CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP007506	Pandoraea pnomenusa strain RB38, complete genome	1 crisprs	csa3,RT,DEDDh,DinG,cas3,WYL	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007506_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007506_1

3753058-3753133

Orphan

Consensus_repeat	Method
CCGCCCTCCCCGGTTCGCACCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007506_1

>merge|NZ_CP007506|1|3753058-3753133|CRISPRCasFinder
CCGCCCTCCCCGGTTCGCACCTCAGTGGTAAATCAAATCAAGTCGTTCAATTTCCGCCCTCCCCGGTTCTCACCTC

>NZ_CP007506|1|1|3753058-3753133|CRISPRCasFinder
CCGCCCTCCCCGGTTCGCACCTC	AGTGGTAAATCAAATCAAGTCGTTCAATTT
CCGCCCTCCCCGGTTCTCACCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007506.3\|WP_023871891.1\|3764996_3765200_+\|SlyX	unknown	unknown	gnl\|CDD\|179824
NZ_CP007506.3\|WP_080685338.1\|3765340_3766009_+\|DUF1439-domain-containing-protein	unknown	unknown	gnl\|CDD\|377799
NZ_CP007506.3\|WP_025250506.1\|3744951_3745560_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP007506.3\|WP_023871884.1\|3754593_3756573_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP007506.3\|WP_025250502.1\|3756588_3757650_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP007506.3\|WP_155734210.1\|3747889_3749260_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007506.3\|WP_023595032.1\|3751196_3752981_+\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|223839
NZ_CP007506.3\|WP_023595041.1\|3742496_3743576_-\|selenide,-water-dikinase-SelD	unknown	unknown	gnl\|CDD\|234870
NZ_CP007506.3\|WP_023871890.1\|3764593_3764911_-\|YnfA-family-protein	unknown	unknown	gnl\|CDD\|235016
NZ_CP007506.3\|WP_023595026.1\|3759059_3759524_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP007506.3\|WP_025250499.1\|3762272_3763745_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP007506.3\|WP_025250505.1\|3746786_3747335_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
NZ_CP007506.3\|WP_023595034.1\|3749412_3750039_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP007506.3\|WP_081215046.1\|3761127_3762276_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176161
NZ_CP007506.3\|WP_023595022.1\|3763810_3764482_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
NZ_CP007506.3\|WP_115344554.1\|3743721_3744834_+\|transglutaminase-domain-containing-protein	unknown	unknown	gnl\|CDD\|376628
NZ_CP007506.3\|WP_023595027.1\|3758161_3758791_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP007506.3\|WP_023871879.1\|3747331_3747862_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
NZ_CP007506.3\|WP_051519103.1\|3750110_3750920_+\|DUF3047-domain-containing-protein	unknown	unknown	gnl\|CDD\|378613
NZ_CP007506.3\|WP_023871877.1\|3745597_3746521_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176142

Protein	Function_ID	Function_description	E-value
NZ_CP007506.3\|WP_080685338.1\|3765340_3766009_+\|DUF1439-domain-containing-protein	gnl\|CDD\|377799	pfam07273, DUF1439, Protein of unknown function (DUF1439). This family consists of several hypothetical bacterial proteins of around 190 residues in length. Several members of this family are annotated as being putative lipoproteins and are often known as YceB. The function of this family is unknown.	2.52483e-12
NZ_CP007506.3\|WP_025250506.1\|3744951_3745560_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.56243e-42
NZ_CP007506.3\|WP_023871884.1\|3754593_3756573_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP007506.3\|WP_025250502.1\|3756588_3757650_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	1.52656e-144
NZ_CP007506.3\|WP_023871891.1\|3764996_3765200_+\|SlyX	gnl\|CDD\|179824	PRK04325, PRK04325, hypothetical protein; Provisional.	1.23891e-22
NZ_CP007506.3\|WP_023595032.1\|3751196_3752981_+\|penicillin-binding-protein-2	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	5.22401e-158
NZ_CP007506.3\|WP_023595041.1\|3742496_3743576_-\|selenide,-water-dikinase-SelD	gnl\|CDD\|234870	PRK00943, PRK00943, selenide, water dikinase SelD.	0
NZ_CP007506.3\|WP_023871890.1\|3764593_3764911_-\|YnfA-family-protein	gnl\|CDD\|235016	PRK02237, PRK02237, YnfA family protein.	3.73194e-44
NZ_CP007506.3\|WP_023595026.1\|3759059_3759524_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.0362e-44
NZ_CP007506.3\|WP_025250499.1\|3762272_3763745_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.55411e-25
NZ_CP007506.3\|WP_025250505.1\|3746786_3747335_+\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	2.63417e-33
NZ_CP007506.3\|WP_023595034.1\|3749412_3750039_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.69632e-46
NZ_CP007506.3\|WP_081215046.1\|3761127_3762276_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176161	cd08472, PBP2_CrgA_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.28558e-62
NZ_CP007506.3\|WP_023595022.1\|3763810_3764482_+\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	2.01422e-49
NZ_CP007506.3\|WP_115344554.1\|3743721_3744834_+\|transglutaminase-domain-containing-protein	gnl\|CDD\|376628	pfam01841, Transglut_core, Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.	3.79764e-24
NZ_CP007506.3\|WP_023595027.1\|3758161_3758791_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	5.15634e-38
NZ_CP007506.3\|WP_023871879.1\|3747331_3747862_+\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	4.64309e-30
NZ_CP007506.3\|WP_051519103.1\|3750110_3750920_+\|DUF3047-domain-containing-protein	gnl\|CDD\|378613	pfam11249, DUF3047, Protein of unknown function (DUF3047). This bacterial family of proteins has no known function.	1.19812e-85
NZ_CP007506.3\|WP_023871877.1\|3745597_3746521_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176142	cd08451, PBP2_BudR, The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.17739e-78

