLRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLGLADDEVYSQSAEAVVPSALCAFSAKEMERLMERFPKLKERLYQMTRLALRTARDNQLVLGRLAPVEKLASFLLVLSARAEKRGEKPNPVHLLINRTDIADYLGLTIETVSRSFTKLKTQGLIQLRDANTVEILSRRSLAVVAGLDPDNL
>NC_022905.1|WP_006173973.1|1340639_1341851_+|MFS-transporter
MSVSAAQQPSNSSADNTVLTIILATSLGHFLNDMMQSLLPAIYPILKENYSLSFWQIGLLTFTFQMTASILQPLVGIYTDRKPMPYSLTFGMGCTLIGLVFLATAHHYSFLLLGAACVGFGSSVFHPEAARVARLASGGRHGFAQSLFQVGGNFGSSIGPLLAAFIVLPFGQISVSWFSVAALIGMFVLWYVGNWYNRYRLANASKPKPDKTLPLPRNRVIASVAVLALLVFTKYIYMTSLTSYYTFYTISHFGVSVQTSQLLLFLFLGAVAAGTIIGGPIGDKIGARKVIWASILGVLPFTLALPYANLEMTAVLTIIIGLILASAFPAIIVFAQELLPGRVGMVSGLFFGFAFGMAGIAAAVLGIVADQKGIEFVYRICSYLPFLGLLTIFLPKLERRRKA
>NC_022905.1|WP_002971501.1|1339548_1340388_-|helix-turn-helix-transcriptional-regulator
MPENEDLQRFHEHRIAMLESMTGPAIALPTRYPDGYFVPRHSHSRAQLLCASQGVVLVTTDAGRWMIPSDHAMWIPAGVEHSVAILGDVFMRSIYISVDAISGVPNYLHVVGLTDLMRCLIIDATSHDSIPAPESRDGLVIELILRDLHTLPEYPLGLPFPSDPRLQKLCRDFVKKPSSRATIDEWADRMAMSRRSFTRHFQRETGVSLSVWRQQACLFAAVPRLSEGEPVTSVALDLGYDSVSAFTTMFRRMLGVPPKFYQPRLDVAPFERSDKAAFG
>NC_022905.1|WP_002966733.1|1338923_1339499_-|DUF2062-domain-containing-protein
MLFQRRYPPTRWERLRLYLWPRRSFSRSFRYGGKRILRITASPHAVAAGLAVGVFSAFTPFFGFHLIIAIVLAYFLAGNVAAAALGTTLANPLTLPFIWGSTFELGRFIMSGSVDSVPPVHLGHALETMRFEEVWTPLLKPMLFGSTILGAAFAVLVYFVTRYAVSVFRRRRLERLAEKHRLHRQRELQKA
>NC_022905.1|WP_002963803.1|1338522_1338927_-|holo-ACP-synthase
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
>NC_022905.1|WP_002963791.1|1349954_1350431_-|SsrA-binding-protein-SmpB
MNKPKNSPARKMIAENRKARFNFEILDTLEAGLVLTGTEVKSLRANQANIAESYASFEDGEFWLINSYIPEYTQGNRFNHEPRRLRKLLVSRREMSRLFNSVSREGMTVVPLKLYFNDRGRAKLELALARGKKTHDKRETEKKRDWNREKARLLRDRG
>NC_022905.1|WP_004689573.1|1350521_1351403_-|4-hydroxy-tetrahydrodipicolinate-synthase
MLKGSITALVTPFDREGAFDEKAFRAFVNWQIEEGTKGLVPVGTTGETPTLSHDEHKRVIEVCIEVAAGRVPVIAGAGSNNTVEAIELAQHAEKAGADAVLVVTPYYNKPNQRGLYEHFSRVARSISIPLVIYNIPGRSIIDMTPETMGALVRDCKNIVGVKDATGKIERVSEQRAICGKEFIQLSGEDATALGFNAHGGVGCISVTSNIAPRLCAEFQEACQAGNFAKALELQDRLMPLHKALFLEPNPSGPKYALSRLGRIENVLRSPMVTIEAATAEKIDHAMKHAGLIN
>NC_022905.1|WP_002963789.1|1351878_1353936_+|lytic-transglycosylase-domain-containing-protein
MVSLAQSSLPPEIPTPLARPFAPTATHQSPISLVTPRPRPIAPDPMATSAVSRTDNPAVIGGTLKNGLDALSAKNVASAIASRNNLPRGSLDRQILTWAIATSGMDGVPSTEIAAAASELSGWPGMATLRRNSERALFKENPSSATIIATFGSTRPQTTEGMIALARAYVATGNSTKAHQLLSPWWTRKRLSSDDEQKILKEFSAILTREDHQRRLLHSLYNGRLQSARLLAGPAQAQSLYNAYAAVAQKSPNAASAIAAVDRSWQANPVYQFLKIRYLRRAERYNEAAELLLKAPRKASVLVDPDAWWVERRILSRELLDLGKPQLAYRLAAAHAAETPTMAAEAEFHAGWYALRALNQPKLAAPHFAKITQISARPISASRAYYWLGRAAEAGSGGDARAYYRRSAHFGTTFYGQLAAAKLNEKAPELAYPKPTEAERVRFASRPAVQAIKRLEQVGYGNKAAALYTQLSQELDSVGELALLAVMAERNDNHYMALRVGKTAAMRGLDVGALSHPLGAIPASANIKGSGKALAYAIARQESEFNVSAVSKAGARGLLQLMPATAKTVATRNGMSFSAQKLTADAAYNATLGAHFLGEQLDRFNGSYVLTFAGYNAGPRRASEWVEKYGDPRGKSVEQVVDWIERIPYSETRNYVQRVMENYEVYKTRLTGRADIKTDLVYGRR
>NC_022905.1|WP_002971509.1|1353998_1354655_-|endonuclease
MPLLIVQLAILIAVAFVVGCFLGRILRRRKSAGSDHERTIVAAALSTPPLAEKPEPVPPAEPVRADSDPLKRKAGLEKARIEPVEGSADSDVAAAPVLQKVPAETPDDAGRPQWREAPRRGKADELTAIEGIGKAIEAVLHELGIFHYDQIAQWTREEAIWIERRIGFPGRVEREGWIAQAAKLAEPPAKSTTKRGAKTKKAANNVRSGTRRAKKQAG
>NC_022905.1|WP_041597578.1|1354733_1354916_-|hypothetical-protein
MTVFPIRPFLCYDYSAKGLKCLAKYYAESLMLYLVETFWSVLVLAILIGAATGWLTAGER
>NC_022905.1|WP_006173966.1|1355755_1356844_-|porin
MNIKSLLLGSAAVLVAASGAQAADAIVAPEPEAVEYVRVCDAYGAGYFYIPGTETCLRVHGYVRYDVKGGNDVYSGTDRNGWDKSARFALRVSTGSETELGTLKTFTELRFNYAANNSGVDGKYGNETSSGTVMEFAYIQLGGLRVGIDESEFHTFTGYLGDVINDDVISAGSYRTGKISYTFTGGNGFSAVIALEQGGDNDGGYTGATNCHIDGYMPDVVGGLKYAGGWGSIAGVVAYDSVIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQNYGQWGGDWAVWGGAKFIATEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTITPEVSYTKFGGEWKDTVAEDNAWGGIVRFQRSF
>NC_022905.1|WP_006173963.1|1359044_1359971_+|site-specific-integrase
MIIVGETKIDTGDKYAPIIDYNLNYISGKNPKHRLVEHYSVAELTAKYINILWDDGSHKYNVRSFLGEIDEILKGARFSGFDHEMLDSIIGTLRERGNSNATINRKMAALSKLLRKAHKMGDIFNLPEFIRQKERVGRIRFLEQEEEKRLFAAIKSRCEDSYRLSVFLVDTGCRLGEAIGLTWNDIQEQRVTFWVTKSNRSRTVPLTRRARKASHIPRERLKGPFSMLNQVRFRQIWNEAKAEVGLGADDQIVPHILRHTCASRLVRGGIDIRRVQMWLGHQTLQMTMRYAHLATHDLDSCVKVLEIH
>NC_022905.1|WP_004689567.1|1360333_1361467_+|pyridoxal-phosphate-dependent-aminotransferase
MAQPRLTPLVESLPSTVPFIGPETLELQRGKPFKARIGANESSFGPAPSVIEAMRNEATEVWKYGDPENYALRHAIAAHHGLKAEHIMPGAGVDALLGLIVRQYVQQGDKVINSLGGYPTFNYHVAGYGGQLVTVPYRDDKPDLDALIDAAAREKPALLYIANPDNPMGTWHEGADIQSFIERLPETTLLILDEAYCETAPASAFPPFETDRPNVLRMRTFSKAYGLAGIRCGYAVGNPVAIKTFDKVRDHFAVSRMAQAAAIAALKDQAYLHEVVGKICAGRDRIAAIAEANGLHAVASATNFVAIDCGRGKDFAQAVLNGLISRDIFVRKPGTPVLDRCIRVSVGVKEQLDQFEAAFPEALEEARKICAANAENT
>NC_022905.1|WP_006173961.1|1361484_1361859_+|DUF423-domain-containing-protein
MPSINGQPRSVLFGTLAGLCGALGIASYAGAAHMGESHLGTIAPLLLAHAPALLFLLLISPVSRVVRIGGAILVVGLALFCGDLFMRDMTGDRLFPFAAPTGGSLMILGWLCLGCSGWFSANAK
>NC_022905.1|WP_006167160.1|1361903_1362554_-|hypothetical-protein
MSIRTITAMAGTAFIMGAAAIAFSSPASALTVKECSTKYQAAKDAGTLGNMKWNDFRKAQCGDDAASAPAAAPAAAPATKKAAKAAAPASNDGAKSLTMKQCSAKYQAAKDAGTDNGMKWNDFRKAECGPGADPVALSTDGDSEPAAPSVAAPKGVKFPTAVSAKYSKESAGKARMHTCLDQYHALKDANALGGLKWVQKGGGYYSLCNARLKGNS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_022905_1	1.1\|1349888\|27\|NC_022905\|CRISPRCasFinder	1349888-1349914	27	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	45587-45613	5	0.815

1. spacer 1.1|1349888|27|NC_022905|CRISPRCasFinder matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

acagatctttccttgcgcgcatcttat	CRISPR spacer
tcagatctttccttgagagcatctgtt	Protospacer
 ************** * ******  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1041488 : 1049841

Brucella_phage(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004689673.1\|1041488_1043135_-	hypothetical protein	A0A141GEY6	Brucella_phage	1.3e-175	62.0
WP_023598555.1\|1043269_1044043_-	fibronectin type III domain-containing protein	A0A141GEY5	Brucella_phage	1.1e-121	96.9
WP_134792401.1\|1044043_1044801_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.8e-15	39.3
WP_004688321.1\|1045641_1045887_+	BrnT family toxin	NA	NA	NA	NA
WP_006161014.1\|1045886_1046201_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	3.4e-05	42.1
WP_002964095.1\|1046548_1046719_+	DUF1508 domain-containing protein	A0A2P1N580	Mycobacterium_phage	3.1e-05	45.1
WP_158332263.1\|1047066_1047579_-	outer membrane beta-barrel protein	O11861	Bartonella_henselae_phage	6.7e-27	37.0
WP_004683738.1\|1048012_1048600_-	hypothetical protein	NA	NA	NA	NA
WP_002964092.1\|1048622_1048898_-	hypothetical protein	NA	NA	NA	NA
WP_002964091.1\|1048894_1049125_-	hypothetical protein	NA	NA	NA	NA
WP_006072696.1\|1049121_1049841_-	hypothetical protein	A0A076GD06	Sinorhizobium_phage	4.6e-05	46.8

DBSCAN-SWA_2

1120655 : 1132582

uncultured_Mediterranean_phage(80.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080690946.1\|1120655_1122983_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.2e-51	43.5
WP_006161065.1\|1123101_1123443_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.1e-12	40.2
WP_002964020.1\|1123602_1124469_+	ATP-binding protein	NA	NA	NA	NA
WP_006174102.1\|1124517_1125816_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	1.0e-18	41.1
WP_002964018.1\|1125864_1126050_-	hypothetical protein	NA	NA	NA	NA
WP_006174100.1\|1126194_1126863_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC50	Streptomyces_phage	3.8e-14	32.4
WP_006174098.1\|1126859_1127627_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	4.4e-38	39.4
WP_002964015.1\|1127775_1129059_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.2e-104	47.2
WP_002964014.1\|1129135_1129960_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.8e-44	41.1
WP_004686803.1\|1129956_1130538_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_002964012.1\|1130648_1130867_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.5e-07	65.1
WP_002964011.1\|1131012_1131738_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.5e-43	45.7
WP_002968731.1\|1131730_1132582_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.4e-31	33.5

DBSCAN-SWA_3

1359044 : 1462962

Paenibacillus_phage(13.04%)

portal,tail,holin,transposase,integrase,protease

attL 1354573:1354589|attR 1437574:1437590

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1354573:1354589	attL	NA	NA	NA	NA
WP_006173963.1\|1359044_1359971_+\|integrase	site-specific integrase	A0A076YL28	Mesorhizobium_phage	2.2e-28	36.3
WP_004689567.1\|1360333_1361467_+	pyridoxal phosphate-dependent aminotransferase	A0A1X7QHI1	Faustovirus	1.8e-16	24.2
WP_006173961.1\|1361484_1361859_+	DUF423 domain-containing protein	NA	NA	NA	NA
WP_006167160.1\|1361903_1362554_-	hypothetical protein	NA	NA	NA	NA
WP_155116023.1\|1362877_1363153_+	hypothetical protein	NA	NA	NA	NA
WP_004683355.1\|1363212_1363983_+	YitT family protein	NA	NA	NA	NA
WP_004683353.1\|1364042_1364300_-	sel1 repeat family protein	NA	NA	NA	NA
WP_004686532.1\|1364569_1364809_+	hypothetical protein	NA	NA	NA	NA
WP_006173958.1\|1364805_1365153_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_006173952.1\|1365211_1365922_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_006173950.1\|1367290_1368259_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_006173949.1\|1368374_1370066_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_002963769.1\|1370454_1371327_+	uracil-DNA glycosylase	NA	NA	NA	NA
WP_002970986.1\|1371488_1372745_+	MFS transporter	NA	NA	NA	NA
WP_006173948.1\|1372749_1373709_-	DMT family transporter	NA	NA	NA	NA
WP_006173946.1\|1373934_1376586_+	aminopeptidase N	NA	NA	NA	NA
WP_006173944.1\|1376976_1379328_+	PAS-domain containing protein	A0A1V0SGX0	Hokovirus	6.3e-27	34.8
WP_006173942.1\|1379598_1381710_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_006173941.1\|1381754_1384706_-	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_006173939.1\|1384828_1386235_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002963761.1\|1386231_1386939_-	response regulator transcription factor	NA	NA	NA	NA
WP_002963760.1\|1387032_1388574_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.7e-28	29.8
WP_004689556.1\|1388715_1389192_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_006173938.1\|1389188_1391180_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_002963757.1\|1391199_1391697_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_006160790.1\|1391693_1392833_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_002971524.1\|1392934_1393387_-	hypothetical protein	NA	NA	NA	NA
WP_023598561.1\|1393480_1394791_-	sensor histidine kinase	NA	NA	NA	NA
WP_004689554.1\|1394865_1395555_-	response regulator transcription factor	NA	NA	NA	NA
WP_002971526.1\|1395633_1395930_-	hypothetical protein	NA	NA	NA	NA
WP_002969445.1\|1396091_1396298_-	hypothetical protein	NA	NA	NA	NA
WP_006173936.1\|1396362_1399020_-\|tail	glycoside hydrolase/phage tail family protein	A0A0B5A7K5	Paracoccus_phage	9.2e-144	35.4
WP_006173935.1\|1399016_1400225_-	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	1.6e-58	38.7
WP_004683307.1\|1400228_1400663_-	C40 family peptidase	NA	NA	NA	NA
WP_004688133.1\|1400659_1401535_-	DUF2163 domain-containing protein	A0A0K1Y6Z2	Rhodobacter_phage	3.5e-47	38.9
WP_006160785.1\|1401531_1402164_-	TIGR02217 family protein	A0A0K1Y6G4	Rhodobacter_phage	1.1e-47	50.9
WP_002970984.1\|1402166_1402712_-\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	2.8e-07	46.4
WP_002963745.1\|1402716_1402887_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_004688130.1\|1402930_1403272_-	gene transfer agent family protein	NA	NA	NA	NA
WP_002963743.1\|1403268_1403682_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_002967499.1\|1403745_1404123_-	hypothetical protein	NA	NA	NA	NA
WP_006173916.1\|1404119_1405313_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.0e-65	39.7
WP_005969588.1\|1405344_1406604_-	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	1.3e-71	40.6
WP_002963734.1\|1406542_1407055_-	hypothetical protein	NA	NA	NA	NA
WP_002963732.1\|1409595_1410207_+	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_002963731.1\|1410199_1410742_+	hypothetical protein	NA	NA	NA	NA
WP_134790775.1\|1410811_1411568_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_006160775.1\|1411783_1412860_+	DUF2336 domain-containing protein	NA	NA	NA	NA
WP_002963729.1\|1412870_1413218_-	DUF1491 family protein	NA	NA	NA	NA
WP_002971535.1\|1413231_1414200_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_004691943.1\|1414174_1416004_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.3e-23	29.3
WP_004688118.1\|1416294_1416744_+	hypothetical protein	NA	NA	NA	NA
WP_006173909.1\|1416823_1417249_+	SufE family protein	NA	NA	NA	NA
WP_006173907.1\|1417289_1418627_-	amidase	NA	NA	NA	NA
WP_006173905.1\|1418739_1419513_-	hypothetical protein	NA	NA	NA	NA
WP_006173903.1\|1419509_1419965_-	hypothetical protein	NA	NA	NA	NA
WP_002969861.1\|1420146_1420458_+	hypothetical protein	NA	NA	NA	NA
WP_004688116.1\|1420665_1421094_-	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.0e-20	47.6
WP_006173900.1\|1421665_1423774_+	S9 family peptidase	NA	NA	NA	NA
WP_002963717.1\|1423891_1424227_+	hypothetical protein	NA	NA	NA	NA
WP_004689540.1\|1424398_1424998_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	6.9e-39	42.6
WP_002963715.1\|1425228_1425882_+	haloacid dehalogenase type II	NA	NA	NA	NA
WP_002971536.1\|1425883_1426126_-	hypothetical protein	NA	NA	NA	NA
WP_006173896.1\|1426184_1426901_+	L,D-transpeptidase	NA	NA	NA	NA
WP_006173894.1\|1427106_1428618_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	3.0e-83	44.3
WP_006173889.1\|1428998_1429361_+	hypothetical protein	NA	NA	NA	NA
WP_006160766.1\|1429417_1430728_-	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_002963710.1\|1430724_1431402_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_006173886.1\|1431557_1432550_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002963708.1\|1432610_1432841_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_002963707.1\|1432837_1433227_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	3.5e-07	44.6
WP_002967489.1\|1433223_1433694_-	GreA/GreB family elongation factor	NA	NA	NA	NA
WP_002963705.1\|1433738_1434761_-	asparaginase	NA	NA	NA	NA
WP_004688107.1\|1434951_1435548_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_023598563.1\|1435550_1437200_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	7.9e-61	32.2
WP_002963701.1\|1437369_1438833_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
1437574:1437590	attR	NA	NA	NA	NA
WP_186813188.1\|1439402_1440443_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004688104.1\|1440704_1441736_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004688103.1\|1441768_1443220_+	xylulokinase	NA	NA	NA	NA
WP_002966715.1\|1443266_1444574_+	xylose isomerase	NA	NA	NA	NA
WP_006173877.1\|1444615_1445788_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_004688100.1\|1445795_1446848_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_006160755.1\|1446905_1447868_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_006173869.1\|1447946_1448936_-	ABC transporter permease	NA	NA	NA	NA
WP_006173867.1\|1448956_1450525_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-14	24.9
WP_109790518.1\|1450631_1450835_-	hypothetical protein	NA	NA	NA	NA
WP_002969456.1\|1451183_1452293_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002963690.1\|1452375_1453548_-	AGE family epimerase/isomerase	NA	NA	NA	NA
WP_006641153.1\|1453580_1455005_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	4.0e-53	31.0
WP_002975117.1\|1457059_1457377_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_094283805.1\|1457273_1458037_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.1e-20	39.2
WP_005969645.1\|1458200_1458755_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.9e-12	33.9
WP_077281774.1\|1458797_1458950_+	hypothetical protein	NA	NA	NA	NA
WP_002963682.1\|1459707_1460826_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_134790775.1\|1461196_1461954_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_029669663.1\|1462023_1462962_-\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_022906

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_022905

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection