CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP003949	Rhodococcus opacus PD630, complete genome	1 crisprs	csa3,cas3,WYL,DEDDh,Cas14u_CAS-V,c2c10_CAS-V-U3,casR,RT,cas4,Cas9_archaeal,DinG,c2c9_V-U4	0	1	0	0
NZ_CP003958	Rhodococcus opacus PD630 plasmid 9, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003950	Rhodococcus opacus PD630 plasmid 1, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003953	Rhodococcus opacus PD630 plasmid 4, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003952	Rhodococcus opacus PD630 plasmid 3, complete sequence	0 crisprs	PD-DExK,DEDDh	0	0	0	0
NZ_CP003956	Rhodococcus opacus PD630 plasmid 7, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003957	Rhodococcus opacus PD630 plasmid 8, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003954	Rhodococcus opacus PD630 plasmid 5, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003955	Rhodococcus opacus PD630 plasmid 6, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP003951	Rhodococcus opacus PD630 plasmid 2, complete sequence	0 crisprs	NA	0	0	0	0

1. NZ_CP003949

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP003949_1

• CRISPR_ID: NZ_CP003949_1
• CRISPR_location: 38362-38443
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NZ_CP003949_1

Consensus_repeat	Method
CGTACGCCTGCTGGCCGTAACCGCCCTG	CRISPRCasFinder

spacers of NZ_CP003949_1

>1.1|38390|26|NZ_CP003949|CRISPRCasFinder
GTCGTAGTCGGCGTAGCCCTGCTGGT

CRISPR arrays and Neighbor proteins around NZ_CP003949_1

CRISPR arrays

The CRISPR arrays of NZ_CP003949_1

>merge|NZ_CP003949|1|38362-38443|CRISPRCasFinder
CGTACGCCTGCTGGCCGTAACCGCCCTGGTCGTAGTCGGCGTAGCCCTGCTGGTCGTACGCCTGCTGGTCGTAACCGCCCTG

>NZ_CP003949|1|1|38362-38443|CRISPRCasFinder
CGTACGCCTGCTGGCCGTAACCGCCCTG	GTCGTAGTCGGCGTAGCCCTGCTGGT
CGTACGCCTGCTGGTCGTAACCGCCCTG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP003949.1|WP_005249070.1|40436_41090_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP003949.1|WP_005249077.1|32931_34419_-|penicillin-binding-protein-2	unknown	unknown	gnl|CDD|223839
NZ_CP003949.1|WP_005249065.1|43227_44220_-|IS3-family-transposase	unknown	unknown	gnl|CDD|366234
NZ_CP003949.1|WP_005249073.1|37782_38103_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP003949.1|WP_005249075.1|35869_37342_-|serine/threonine-protein-phosphatase	unknown	unknown	gnl|CDD|223704
NZ_CP003949.1|WP_025431552.1|42756_43164_+|SRPBCC-family-protein	unknown	unknown	gnl|CDD|176874
NZ_CP003949.1|WP_025431553.1|45581_46250_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP003949.1|WP_005249076.1|34415_35870_-|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl|CDD|223843
NZ_CP003949.1|WP_025431551.1|31543_32929_-|serine/threonine-protein-kinase	unknown	unknown	gnl|CDD|270916
NZ_CP003949.1|WP_005249079.1|29627_31547_-|serine/threonine-protein-kinase	unknown	unknown	gnl|CDD|270916
NZ_CP003949.1|WP_005249062.1|44817_45585_-|hypothetical-protein	unknown	unknown	gnl|CDD|131023
NZ_CP003949.1|WP_005249069.1|41086_41548_+|RDD-family-protein	unknown	unknown	gnl|CDD|377640
NZ_CP003949.1|WP_005249082.1|27774_28038_-|cell-division-protein-CrgA	unknown	unknown	gnl|CDD|178907
NZ_CP003949.1|WP_005249068.1|41588_42272_+|AraC-family-transcriptional-regulator	unknown	unknown	gnl|CDD|378964
NZ_CP003949.1|WP_005249064.1|44241_44538_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP003949.1|WP_005249071.1|39986_40382_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP003949.1|WP_005249081.1|28157_28859_+|DUF881-domain-containing-protein	unknown	unknown	gnl|CDD|377575
NZ_CP003949.1|WP_043943620.1|42261_42708_-|glyoxalase	unknown	unknown	gnl|CDD|319901
NZ_CP003949.1|WP_005249074.1|37338_37803_-|membrane-protein	unknown	unknown	gnl|CDD|224630
NZ_CP003949.1|WP_005249080.1|28913_29567_+|aminodeoxychorismate/anthranilate-synthase-component-II	unknown	unknown	gnl|CDD|181107

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP003949.1|WP_005249065.1|43227_44220_-|IS3-family-transposase	gnl|CDD|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	4.17269e-24
NZ_CP003949.1|WP_005249075.1|35869_37342_-|serine/threonine-protein-phosphatase	gnl|CDD|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	1.54854e-80
NZ_CP003949.1|WP_025431552.1|42756_43164_+|SRPBCC-family-protein	gnl|CDD|176874	cd08865, SRPBCC_10, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	0.000221095
NZ_CP003949.1|WP_005249076.1|34415_35870_-|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl|CDD|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	1.04166e-88
NZ_CP003949.1|WP_025431551.1|31543_32929_-|serine/threonine-protein-kinase	gnl|CDD|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.53127e-119
NZ_CP003949.1|WP_005249079.1|29627_31547_-|serine/threonine-protein-kinase	gnl|CDD|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.15719e-128
NZ_CP003949.1|WP_005249062.1|44817_45585_-|hypothetical-protein	gnl|CDD|131023	TIGR01968, Septum_site-determining_protein_MinD, septum site-determining protein MinD. This model describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model. [Cellular processes, Cell division].	0.00488841
NZ_CP003949.1|WP_005249069.1|41086_41548_+|RDD-family-protein	gnl|CDD|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	2.35534e-15
NZ_CP003949.1|WP_005249082.1|27774_28038_-|cell-division-protein-CrgA	gnl|CDD|178907	PRK00159, PRK00159, putative septation inhibitor protein; Reviewed.	9.93822e-50
NZ_CP003949.1|WP_005249068.1|41588_42272_+|AraC-family-transcriptional-regulator	gnl|CDD|378964	pfam12833, HTH_18, Helix-turn-helix domain.	2.56498e-12
NZ_CP003949.1|WP_005249077.1|32931_34419_-|penicillin-binding-protein-2	gnl|CDD|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	6.49606e-94
NZ_CP003949.1|WP_005249081.1|28157_28859_+|DUF881-domain-containing-protein	gnl|CDD|377575	pfam05949, DUF881, Bacterial protein of unknown function (DUF881). This family consists of a series of hypothetical bacterial proteins. One of the family members YlxW from Bacillus subtilis is thought to be involved in cell division and sporulation.	2.96009e-53
NZ_CP003949.1|WP_043943620.1|42261_42708_-|glyoxalase	gnl|CDD|319901	cd07235, MRD, Mitomycin C resistance protein (MRD). Mitomycin C (MC) is a naturally occurring antibiotic, and antitumor agent used in the treatment of cancer. Its antitumor activity is exerted primarily through monofunctional and bifunctional alkylation of DNA. MRD binds to MC and functions as a component of the MC exporting system. MC is bound to MRD by a stacking interaction between a His and a Trp. MRD adopts a structural fold similar to bleomycin resistance protein, glyoxalase I, and extradiol dioxygenases; and it has binding sites at an identical location to binding sites in these evolutionarily related enzymes.	6.35443e-57
NZ_CP003949.1|WP_005249074.1|37338_37803_-|membrane-protein	gnl|CDD|224630	COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms].	6.50815e-24
NZ_CP003949.1|WP_005249080.1|28913_29567_+|aminodeoxychorismate/anthranilate-synthase-component-II	gnl|CDD|181107	PRK07765, PRK07765, aminodeoxychorismate/anthranilate synthase component II.	4.36321e-149

Protein sequences

>NZ_CP003949.1|WP_005249073.1|37782_38103_+|hypothetical-protein
MQNQTLHGSPPPSVAGTFEVPASFSGSIIGATRTLRSGYGQPTTIRSPHRVTSDTGSDAVSVQYRSRLGCVSVREFGIGYRRFLLGVLIRWSLRGFGPGSPNDLPG
>NZ_CP003949.1|WP_005249074.1|37338_37803_-|membrane-protein
MQGLILQLTRAGFLLLLWLFVWTVLRALRGDIYAGSGVRVPPRYSRSGNVLPSLGKTKTAKYLVVTQGGLAGTRITLGTQPVLIGRADDSTLVLTDDYASTRHARLSPRGADWYVEDLGSTNGTYLDRAKVTTSVRVPLGTPVRVGKTVIELRP
>NZ_CP003949.1|WP_005249075.1|35869_37342_-|serine/threonine-protein-phosphatase
MTLVLRYAARSDRGLVRSNNEDSVYAGARLLALADGMGGHAAGEVASQLMIAALAHLDDDEPGEDLLGKLEAATREGNDSIADHVEEDPELDGMGTTLTAILFSGNKLGLVHIGDSRAYLLRDDSLAQITRDDTFVQSLVDEGRITAEQAHTHPQRSLIMRALTGNEIEPTLTVREARAGDRYLLCSDGLSDVVSDETIENTMREGSQDECADRLIELALRSGGPDNVTVVVADVIDLDYGQSHPIVAGAASADDEEDTPPPNTAAGRAAAMRPPRATPKRVVPQVEEPPTKKKRHRMWWAALALGLIVVVAVAAFVGRALVRDNYYVGADGERVTVLRGVPGSVLGYSLQEANLVGCVSDAGELTLMSPTESPNGCTILEVDDLQPSAREQVRAGLPSGKLDDVRNQMTRLAQNDLLPVCESESSTTTTTTTPAPTPAPVPETTPPPAPAPVPPAEVPPAPGPTTPPTPTATPAPTVTQIPGQNCRTAS
>NZ_CP003949.1|WP_005249076.1|34415_35870_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MSVASASPGAQFPSPPGGFAPAPVQSTRRGTELILIGFAILITTISLVLVEASQEQSITWDLAKYAAAYSALFLIAHLAVRRFAPYADPLILPIVALLNGLGLVLIHRLDLADAQSAAYFGLPVPSPDANQQVLWTTLAIAGFVAVLVLLKDYRLLARYSYTLGLAGLVFLAIPAILPSSFSEVNGAKIWIRLPGFSIQPGEFAKILLIIFFASVLVAKRDLFTTAGKHVFGIDLPRARDLGPILLAWMVSVGVLVLEKDLGTSLLLFSTVLVMLYIATERVGWLLIGAGLLGIGFFFAYQLFGHVRVRVSTWLDPLADYNNTGYQISQSLFGLATGGVAGTGLGSGRPAQVPFAKTDFIVATIGEELGLIGLAAVLMLFLILVIRGLRTALAVRDSFGKLLAAGLSFTIAVQVFVVVGGVTKLIPLTGLTTPFMSYGGSSLLANYLLLAILIKISDAAREPAVPKKKGPAPIADAPTEMVPRS
>NZ_CP003949.1|WP_005249077.1|32931_34419_-|penicillin-binding-protein-2
MNTPLRRVAIAVMVMVVALLANATYVQVIKADNLRADPRNSRVLLDEYSRQRGQISAAGQVLAASVPTDDRYKYLRTYPPNPAAPSSPLANAPVTGFYSMQYGSTGLERTEDPVLNGSDNRLFGRRFFDLVSGRDPRGGNVVTTINPVMQQVAYDELTAKGYTGSVVAIEPSTGRILTMVSTPSYDPNSLASHDGTETTQAWEALNADPEKPLINRAVSQTYPPGSTFKVVVTAAALAAGTTPDTQLTAAPQITLPGTSTTLENYNGSTCGGAPTASLREAFARSCNTAFVELGVKTGTDAVSDESSALGIGGQMPGVPFPVADSTIGSIPDDAALGQSSIGQRDVALTPLQNAMIAATVANGGVRMQPQLVSELQGPDLSNLATTNPVSEGQAMSSQVAATLTDLMIGSENNTSGEGKIPGVQIASKTGTAEHGTDPRNTPPHAWYIGFAPAQNPTVAIAVIVEDGGDRALAATGGSVAAPIGRAVIAAGLQGG
>NZ_CP003949.1|WP_025431551.1|31543_32929_-|serine/threonine-protein-kinase
MALNNGALIANRYRLIRLIATGGMGQVWEATDNRLNRRVAVKVLKSEFSSDPEFVERFRFEARTTAQLNHSGIAGIYDYGEVRDATGDSTAYLVMELVNGEPLNAVLARVGRLAVPHALDMLEQTGRALQVAHDAGVVHRDVKPGNILITPTGQVKITDFGIAKAVENSPVTRTGMVMGTAQYIAPEQALGQDATAASDVYSLGIVGYEALSGRRPFVGDGAITVAMKHVQEAPAPLPSDLPPNIRELIDITITKDPSTRYASGGEFADAVAAVRAGRRPPPPGMSGTGSGRVLPPPMTGATQMMPPSQTAYAGPVTGQVPPDDSNGNGKKGGLTSGQKAVAWGAGGLLVLAAIIALALVLFDGGDTKEPTSPAITSSLRTITTTPRPTTTTTTEEPTTTTEPPYTTTTTQPYTTTTTQPPTTTTTEPTTTTTTTTTTAPTTTTTTTTSEESTTPTPQGLP
>NZ_CP003949.1|WP_005249079.1|29627_31547_-|serine/threonine-protein-kinase
MTTPRNLSSRYELGEILGFGGMSEVHLARDVRLSRDVAIKVLRADLARDPTFYLRFRREAQNAAALNHPAIVAVYDTGEAETDAGPLPYIVMEYVDGDTLRDIVRSEGPMAPRRAMEVISDVCAALDFSHRNGIVHRDVKPANVMINRAGAVKVMDFGIARAISDASSPMTQTAAVIGTAQYLSPEQARGEQVDARSDVYSLGCVLFEILTGEPPFKGDSPVAVAYQHVREDPQTPSVVNPDIPRELDSVILKAMSKNPANRYQTAADMRSDLVRVLGGQRPSAPMVMSDEDRTTILGAVDSGAGNYRRPQSPTPATASKTDGGEPDKKKNPMRVALMALGALIVVGIVGAFLWSVGPGSKADQVTMPDVTNQAADDAETTLQNLGFRVARQQKPDAVVATGNVITTRPVGGVQVDEGSTITLEVSSGPEQVKVPRLAGLTQQEAQQELNAVGLRLDTAVARAPSDVSDIDKVIEQNPSSGASISLDSEVAVTLGTGPEQIRIPDVTGQKVEVAQANIEGAGFKVQIQNIDSGVPKGQVVSTDPVGGSTAAKGDTIQIRVSNGNNIEMPDLTGKTVSQALAELRSAGWSGSSSSINQTQTSTLDPEMVGKIISQEQPPGSEITKNGVVSVGVGALGIPR
>NZ_CP003949.1|WP_005249080.1|28913_29567_+|aminodeoxychorismate/anthranilate-synthase-component-II
MRILVVDNYDSFVFNLVQYLGQLGTRAVVWRNDDPNLTGPDAVAAAAAEFDGILLSPGPGTPQRAGATMDLVTACAAAETPLLGVCLGHQAIGAAFGATVDRAPELLHGKTSVVHHTGEGVLAGLPDPFTATRYHSLTVLEDTIPDELEVTAHTDSGIVMAMRHRELPIHGVQFHPESVLTEGGHRMLANWLTVCGEAPTESLIATLETEVAQALGA
>NZ_CP003949.1|WP_005249081.1|28157_28859_+|DUF881-domain-containing-protein
MTRSIFWRIAVLVVCLVAGLLVATTRQVSHGNEIRAGDSTRLSDLVRNAQSETDQVADTRDQLAAQVESLQQEAAASDSGVAQALADTKALATDAGLTPMTGPGVTVTLTDAPRDADGKYPVDASPDDLVVHQQDVQSVLNALWVGGAEAISMQDQRIVNTSAPRCIGNTLLLHGRTYSPPYVMSAIGDPARLEAALANEPGIRVFKQYASRFGLGYSEAASGQLTVPGYAGH
>NZ_CP003949.1|WP_005249082.1|27774_28038_-|cell-division-protein-CrgA
MPKSKVRKKTDYTINPASRTPVKVKAGPSSTLYVSVMLGFMLVGLVWLLVYYLAADQLEWMNNLGAYNFLIGFGFMVVGLIMTMRWR
>NZ_CP003949.1|WP_005249071.1|39986_40382_+|hypothetical-protein
MSISQVRATSSANVGEYVGSVATTVGALSVDWWCTPAFDAVVTLSCEIPYYRGRKAVLAWNRHFGWSLGVHGLTQGNVLVVEGLGLGPAPDPARCSDRVAELIAELADWAPRPASGQPAPRIVHGPGAPRG
>NZ_CP003949.1|WP_005249070.1|40436_41090_+|hypothetical-protein
MDGRKAPDPLRLAAGVAATAGGALQRVIGFGVDTARVLPGVDPLLVALEERGTQTLRNADELADRLLHAVLRRIVQVALQEVDLTAIVRDHVDLDVVAEGIDIQRIIDRVDVDAIAARIDIPQILDRVDIDAVAARVDVGAIVDRVDVDSVIGRVDLVVLADTVIEGVDLPRIIRESTDSMSNEAVRGVRTQGMQADDAVAGFVGKLFGRAHEPGDA
>NZ_CP003949.1|WP_005249069.1|41086_41548_+|RDD-family-protein
MSAPAHRSAGIVTRGLACGIDLGVVLAVMGGIYVGALFLRLLFSPQEFSFPDANAVLSATLFVGVAVLYLTACWSVSGRTVGAVTMGLRVVSRNGELIGWLRAFVRAVLCVMFGFGLLWAAVDGRRRSLQDILLRTAVVYDWEPDLHPGEPEI
>NZ_CP003949.1|WP_005249068.1|41588_42272_+|AraC-family-transcriptional-regulator
MYTERRSVFPGAVVWQKTAAGGEAAILPDGCMDLIWMNGDVVVAGPDSRPYLTRSREGDRYVGLRCSPGILPDLLGVPAEELTNLRVPLAELLTDRATREFLGRIADDAEPGRALEEFARSRRLLGPPPDSRIPAIARLLEQQTSVREVADRIGVGERQLHRLCRRQFGYGPKMLARILRLQSALGLADSSIPAAQAAGMAGFADQAHLIREAHELTGRTFGQLVTV
>NZ_CP003949.1|WP_043943620.1|42261_42708_-|glyoxalase
MSETFNAGPPEIVSVLDMTATFSAIELVVHDLPTSLAFYRRLGLDIPADADQAPHVEFEFPGGVRLLWDTVETIRSFTPDWTEPTGGHRIGLAFDCGTAADVDTLFDEFTGDGYTGRTKPWDAPWGQRYATVDDPDGNPVDLFAALTP
>NZ_CP003949.1|WP_025431552.1|42756_43164_+|SRPBCC-family-protein
MLGVMTTESTHVSVFIARTAADVYAYASDPANLPAWASGLSTNITRDGDRWLADSPMGQVAVTFAPANDYGVLDHDVTLPSGDTVYNPVRVIPDGDHSEVVFTIRRRDGVTADEFAQDAAAVNADLQRLKGLLEA
>NZ_CP003949.1|WP_005249065.1|43227_44220_-|IS3-family-transposase
MQAGIHVARASALLGLARSSYNRLAHNYQHYQPVERPIPHTDRSQPAALSETERRVIIDLILAEENSDRSVVQTYWRSFDEGLVACSERTFYRVARSQNLTGDRRRTRRGGSNARPKPVVATAQVGQLWSWDITMLQGPRKQDRYLLYLAIDVFSRYPVAWRIEYAETTQMAVQMFLAAFEKYGVPLVLHADNGASMRSTGLLDALESAGVSASYSRPRVSDDNPFSESLFKTLKYDSSCPERFDDIGHAREWTEQFLHRYANEHRHGGLSRHTPAAVFFGTAAAIRRYRQDRLDRIWTEHPERFRRRPQAPELPQLTGINIKHDLSQAG
>NZ_CP003949.1|WP_005249064.1|44241_44538_-|hypothetical-protein
MKARDRGEFTAAMVTAAEKSRSRRMNSRERAEVAKLRAENERLKEKVVQAEAAQQILGKAFELLQGITERSTEDTTEIPPALMSASEYAQWLERRKLS
>NZ_CP003949.1|WP_005249062.1|44817_45585_-|hypothetical-protein
MTDQLLQALPVSTLVLGACGGAGATTTTLGLANTAAARGGAVVAVDATPAGGDVAERGADAVLSVSGLEQLVAAGPVADDVFDGYCSRTSVGTRILNRIGNQTASEREFHTLTGSLRARGVSAVHDLGHRLRAAYLAPLLATPSPIVLVVPCRADAFNRLRSALQSIGDTLGEPGLARTVVTVSNQDATGWQVDIDLLREYLGGQVWGIETIPYDEHLGMGIVIDHSKLAPDTRAAYERVSAAASAIAEGRPERV
>NZ_CP003949.1|WP_025431553.1|45581_46250_-|hypothetical-protein
MTEPPNRAPLDRFSHWFPPFASAPAPRSTAPAAETEQQPPAPTWLTPGDEPDPTPPVRGNQRLVVAGAAAAVIAVLAGVVAVIASTSGDASGTPVAAADSGWCVESRDGSTVTGNGPGGTSDGVAAILGFDHAYYVARSGAKAREVVAPDAPVGSAETIQGGIDSVPEGTEHCLAITETEPGRYAVTLSELRPDGSAKKYEQVVTTADRDGRTYITSIGDAK

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	599308-599333	3	0.885
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1213766-1213791	3	0.885
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	162689-162714	4	0.846
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP010420	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50e, complete sequence	95528-95553	4	0.846
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2696758-2696783	4	0.846
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NC_023067	Streptomyces sp. F2 plasmid pFP3, complete sequence	19234-19259	4	0.846
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1127315-1127340	5	0.808
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1630769-1630794	5	0.808
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1630715-1630740	5	0.808
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1118312-1118337	5	0.808
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	201981-202006	5	0.808
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NC_030916	Tsukamurella phage TPA4, complete genome	10727-10752	5	0.808
NZ_CP003949_1	1.1|38390|26|NZ_CP003949|CRISPRCasFinder	38390-38415	26	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	715602-715627	5	0.808

1. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 3, identity: 0.885

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
atcgtggtcggcgtcgccctgctggt	Protospacer
.****.******** ***********

2. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 3, identity: 0.885

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
atcgtggtcggcgtcgccctgctggt	Protospacer
.****.******** ***********

3. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 4, identity: 0.846

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ctcgtagtcggcgacgccctgctggc	Protospacer
 ************  **********.

4. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP010420 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50e, complete sequence) position: , mismatch: 4, identity: 0.846

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ctcgtagtcggcgacgccctgctggc	Protospacer
 ************  **********.

5. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
gtcgaagccggcgtagccctgctcgg	Protospacer
**** **.*************** * 

6. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NC_023067 (Streptomyces sp. F2 plasmid pFP3, complete sequence) position: , mismatch: 4, identity: 0.846

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
gacgtcgtcggcgtagccctgccggg	Protospacer
* *** ****************.** 

7. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ccggtggtcggcgtatccctgctggt	Protospacer
 . **.********* **********

8. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ccggtggtcggcgtatccctgctggt	Protospacer
 . **.********* **********

9. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ccggtggtcggcgtatccctgctggt	Protospacer
 . **.********* **********

10. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ccggtggtcggcgtatccctgctggt	Protospacer
 . **.********* **********

11. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
caggtcgtcggcgtagccgtgctggt	Protospacer
   ** ************ *******

12. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NC_030916 (Tsukamurella phage TPA4, complete genome) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
gtcgtagtcggcgtcgcccggcttcg	Protospacer
************** **** ***   

13. spacer 1.1|38390|26|NZ_CP003949|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.808

gtcgtagtcggcgtagccctgctggt	CRISPR spacer
ccggtggtcggcgtatccctgctggt	Protospacer
 . **.********* **********