>NZ_CP007506.3|WP_023595032.1|3751196_3752981_+|penicillin-binding-protein-2
MQKNRQPKDVTFASSPVLQSRTSLWRSKLVVIGITLAFIGLVVRAFWIAGPGNGFYIAQGEKRYEHTIVMPAVRGKIEDRDGRVLATSLPMRTVWAVPAEVPDDLSDSDIRKASKLLDIPPKELRTKLIGEKKFVYVKRQVSPEIGKQVEALGIPGVYESSEYKRFYPEGEVAAHVVGFTNVEDKGQEGMELGEESLLEGTAGVRRVIKDRIGRTIQDLDDSSPPRDGKDIRLTLDTRVQYIAYEALKNALDRTGAKAAMAVVIDAKSGQVLALANLPTYNPNDREHLTGEQLRNRVFTDVFEPGSILKPFTMALALDLHRLTPSTLIDTGPGRYVFEGATISDDSANGVLTAAGVIQKSSNIGMTKVSTMLRAEEMWDMFTEIGLGQQPKLGFPGAVSGRLRPYKSWRRIEQATMAYGYGISASLFQLARAYTIFANDGVLVPISIIKPDTPVQPEGVRVIDARTAAEMRKMLAGVVDTGGTATTAQVAGYSIGGKTGTAYKAGAHGYDHSKYRASFVGIAPLSAPRLVIAVSVDEPKASQHFGGQAAGPAFAEIASQALPLLGIRPDLPVRPGVILAAPTSDSPPDDKGAHG
>NZ_CP007506.3|WP_051519103.1|3750110_3750920_+|DUF3047-domain-containing-protein
MPRIVSPLRSVRSPNVPPLRVLGAAACLIAGLGPVDPVFAADAAAPPPPAVTAVAFSRAAPGSTSLAGWQNLPVVSGKKLTTYTVVADGRSNVVEANAADSASALMAKGDRIDLGATPVVTWRWKVDNAIPGADNRVADKEDSPARLVFFFDGDKSKLPFGDRATMTLAKAGGEDLPYATLMYIWSNDAVPGGVIQNPHTDRVQMLVVAGGDASLGKWQTFSRNLAADYERVFREKPGRLLGYGVFTDSDNTHASAHAWYGDVRFGAEK
>NZ_CP007506.3|WP_023595034.1|3749412_3750039_+|LysE-family-translocator
MPTLATLATFVVVVLGLFLIPGPAVLLTITRTVQGGRRAGVMTGVGIALGDLVHTLCAAVGLSAVLMTSALAFDVVKYVGAAYLIYLGIKALREPPSDPQLPAAPRVSPGRAFVQAVATEVLNPKTALFFLAFMPQFVHAHEGNVFLQFLVLGMVFVAMSALYTAAIALSVRPLGRFVKRFTWLLRWQGKIIGSLFIGLGLRVAMQQR
>NZ_CP007506.3|WP_155734210.1|3747889_3749260_-|hypothetical-protein
MPMTCAGPAINPTAPSANTFLQLGMRVVTCVRDGFRDDFAGMTACLRESGWRCLLDEAWHNASERFRVRGVTLPEAADVTFACAASILAIGATCRYLWPELRALERAIAEGDGARHEWALQTDAQLRRRTLADVTAMRQCMAAFEATEADANAANTTTTANAGVSARDHDRMSPTSRRRLAEMRISEALVLHVADAPQSSLAQSDRVAGLCQLLAHGLGFRLPAARLRTLHVSDARPSLIRFDEAFALLRERLEPDWRRDTPGAPTFCVHPIDVQLFDPAETTDDLCADVRDARRLLTHPEALRRVRSRVVALIAASVREDCGGTGDWRALAERALRTAAQLGMTCGRVLGALGIATRSGVSARAAWRWSDEVPMAPGRHPAPAIEADVAQWVARTMLLAGKTACPPRLAALARGDTPASLVIGSAAWTDLVDGIAVLGREHWRVAYAQVCGVGRA
>NZ_CP007506.3|WP_023871879.1|3747331_3747862_+|chromate-transporter
MTGTLISLAVIFTQLSVLAFGGGNTILPEMERQVVDVHHWMTSEAFSALFALGQAAPGPNLMIVTLVGWHVAGWQGMLVTSIAKFGPSSLITVGVLHLWERFKDRPWRRIVQAGLVPMTAGLVAASAALIAQASATSWLLAGITASVAVLAIRTRVHPLWWLAAGSVAGLLGGAYL
>NZ_CP007506.3|WP_025250505.1|3746786_3747335_+|chromate-transporter
MPGDTRPAPSVRALFLGFLGLGMTAFGGALPLARRMVVEKHRWLTPAEFTDLLGLCQFLPGGNIINLSVALGMRFHGWRGALASILGLIAAPSAVVILLGMIYQHFQNDPHVKHLFAGLAAAAAGLLIQMAWKVSWPLRKSMVLGAVALACFIAIAVLRVPLVLTMAVMTPISIYATWRVSQ
>NZ_CP007506.3|WP_023871877.1|3745597_3746521_-|LysR-family-transcriptional-regulator
MANIDVRLLRYFIAVAETGHMTRAAERLGIGQPPLSQQIRVLETQLGVTLFERLPRGMALTDAGQAFLADAYEVVRKLDQAVDDVRRVAAGVKGRLSVGFTSSAALHPFVPTVIRAFRADAPSVSLMLDEASTSELLDSLRDGQLDVAFIRQPQGDTGQITFVPVLEEPMVLAAPSAHPLALTGRAGKAVVPMTAIAAEKLILYRRRTGQGLYDAIIAACHGAGFSPNIEQEAPRLLTTLSLVAAGLGVSVVPASLMRMQVEGIVYRPLAPPPRAPLYCAYREGVLAGPTARLLDHVHVAARSVAPE
>NZ_CP007506.3|WP_025250506.1|3744951_3745560_+|TlpA-family-protein-disulfide-reductase
MQRRHFLHTMGAIGAAGAVGAIGGMSAPTMAAGPSKGTAQVDDSVLAGTSGGTLSAWRGATPAFSLPALDGTTHASSAWRGRVVILNFWATWCAPCREEIPAMGAVARQYRERGLMLVAVNYKEPPATVKPFVDKVPIDGTVLLDIDGAVYKRFGPIGLPATYLIDRAGNARFWRMGELEWSDVGLHGHIETLLAQKGGTSA
>NZ_CP007506.3|WP_115344554.1|3743721_3744834_+|transglutaminase-domain-containing-protein
MPASLLTSSLLPVQAHASPRAASPHDAADGWRTFELTTQVDLPAAAAGGGPARVWLPVATSPGGGYQQALGTRWEAPGAKAELRMVRGAAGVGVPMLAVAWPDATQARTVTLVNTFATRDRRVDLSQPPSADAPKEAPAVLRQYLQPTTLQPTDGLVRETAEKITRGQQGDVEKARAIYEWIVDNCRREGSVRGCGTGDVRYMLTTGNLAGKCADINALFTALARSVGIPARDAYGVRVAASQHGFNSLGKAGDVTRAQHCRAEFHAAGYGWVPVDPADVRKVVLEEVPGGLPLDDLRVRAARAMLFGQWEMNWVAFNHGADIALPGATRANREPVPFLMYPNGEVANARLDSLDPDTFRYRMSARELTA
>NZ_CP007506.3|WP_023595041.1|3742496_3743576_-|selenide,-water-dikinase-SelD
MTAIDATQAGATPAAPRLTSLSHGGGCGCKIAPGVLSELLARNDTPLPAPAALLVGTETSDDAAVYQLNDEQAIIATTDFFMPIVDDPYDFGRIAATNALSDIYAMGGKPIFALAIVGMPINVLPRETIRDILRGGESICAEAGIPIAGGHSIDSVEPIYGLAALGVVHPKRLKRNADAQAGDVLVLGKPLGVGVMSAALKKNQLDDAGYRLMIDATTRLNRVGPALAALPGVHALTDVTGFGLLGHTLEMCRGANLAAYLRMADVPLFDGVRELADKGCITGASGRNWASYGASVELGDRLTTRDRDLLCDPQTAGGLLVSCAPGAVDDVLAVFRADGFAEAGIVGAMRPGKPGVRVI
>NZ_CP007506.3|WP_023871884.1|3754593_3756573_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MFGKLTLEAIPYHEPIIVGAVGMMVLGGLGIIALLTYFGKWKYLWNEWVTSVDHKKIGVMYVLVALVMLLRGFADAMMMRTQLALAHNSPGILPPDHYDQIFTAHGVIMIFFVAMPFMTGLVNLVVPLQIGARDVAFPFLNTLSFWLFVAGAALVNLSLGVGEFARTGWLAYPPLSGIQYSPGVGVDYYIWALQISGLGTLLTGVNFVVTILKMRAPGMNLMKMPIFTWTSLCTMVLVCAAFPVLTVTLALLSLDRYLDFHFFTNELGGNPMMYINLIWIWGHPEVYILILPAFGIFSEIISTFSGKKLFGYKSMVYATAAIMVLSFLVWAHHFFTMGSGASVNAFFGIATMIISIPTGVKIFNWLFTMYRGRVQMTTPVLWTLGFIVTFVIGGMTGVLLAVPGADFVLHNSLFLIAHFHNVIIGGVLFGYIAGMNYWFPKAFGFKLDERLGKASFWCWLIGFYLAFMPLYVLGLMGMTRRLNHYSNPEWQPWLIAALIGALFIAAGIGFQVLQLVVSIKNRKALADTTGDPWNGRTLEWMTSSPPQFYNFAEEPRVHDVDELAYRKEHGIKGDLKTSYAPIHMPKNTGAGFIISAFSLVFGFAAIWHIWWLAIVGFVGMIVTFICRSNNDSIDYYVQSPEVVAIETAHHQALAAAAKA
>NZ_CP007506.3|WP_025250502.1|3756588_3757650_-|ubiquinol-oxidase-subunit-II
MKKHRNPRLFRLLALCSPLILAGCDMTLLDPKGQIGVENKNLILTATWLMLIVVIPVILMTLWFAWKYRATNKSARYEPNWSHSTAIEVVVWLVPIIIIAILARITWVSTHELDPYKPLESEVKPITVEVVSMNYKWLFIYPEQGIASINELAVPVDTPVNFKITSESIMNSFFIPQLGSMVYTMAGMETKLHLIANHVGEYDGISANYSGGGFSGMRFKTLAMTDGDFQAWVTKVRESKKVLDKGTYASLVPMSENTPVTYYSSVDANMFQSIVHAPMASGMAQQQEGHENHGAMDMKGMDKKMEMKGAGTDAATAPAAAANVQNGQSMTMAMDNAGAHAMHAGAAAHAHKE
>NZ_CP007506.3|WP_023595027.1|3758161_3758791_-|LysE-family-translocator
MVSLQLLTVFIGALVVVYALPGPDMALVMQTSMTRGVRHGLATAGGLAMARAGHVTLSACGVAALLRAAPWLFETVRIVGAIYLAWVAIQIWRSPAFGVDAVALSTDAPPPLSQAVRRGVLSSVLNPKALLFCSVLLPQFVRAEAGPVWSQVLELGVLLLVVGAIFDVTLAFGAARIARWLRTRPLAQKVQRWSFGAALMAFAVRLSLD
>NZ_CP007506.3|WP_023595026.1|3759059_3759524_+|Lrp/AsnC-family-transcriptional-regulator
MNELDAIDRAILAIVQRDGRISNARLAERVSLSETPCARRLKRLEAEGYITGYRAELSYRALGLGVTAFVHVRFAVHDRSLSEQFEREVQAIDRIVSCHNISGSADYLLGVVATDLDDYGMFTRDVLRALPGVSSIESMLSLREVKRDTGAPLL
>NZ_CP007506.3|WP_081215046.1|3761127_3762276_-|LysR-family-transcriptional-regulator
MIDRITAMRTFVRVAEVGSFTKAAASLDLPRATATTQVQHLERWFGVALFTRSTRRVALTMEGAAYYERCAAILADVEEVESGLFGAHVQLRGRLAVVLPPVIAREVVMPSLAEFQSRHPGLEIALDATPAHGDWRGDGVDCGVVLGELPDSRLVARHLGDLPRVTCASRRYLDVHGTPEDLDDLAMHTSVKWRSAPAESLTVPASPTSTPAADEAGTAGMTLATPTTRCGDLMLMVGSRATCVRTRGQLQVGDEAAYLAAGLEGLGLIQPTVLAAAPYLASGRLVPVLPNCPPPALRLSAAYPAQKRVSPRVRAFVDWLAQICEPLGHGGRGGAQASPRPAEPGVPAEPGVAGVAGVAAVVALPLPEGKASSTRRSFTLPA
>NZ_CP007506.3|WP_025250499.1|3762272_3763745_-|MFS-transporter
MTTNTTNSGTPGWRDLLSGNNGWRSLALAGGVALHATNVYVSTTVLPSIVRDIGGLDLYAWNTTLFVVASILGSVLAATLMATFGPRIAYGMALLGFSAGTILCAAAPTMPWMLAGRTLQGFGGGILLSLSYALIRIVFVPSLWSRAMGLISGMWGVATLCGPALGGIFAQFGHWRWAFWSLLPVVVGLGLIIRVQVPAGRAMAAGAASPRSDEAQVIPWFKVILLCASAVAISLGAVVTSHPLAAAWMVAGLALVGWLAHRERSARHALPRLMPTGAYSLRTRLGGLYVAMGLLGLAMTSEIYIPYFLQTIHGQTPFAAGYLAALMAAGWSVGSMTSAGRQGDAAERCVRLGPVIVAIGMFALAWLLPQRSLFESTAGALSLGAALFGVGMGVGIGWPHLLTRVMTAARPGEAHLASASITTVQLYSMALGSALAGLVANSAGLADGALEAAQRASVWLFALFALAPAGAAIVAWRGKAAARVSGQEAS
>NZ_CP007506.3|WP_023595022.1|3763810_3764482_+|transcriptional-regulator
MNYTNNHLDNRAVPSATGAGPERVLHWLKTQGPASTAEVAAALGITAEAARQQVQRLVSDGLLVGQTTPSRGAGRPRQTWMLTEAGHARFPDAHSHLTIQLIGSIRQLFGEDGLDRLITQRAADTRLHYKQAVDPLKGLQARLDKLAEIRSAEGYMARVERDGDDWLLIEDHCPICAAAKTCQGFCRTELELFQELIGERGTVSRETHILAGGQRCTYRVRTP
>NZ_CP007506.3|WP_023871890.1|3764593_3764911_-|YnfA-family-protein
MKTFALYVVTAVAEIVGCYLPWLWLRQDRSAWLLVPGAASLALFAWLLTLHPAAAGRVYAAYGGVYITVAIVWLWWVDGVRPTSWDMAGVTVALVGMGLIAFQPR
>NZ_CP007506.3|WP_023871891.1|3764996_3765200_+|SlyX
MEARIVELEIKTAFQEDLLETLNGIVTRQEQQIDLLQKQFKALYQQMLSQGPGGNDGNPRHEIPPHY
>NZ_CP007506.3|WP_080685338.1|3765340_3766009_+|DUF1439-domain-containing-protein
MTTRRPPSLPRSLPSPWLARATSPVEAEQLTASRREVLRIGLAGLLGLALASRMQRADAGYNIWTGEYTMTRKDIESAVDKRFPTTLNYGQLLTVELTHPQIGFNPQANRVNTQVDAQLKNILLQGQPLQGTLAISSALKYDPVRRAVLLDHPSVERVDVNGMPPAYGQQLTAIGGTVAQQVLDQYPIYTFRPEQLRYGGRDVEPGAITVLPDGIKVEVKTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

953078 : 1081586

Burkholderia_virus(25.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155734150.1\|953078_954316_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.6e-143	87.3
WP_155734151.1\|954485_954716_+	hypothetical protein	NA	NA	NA	NA
WP_025249780.1\|954932_955340_+	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	2.0e-34	49.6
WP_025249779.1\|955350_955662_-	hypothetical protein	NA	NA	NA	NA
WP_025249778.1\|955935_956541_-	hypothetical protein	NA	NA	NA	NA
WP_081214897.1\|957536_958403_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_051519078.1\|958417_959776_+	MFS transporter	NA	NA	NA	NA
WP_025249775.1\|959860_961066_+	porin	NA	NA	NA	NA
WP_025249774.1\|961076_961961_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_025249773.1\|961928_962849_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025249772.1\|962960_964352_+	hypothetical protein	NA	NA	NA	NA
WP_025249771.1\|964417_965302_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025249770.1\|965426_966659_+	CoA transferase	NA	NA	NA	NA
WP_025249769.1\|966642_967458_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_025249768.1\|967538_968915_+	MHS family MFS transporter	NA	NA	NA	NA
WP_025249767.1\|968880_969759_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_025249766.1\|969869_971147_-	3-(3-hydroxy-phenyl)propionate transporter MhpT	NA	NA	NA	NA
WP_025249765.1\|971255_972041_-	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_025249764.1\|972056_973016_-	3-carboxyethylcatechol 2,3-dioxygenase	NA	NA	NA	NA
WP_025249763.1\|973019_974897_-	bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	NA	NA	NA	NA
WP_023873218.1\|975187_976003_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_023873219.1\|976172_977060_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025249762.1\|977188_978667_+	D-aminoacylase	NA	NA	NA	NA
WP_025249761.1\|978663_980001_+	MFS transporter	NA	NA	NA	NA
WP_023873222.1\|979997_981362_+	amidase	NA	NA	NA	NA
WP_029754334.1\|981576_981966_+	phosphonate transporter	NA	NA	NA	NA
WP_025249759.1\|981962_983303_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-15	31.1
WP_025249758.1\|983369_984161_+	EAL domain-containing protein	NA	NA	NA	NA
WP_025249757.1\|984230_985880_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_025249756.1\|985876_988474_-	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	7.0e-11	28.1
WP_023873229.1\|988470_989349_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_025249755.1\|989420_990683_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_048806837.1\|991038_991965_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_155734152.1\|992032_992908_+	FCD domain-containing protein	NA	NA	NA	NA
WP_023873233.1\|992925_993561_+	flavin reductase family protein	NA	NA	NA	NA
WP_025249753.1\|994067_996233_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.4e-17	25.6
WP_025249752.1\|996229_998026_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_081215018.1\|998165_999017_+	hypothetical protein	NA	NA	NA	NA
WP_081214898.1\|999156_1010997_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	4.3e-23	30.4
WP_141570902.1\|1010993_1011251_+	hypothetical protein	NA	NA	NA	NA
WP_155734153.1\|1011263_1012500_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.9e-144	88.0
WP_072619137.1\|1012581_1012986_+	hypothetical protein	NA	NA	NA	NA
WP_023873243.1\|1013858_1014056_+	DUF4926 domain-containing protein	NA	NA	NA	NA
WP_025249749.1\|1014132_1015383_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.5e-40	41.7
WP_141570906.1\|1015555_1015999_-	hypothetical protein	NA	NA	NA	NA
WP_155734154.1\|1015985_1019057_-	adhesin	NA	NA	NA	NA
WP_141570910.1\|1019113_1019533_-	hypothetical protein	NA	NA	NA	NA
WP_051519077.1\|1019556_1022736_-	DUF637 domain-containing protein	NA	NA	NA	NA
WP_025249747.1\|1023340_1023973_-	hypothetical protein	NA	NA	NA	NA
WP_155734155.1\|1024153_1024573_-	hypothetical protein	NA	NA	NA	NA
WP_155734156.1\|1024652_1025755_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_081214899.1\|1025833_1026640_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	3.0e-37	45.4
WP_155734157.1\|1027041_1029546_-	hypothetical protein	NA	NA	NA	NA
WP_155734158.1\|1029652_1029823_-	hypothetical protein	NA	NA	NA	NA
WP_023872376.1\|1030074_1031091_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-36	31.2
WP_025249744.1\|1031147_1031432_+\|transposase	IS3 family transposase	U5P4I9	Shigella_phage	6.8e-13	48.9
WP_062802140.1\|1031479_1031986_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.9e-30	48.2
WP_155734159.1\|1031951_1033039_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_025249741.1\|1033695_1033911_-	hypothetical protein	NA	NA	NA	NA
WP_025249738.1\|1039111_1039474_+	hypothetical protein	NA	NA	NA	NA
WP_051519075.1\|1039651_1040176_+	hypothetical protein	NA	NA	NA	NA
WP_058952727.1\|1040126_1042007_+	hypothetical protein	NA	NA	NA	NA
WP_155734156.1\|1042377_1043480_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_025249736.1\|1043751_1044144_+	hypothetical protein	NA	NA	NA	NA
WP_155734153.1\|1044254_1045491_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.9e-144	88.0
WP_025249734.1\|1045555_1045798_+	hypothetical protein	NA	NA	NA	NA
WP_155734160.1\|1046064_1048536_+	adhesin	NA	NA	NA	NA
WP_081214901.1\|1048561_1048876_+	hypothetical protein	NA	NA	NA	NA
WP_141570928.1\|1048879_1049200_+	hypothetical protein	NA	NA	NA	NA
WP_025249732.1\|1049378_1050395_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.9e-36	31.2
WP_023597415.1\|1050806_1050941_+	hypothetical protein	NA	NA	NA	NA
WP_023597414.1\|1051198_1052071_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025249731.1\|1052412_1053738_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.1e-81	40.8
WP_023873247.1\|1053890_1055090_+	amidohydrolase	NA	NA	NA	NA
WP_028731074.1\|1055086_1056184_+	DUF2817 domain-containing protein	NA	NA	NA	NA
WP_025249730.1\|1056292_1057159_-	hypothetical protein	NA	NA	NA	NA
WP_023597409.1\|1057454_1058177_-	hypothetical protein	NA	NA	NA	NA
WP_025249729.1\|1058591_1060376_+	hypothetical protein	NA	NA	NA	NA
WP_144347397.1\|1060347_1060788_+	hypothetical protein	NA	NA	NA	NA
WP_155734161.1\|1060754_1061504_+	response regulator	NA	NA	NA	NA
WP_025249727.1\|1061500_1062505_+	hypothetical protein	NA	NA	NA	NA
WP_080738790.1\|1062529_1063378_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_144347396.1\|1063313_1064723_-	hypothetical protein	NA	NA	NA	NA
WP_081214902.1\|1064739_1067325_-	hypothetical protein	NA	NA	NA	NA
WP_080738788.1\|1067355_1067709_+	hypothetical protein	NA	NA	NA	NA
WP_023597356.1\|1067932_1068388_+	hypothetical protein	NA	NA	NA	NA
WP_023597355.1\|1068521_1068803_-	XapX domain-containing protein	NA	NA	NA	NA
WP_025249725.1\|1068802_1069252_-	DoxX family protein	NA	NA	NA	NA
WP_025249724.1\|1069282_1071142_-	amidohydrolase	NA	NA	NA	NA
WP_023597352.1\|1071155_1071842_-	hydrolase	NA	NA	NA	NA
WP_025249723.1\|1072088_1072769_+	response regulator transcription factor	NA	NA	NA	NA
WP_115344501.1\|1079851_1080969_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.2e-47	39.2
WP_081214903.1\|1080983_1081586_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1430176 : 1473430

Pseudomonas_phage(27.27%)

transposase,integrase,tRNA,portal,protease,head,tail,terminase,capsid

attL 1431616:1431675|attR 1475611:1475673

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023597078.1\|1430176_1431481_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-96	45.2
1431616:1431675	attL	NA	NA	NA	NA
WP_025249618.1\|1431706_1432759_-\|integrase	site-specific integrase	G8C7S0	Escherichia_phage	6.8e-82	44.1
WP_150568411.1\|1432614_1432944_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_041612570.1\|1432996_1433266_+	hypothetical protein	NA	NA	NA	NA
WP_025249616.1\|1433466_1435272_-	type II restriction endonuclease subunit M	H9C171	Pectobacterium_phage	5.1e-162	47.1
WP_025249615.1\|1435316_1435709_+	hypothetical protein	NA	NA	NA	NA
WP_025249614.1\|1435719_1436340_-	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	1.3e-32	43.1
WP_025249613.1\|1436332_1437790_-	hypothetical protein	X5I2N5	Pseudomonas_phage	5.8e-31	58.2
WP_141571302.1\|1437782_1438073_-	hypothetical protein	NA	NA	NA	NA
WP_141571304.1\|1438410_1438932_+	hypothetical protein	Q8W6Q5	Burkholderia_virus	4.3e-05	44.6
WP_025249610.1\|1438985_1439891_-	hypothetical protein	V5YTD4	Pseudomonas_phage	3.6e-55	51.9
WP_141571306.1\|1439887_1440241_-	hypothetical protein	NA	NA	NA	NA
WP_025249609.1\|1440680_1441028_+	hypothetical protein	NA	NA	NA	NA
WP_025249608.1\|1441239_1441731_+	hypothetical protein	NA	NA	NA	NA
WP_025249607.1\|1441916_1442237_-	hypothetical protein	A2I2Y8	Vibrio_virus	2.2e-23	57.0
WP_115344501.1\|1442508_1443625_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.2e-47	39.2
WP_155734166.1\|1443904_1444693_-	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_155734167.1\|1444694_1445006_-	hypothetical protein	NA	NA	NA	NA
WP_081215022.1\|1445186_1445678_-	S24 family peptidase	A0A1I9KG86	Aeromonas_phage	2.4e-29	45.5
WP_155734168.1\|1446212_1446407_+	hypothetical protein	NA	NA	NA	NA
WP_025249600.1\|1446737_1447331_+	hypothetical protein	A0A0S2SYA8	Pseudomonas_phage	5.6e-25	40.6
WP_155734169.1\|1447327_1447516_+	hypothetical protein	NA	NA	NA	NA
WP_025249599.1\|1447526_1447790_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025249598.1\|1447786_1448587_+	helix-turn-helix domain-containing protein	Q3HQZ6	Burkholderia_phage	6.3e-88	62.9
WP_025249597.1\|1448583_1449240_+	hypothetical protein	Q3HQZ7	Burkholderia_phage	6.8e-72	63.0
WP_029754245.1\|1449445_1449745_+	hypothetical protein	A0A1I9KG18	Aeromonas_phage	1.8e-16	54.7
WP_025249594.1\|1449741_1450092_+	hypothetical protein	NA	NA	NA	NA
WP_025249593.1\|1450202_1450442_+	hypothetical protein	A0A2H4JA03	uncultured_Caudovirales_phage	5.4e-19	65.8
WP_155734170.1\|1450507_1450903_+	hypothetical protein	NA	NA	NA	NA
WP_025249591.1\|1450902_1451331_+	DUF1364 family protein	K7P7Q1	Enterobacteria_phage	1.9e-11	58.6
WP_025249590.1\|1451323_1451704_+	hypothetical protein	NA	NA	NA	NA
WP_081214914.1\|1452055_1452460_+	HNH endonuclease	A0A1B5FP94	Escherichia_phage	1.0e-06	38.2
WP_025249588.1\|1452510_1452927_+\|terminase	terminase	NA	NA	NA	NA
WP_025249587.1\|1452919_1454638_+\|terminase	terminase large subunit	A0A0U4B0M7	Pseudomonas_phage	2.4e-254	73.6
WP_025249586.1\|1454634_1455933_+\|portal	phage portal protein	G0ZT36	Aeromonas_phage	1.3e-151	65.3
WP_025249585.1\|1455937_1456804_+\|protease	Clp protease ClpP	A0A2H4PI16	Pseudomonas_phage	9.5e-74	53.6
WP_025249584.1\|1456806_1458009_+\|capsid	phage major capsid protein	A0A2H4PI18	Pseudomonas_phage	2.3e-126	60.4
WP_025249581.1\|1458779_1459091_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_081214915.1\|1459002_1459428_+\|head	phage head closure protein	NA	NA	NA	NA
WP_025249579.1\|1459420_1459933_+	hypothetical protein	NA	NA	NA	NA
WP_081214916.1\|1459929_1460307_+	DUF3168 domain-containing protein	Q9MCA6	Pseudomonas_phage	4.2e-18	43.0
WP_025249578.1\|1460370_1460853_+	hypothetical protein	NA	NA	NA	NA
WP_025249577.1\|1460854_1461184_+	hypothetical protein	NA	NA	NA	NA
WP_025249576.1\|1461264_1461498_+	hypothetical protein	NA	NA	NA	NA
WP_025249575.1\|1461494_1463612_+	hypothetical protein	A0A0U2BXT9	Paracoccus_phage	3.3e-19	31.6
WP_025249574.1\|1463611_1463950_+\|tail	phage tail protein	K7P7R1	Enterobacteria_phage	1.2e-27	50.9
WP_155734235.1\|1464035_1465058_+	hypothetical protein	A0A0F7LBT2	uncultured_marine_virus	6.5e-21	38.8
WP_025249572.1\|1465064_1465769_+\|tail	phage minor tail protein L	A0A2R3UA90	Siphoviridae_environmental_samples	4.8e-84	62.3
WP_025249571.1\|1465768_1466482_+	C40 family peptidase	A0A1B1IV85	uncultured_Mediterranean_phage	1.7e-68	52.2
WP_025249570.1\|1466513_1466852_+	hypothetical protein	NA	NA	NA	NA
WP_025249569.1\|1466913_1467510_+\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	2.3e-50	57.9
WP_025249568.1\|1467576_1470738_+	host specificity protein J	Q8W6T0	Burkholderia_virus	0.0e+00	56.3
WP_025249567.1\|1470737_1471040_+	hypothetical protein	NA	NA	NA	NA
WP_155734171.1\|1471054_1471798_+	hypothetical protein	NA	NA	NA	NA
WP_025249565.1\|1471865_1472207_+	hypothetical protein	Q6J1Q7	Burkholderia_virus	1.0e-31	68.2
WP_025249564.1\|1472206_1472485_+	hypothetical protein	Q6J1Q6	Burkholderia_virus	2.3e-21	52.2
WP_025249563.1\|1472471_1472948_+	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	4.0e-50	61.6
WP_058952725.1\|1472944_1473430_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	8.6e-24	43.4
1475611:1475673	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1758023 : 1767273

Burkholderia_virus(42.86%)

integrase

attL 1750041:1750056|attR 1774042:1774057

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1750041:1750056	attL	NA	NA	NA	NA
WP_025249438.1\|1758023_1759937_+	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	4.6e-20	27.9
WP_029754174.1\|1760124_1760442_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	4.8e-15	47.6
WP_144347378.1\|1760655_1760841_+	hypothetical protein	NA	NA	NA	NA
WP_155734239.1\|1760901_1761309_+	glycoside hydrolase family protein	A0A0U4JP67	Pseudomonas_phage	8.0e-31	54.5
WP_150646730.1\|1761338_1761680_+	hypothetical protein	NA	NA	NA	NA
WP_025249434.1\|1762006_1762798_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.6e-123	78.6
WP_025249433.1\|1762807_1763122_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	2.6e-29	73.1
WP_025249432.1\|1763125_1763422_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	3.5e-28	62.2
WP_155734178.1\|1763829_1764510_+	hypothetical protein	NA	NA	NA	NA
WP_155734179.1\|1764720_1765479_+	hypothetical protein	NA	NA	NA	NA
WP_025249429.1\|1765633_1766242_-	hypothetical protein	NA	NA	NA	NA
WP_025249428.1\|1766247_1767273_-	ParA family protein	Q56VQ0	Pseudomonas_phage	2.8e-104	61.1
1774042:1774057	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage