CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011454	Gemmatimonas phototrophica strain AP64 chromosome, complete genome	2 crisprs	csa3,DinG,DEDDh,cas3,Cas9_archaeal,WYL	0	1	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011454_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011454_1

55032-55118

Orphan

Consensus_repeat	Method
GTGCCGGGCGGTCGCGCGCACCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011454_1

>merge|NZ_CP011454|1|55032-55118|CRISPRCasFinder
GTGCCGGGCGGTCGCGCGCACCGGGCCACCCCCGAAGCAACGCGCGAAGGAGCGTGTGGGGTTGTGCCGGGCGGTCGCGCGCACGGA

>NZ_CP011454|1|1|55032-55118|CRISPRCasFinder
GTGCCGGGCGGTCGCGCGCACCGG	GCCACCCCCGAAGCAACGCGCGAAGGAGCGTGTGGGGTT
GTGCCGGGCGGTCGCGCGCACGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011454.1\|WP_026848964.1\|53292_53922_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_145978920.1\|57920_58391_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_082820936.1\|60740_62099_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153254
NZ_CP011454.1\|WP_026848965.1\|53918_54500_-\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_CP011454.1\|WP_026848961.1\|49095_50085_-\|YncE-family-protein	unknown	unknown	gnl\|CDD\|225926
NZ_CP011454.1\|WP_158514665.1\|57487_57895_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_026848966.1\|55246_56575_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349894
NZ_CP011454.1\|WP_043580066.1\|48649_49009_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239275
NZ_CP011454.1\|WP_026848958.1\|46501_47749_+\|dicarboxylate/amino-acid:cation-symporter	unknown	unknown	gnl\|CDD\|234968
NZ_CP011454.1\|WP_082820935.1\|56584_57325_-\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|239945
NZ_CP011454.1\|WP_145978921.1\|64231_66436_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_158514664.1\|53111_53288_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_026848972.1\|66641_67148_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_053333858.1\|50137_50449_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP011454.1\|WP_026848970.1\|62182_64156_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP011454.1\|WP_026848973.1\|67343_68567_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|224365
NZ_CP011454.1\|WP_026848959.1\|48033_48633_-\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP011454.1\|WP_053333859.1\|58451_60695_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP011454.1\|WP_075071362.1\|51396_52959_+\|DUF1080-domain-containing-protein	unknown	unknown	gnl\|CDD\|368908
NZ_CP011454.1\|WP_043580067.1\|50467_51331_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318

Protein	Function_ID	Function_description	E-value
NZ_CP011454.1\|WP_026848970.1\|62182_64156_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP011454.1\|WP_082820936.1\|60740_62099_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153254	cd07992, LPLAT_AAK14816-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are uncharacterized glycerol-3-phosphate acyltransferases such as the Plasmodium falciparum locus AAK14816 putative acyltransferase, and similar proteins.	1.7313e-49
NZ_CP011454.1\|WP_026848965.1\|53918_54500_-\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	1.7135e-31
NZ_CP011454.1\|WP_026848961.1\|49095_50085_-\|YncE-family-protein	gnl\|CDD\|225926	COG3391, COG3391, Uncharacterized conserved protein [Function unknown].	1.37983e-12
NZ_CP011454.1\|WP_026848966.1\|55246_56575_+\|M28-family-peptidase	gnl\|CDD\|349894	cd05642, M28_like, M28 Zn-peptidase-like; uncharacterized subfamily. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions.	7.4225e-135
NZ_CP011454.1\|WP_043580066.1\|48649_49009_+\|hypothetical-protein	gnl\|CDD\|239275	cd02977, ArsC_family, Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX), through a single catalytic cysteine. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases. Spx is a general regulator that exerts negative and positive control over transcription initiation by binding to the C-terminal domain of the alpha subunit of RNA polymerase.	1.38003e-14
NZ_CP011454.1\|WP_026848958.1\|46501_47749_+\|dicarboxylate/amino-acid:cation-symporter	gnl\|CDD\|234968	PRK01663, PRK01663, C4-dicarboxylate transporter DctA; Reviewed.	0
NZ_CP011454.1\|WP_082820935.1\|56584_57325_-\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|239945	cd04501, SGNH_hydrolase_like_4, Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.	3.51599e-75
NZ_CP011454.1\|WP_026848973.1\|67343_68567_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|224365	COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism].	3.89991e-41
NZ_CP011454.1\|WP_053333858.1\|50137_50449_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	2.28344e-16
NZ_CP011454.1\|WP_026848959.1\|48033_48633_-\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	3.99773e-82
NZ_CP011454.1\|WP_053333859.1\|58451_60695_+\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.56688e-74
NZ_CP011454.1\|WP_075071362.1\|51396_52959_+\|DUF1080-domain-containing-protein	gnl\|CDD\|368908	pfam06439, DUF1080, Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.	2.58594e-46
NZ_CP011454.1\|WP_043580067.1\|50467_51331_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.05861e-144

>NZ_CP011454.1|WP_026848965.1|53918_54500_-|RNA-polymerase-sigma-factor
MTIPAEPGLDGVPDPHSPPDALLIRQVLAGQTDAFAALVDRYHAQCLRVATHLLADSDDAEDVVQDAFVRAYRHLGSYHERDKFGGWLMRILVNQCRTRATKNARYVALDPELHTEHLSVSADDDALSRRAELAHAMSHLGAEAREALVLRFGEELSYEEMSALTGVGVSALKMRVQRACQRLRTLLTEHLSS
>NZ_CP011454.1|WP_026848964.1|53292_53922_-|hypothetical-protein
MKPGAFSPDHHDQPPTWIVDALRAPVASRPEARTRIMHAVRGLPTPRLLSAPMVQHASRWRRRGSLTGLGGVLLTAMLMLAATVRQSDQRDLSARVQPSAIVLGDSAVPVRGADSLAAIMQGRLLDTMKVVEYVVRGSDVRDVQVQRALRDQQANEAHVVPFEPTRLTRVSSTEWRVRALLPRDAIAVSFQVNDCTLDPVQVRELATEL
>NZ_CP011454.1|WP_158514664.1|53111_53288_-|hypothetical-protein
MALDRQTAVAGGITALTLLLGYVDLWRGGDIMAPMLLVLGYVIGVPATLLATSRDWQG
>NZ_CP011454.1|WP_075071362.1|51396_52959_+|DUF1080-domain-containing-protein
MMGALLAAFPLSAQQAPLGGWPQHSRARPAPPVVTPGPHVSVLPPRDAVVLFDGASLNAWMMSDSTPAKWRVVDGAFEVTPGTGTLVTRAAFGDVQLHIEFMSPNPSKGRDQDRGNSGVFFGGGRYEVQVLDSYKNPTYADGQAASLYGQYPPLVNASRVPGEWQSYDITYKRPRFAATGKVLQPAVLTVVHNGVLVQDHRALIGPTANGSRPPYEKHEDRLPLMLQDHDHPVRFRNVWVRNLEALPQETVQYRTPQGDVFRALGETDAVVKARAALGGNYRNVSNVIALGVAQSGVRQFREAITTFTRGLAALPATGRNVKDEAMLLRWRGHRYLSVREFAKAEADLTRGLALDGTNYGILFHLGVLRFHAGRFADAAALFARAQPVAPDGGERAGSTDWLWMSLARAGRVAEANAMLVKRIDQQPDPKPAPPGYAYVTRLKLYRGEITPEQLIGDNEVDDVSISTLAYGLGNWYMVKGDTVNARAAWQRAVQSGGWPGFGFNVAEAELRRLGARRRAR
>NZ_CP011454.1|WP_043580067.1|50467_51331_+|aldo/keto-reductase
MLSPIVAGVWRMASWNWTPQERLRWIEQCLELGVTSFDHADIYGAYTVEALFGEALALAPGLRQRMQLVTKCGIQLRVPARPDTRIKHYDTSAQHIVRSVENSLAALGTDHIERLLLHRPDALMDADEVAGAFERLQESGKVQQFGVSNFSVAQFELLHARFPLVTNQIEWHPLHRAPLHDGTLDQAQRMRAHPMIWSPLAGGALFTSHAEDAMRVRGVLTSIGAQYGVSAATVAFAWILRHPSRPHPIAGSRRIEAMQEAVAAVGVRLDAQEWTEILCAATGEEVP
>NZ_CP011454.1|WP_053333858.1|50137_50449_+|DUF1905-domain-containing-protein
MARSRFSATNAVGHSFSGTFTATLFRYPGKGGWTFVEVPDELAPPVTHGWGRTPVTASMGGVSWETSVWRGKDGRTLLALPKKVRGSLGEGDHVTCRIQFSAL
>NZ_CP011454.1|WP_026848961.1|49095_50085_-|YncE-family-protein
MRRAFLLTALLAIVTPLHAQVAGLTGTLVVTNKTPGTATIIDVGTGATLATLPTGNGPHEIVLTQDGRTAIVTDYGTGPAPGSTLTFIDVPRRKVTRTASLGEYRRPHGLVLLPGDSLVAVTSEANRALLLVRVATGEIPKVIPTNQNGSHMVGITASGTRGWTGNIGSNTVSELDLVAGTSLRTIAVPNQPEAINVTPDGAEVWVGSNQTGLISVVNSVSGTVSTAAEGFGWPYRVLYSPDSKLVLMPDLRKEELRFIDRASRKELARLSLPGKGPQGIIFAPNGTYAFLSFSTGSAVAIIDVAQRKIVGELKAGETPDGVVYTPRVF
>NZ_CP011454.1|WP_043580066.1|48649_49009_+|hypothetical-protein
MPPADLLVQIFGTKKSADTRKALRFFAERRVKTHFVDLAERAASLGELKRFTQKFGVEAILDRDSKRFADLGLRTALYGEEKWLSILADEPFMLKQPLVRLQNKLCVGVDEKLFKDWLA
>NZ_CP011454.1|WP_026848959.1|48033_48633_-|sugar-O-acetyltransferase
MTNAPETERTRMRAGLPYNSRDPELLALTHRARARLQQFEQTPSNATVPRLQVLRDLLGHIGDGVWIEAPFFCDYGAHISIGAHTFINMNVVMLDSANITIGEKVLIGPGVQLLTASHPVATAERLPAEWTPGSGQSPYVTTASPIVIGDGAWIGAGSLIMPGVTIGAGAVIGAGSVVTSDVPAGMLAFGNPCTVQRAV
>NZ_CP011454.1|WP_026848958.1|46501_47749_+|dicarboxylate/amino-acid:cation-symporter
MLKKIVRNLTFQVIVAVTLGVLLGVVAPDFAKSLKPIGDTFINLVKMVITPIIFLTIVHGIASMADLSKLGRVGGKALLYFEIVSTFALGIGLVVVNLTKPGKGLDISALAKGDVSKYLAAGEKQSMLEFFLHIVPSNVVAAFASGDLLPVVFFAVLFGVALTAVGDAGRDIADLLVRFQAVFFRIVAMVMVLAPVGAFGAMAYTVGTFGLKTLLPLGRLMLDVYVTMALFIFIVLGSICRAYGFRIWPFLRYIKEEILLVLGTSSSEAALPRMLEKLERYGCAKPVVGLVIPTGYSFNLDGTSIYLSMAAIFIAQVYGIDLPIGEQLTLLGILMLTSKGAAGVTGSGFIVLASTLAATRTVPVEGVALLLGVDRFMSEARAITNLIGNGVATLVVSRSENAFDDEKRAIAEAGM
>NZ_CP011454.1|WP_026848966.1|55246_56575_+|M28-family-peptidase
MVLLAPAVAAAQTVTAPPIAEDARIHEAVANASADRVKKDITTLVKFGTRHTLSDTMSTTRGIGAARRWIYGEFQSISKQCGGCLEVRYIEEVWKGSPTGRIKDDVNVVNVVAILRGATEPNRYIVHTGDIDSRVTDVMNGTSESPGANDNASGVAALLEAARLMSKHKYAASVAFVALSAEEQGLFGGEIVAKVAQKEGWRIDAVINNDMVGNSRGIDGVFENTKARVFAPGLPANTPPAELRRILTNGGELDTPSRQLARYIDLVADRYHPNMDVEIIYRLDRYGRGGHHTPFFNLGAAAVRLMEAHEDYTKQHQDLRTEKGIAYGDVLEGVDFDYAAKMTALDASVLMSLAWAPAAPDSATIRGSVQPSPTLRWKASPSPDVMGYRIYWRKPSEVNWTRSRFVGNVTEHTLKNVIIDNYFFGVAAVGKNGQESLVAFPR
>NZ_CP011454.1|WP_082820935.1|56584_57325_-|SGNH/GDSL-hydrolase-family-protein
MHMTPRSPRARRTTVVACATGLLLAVAFPPRVMSQSSSAVEFAGLARYRAANAALGAPQPGTSRVVFFGNSITEGWARHFATMFPGRPYVGRGISGQTTAQMLLRFRQDVVALKPAAVVILAGTNDIAGNTGPATLEEIQDNLAAMAELAQASGIKVLLCAILPVYDYPWKPGLQPAPKIIAINRWLKAYAAQRGATFVDYHTPFADERGGMRPEHAADGVHPTDAGYRIMAGIVEPLIQSALSKR
>NZ_CP011454.1|WP_158514665.1|57487_57895_+|hypothetical-protein
MGMGGVLLASVAVMAATPWSPRAVVQVTVNARCAGPNNTEITVSPWNVRLQQGDEIEWVIAANANSNDITVTPKETSDWPFATRGPFNAAKGRPARVNGMRQNGRGTYKYNIQLVCQSGNNPPDEVLIDPDIIVD
>NZ_CP011454.1|WP_145978920.1|57920_58391_+|hypothetical-protein
MRRVLGRGVAVAASITVVVALAACDSGGRAAPPASDREIKAKNADTITVTANCAAANQIDVDVNKWVVDMKPNGVVTFVVDTASSDDAVVTIEQKTPDQWPFADAPPFNPGKGSANGPKGGKAKAAKGEYHYNLRVVCGTAPNTRTVLIDPDIFVD
>NZ_CP011454.1|WP_053333859.1|58451_60695_+|serine/threonine-protein-kinase
MSAFPKHPARIGPYDIIQLLGEGGMGVVYEAEETAPVRRRVALKLVRAGLDDARDVLARFDAERRALAVMNHPGIARVLQAGSTENGEPYFAMELVRGLPLTEFCDTRRLAVRDRLLLFIGICEAVQHAHQKGVIHRDLKPSNILVTDEEGHPQPKIIDFGIAKALGPQSSEQVAKTLAGFAMGTVAYMSPEQASSTAMDVDTRADIYSLGVILYELLVGNLPVDPVEVGIYEFLARLASGNTLPPTPSVGLSTAIARSETIAQRRRTDPRHLRKELRGDLDWIVMKAMHPDRVHRFETANGLAADIKRHLANEPVTARPPSTRYRLSKFVQRHRVGVMTAGVASIMVVASSVVATVGFVQARRAERRAESDAAAAKQVTDFMVDLFRQSDPTVSRRGSVTAQAILEQGIKRVTTDLAAQPLLQSRLMQAMGTVQTALGRYPEARAMLQDVLQTRERLLGPDDVLVGETLTTLGEITRDFGELDDAEQYLTRALAIRENAYGATHVDVGQTLSMLAALRWKQTRYAEAESLYLRVLEIDGKVRTPDDPRTLRDLRGLAAVYRGQKRNAQSDSLWKVVLARQERALGSDHPDVGTTLNNIGAYAYLDGKYEEAATYYQRARPIFEKAYGTEHPLPVGVMNNEAEVLWKLKRYQVAEPLFRSALAAKERLYAPDNSSIAISLNGLAGVLRDSGRAAEAEPYYRRALSIREVNQRSADLAETLRDYAALLRATNRAVQATQYEERAAALK
>NZ_CP011454.1|WP_082820936.1|60740_62099_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MLRNVVYWVCHRCLHWFYREHRVEGLGRVPASGPVILVGNHPNDLSDVIAGLYVTPRPVRYIATVSVTTSWAARTMYQAMGVIPVARVRDARKMRAEGVDLAAVNQAANDTVAAALAQGDAITVFPEGGVHDVPEIGRLRTGVAKMVLTHLDAGAKNDVTIVPFGGQYEAPRTWGSDMLSVVGTPWSAREWVAAQPEGQRGAAAFTDALKASLLTVTRNAPTWEEAATRDEIVAAVAARLAPGNPLGATTTVLERAAQLAADAHSDGPSGVAVRIKTAAHTLAHAVERAGGIGSSSVDHARLLLALDVHAEQSLAPSFLLLGAAAPAAAIGWLVHAPILALVYRVAKKGATARTDVVPRCFAPGLYLVIAWWLVVAVLVAVGLALAGWSPLWALAVLVTLPRFGDLAIRWGNWLKGWRLVRRARSWSTAERVGLGEAAEAVRGVWEGESGGR
>NZ_CP011454.1|WP_026848970.1|62182_64156_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MTLISLGNAGVDFGASEIFRDISVTVAAGDRWAIVGRNGTGKTTLVRLITGTLQPTRGNVARMPGLRVALMDQHRRFPDDQSLWDIVADAFGDLRALEQSLAKQAANLEHDHSEGAMEKYGRDLERFEREGGYEMASKVDAILMGVGFDPEMAKVTRIGTLSGGERGRVALARQLATPSDLLLLDEPTNHLDLDTTAWLEQYLATTDRTVICISHDRAFLNAMADHVLHFEGGTAFAYTGSYESFVQQREERRLTQQRQFEKQQNKITSEMDYIARNLAGQNTRQAKGRRKLLARMPRLSAPIGADGVMALRLDAGNRSGDRVIEAKDVTVGVPTPNGPRTLVNNVTVVMERNEVVALVGPNGAGKSTLIKTLLGEMPPLDGEVKVGPSTTVAYYRQDVGHLPLDSTIYDAIANERPLWERRQVQGHLGRFGFSGDEVQRTVGTLSGGERARVAMALLTLSTNNLLILDEPTNHLDVESIEVLEDAVEGYEGSVLIVSHDRAVLRGLATQVWELRNNELQIFPGSFVEWEAMRAERITQETKQSRADDRKDSERAVRQREREKEQKEREKAAGGDPRKLLRTAEKALADAELRVATLESTIADLTEQLDDATLYDSPAGIKKAAALGKQLDEERELLEDAMHEWSTAEEYVSVLKKR
>NZ_CP011454.1|WP_145978921.1|64231_66436_+|hypothetical-protein
MRTSSSMMVRAVAGVAVALWLSAPVLGAQTAAPLRQLLQDASLRNRLPDSLISYKANVETEIAILLRREEGVEAVGAIEQVASRLRWNRAGGYEQRVQGYRAQQLGGNVSMLTLFQTGWINPVLYGNRLRVRPRSSNSRGQAAAVSRNRDGSDTLPAVHPLATDRDAYYTYSGGDTIVTMRAGDRVIPIAHVRVQPRPDVKGKVILFDGEMDLDASRGTLVRLRGHFLRTGASRSSLGSTLADAVAYVEYENGERNGQYWLPATQRIELQANSPLLGDGRAVIRIVSRFANMEVNDTVLDAATLAKADSLRALARRPLTYASTDSLNRFSAWRYTIGASTNGMHADDFQDIAPDRWRTTGPPRFDLSAPRPADVMHFNRVEGLFTGVGGKFALRDLAPGVVVRANAGYAWAEQTVRGRVAIERTRGPWSLELRGGRSMDITNDFRAPLDSGNTFAALSSLDSYDYVSRNFTALSAVRRIGARRWILRADVGYGDDRYRAAQYVRGPFGGDLYRANHGVDEGSYMRSAAVVEWHPDLNAESLKPGLGARVAYERGDGTLSWQRTEARLSGRRPVGPFMLLARGDVGMVTGSRIPSQQLFELGKYQNLPSYEDKQFAGSRAAALRASLQYTSKFLRNPIRVGQFWLPAVAPGLSVGAQSGWADAPTNAARASVDRLTVIDPTLLALWAPVATPTGRVRASVTAGFRFFGNALFVGATRPVDQSAKWRTLVGLGQQW
>NZ_CP011454.1|WP_026848972.1|66641_67148_+|hypothetical-protein
MQIRLKHHADGAVSLTCTRADGSTTWQRFTGPTAMVMPVHDLTHYAVESTLGYARGFYGLVAEGWAIQDFAKPWPRGPIPDEAREVELLVGFFDAERREGVTWSAEEFGAHAAVFIAATEARGKTAPSAVRLPSAEQLVAVRAVCADLLARWFATEPGGELVLEFGLV
>NZ_CP011454.1|WP_026848973.1|67343_68567_+|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MDASNHLLPTRRDFSGDDLIFTLNGKAQKRAAEGASVINATIGALYDDQGKLVVLDTVMGQWQQLTSGEIAPYAPIGGDPTFLLNLVQRHWPNISKLSVGVATPGGSGALALTLKNLLERGDTVLTAAPYWGPYSTLAVEAGQKLATVPYPDVHSGIDIGAWEAACRDILDAQGRLLVWLNDPCHNPTGRSFSKADRTALMDVLRDVASQGPVTLVLDLAYLDYARDPQDVRDALDDYAAFAAEGSVLVGACLSLSKAYTLYGARAGALVFPWSTDAALQGALITSCRGTWSNCARGPMSVLNRISKDDALKASLEQEHAQWRTLLAKRAAAVDAALKAEGFPGAAYDGGFFVTLDGGANPSATCDRMQQHDVFVVPLPEGLRVGICAMKAADAPRFAAAYAASMRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011454_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011454_2

4540336-4540447

Orphan

Consensus_repeat	Method
CCACCGCCGAAGAGAGCAGCGAACGAGGTGAGCGGGGCAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011454_2

>merge|NZ_CP011454|2|4540336-4540447|CRISPRCasFinder
CCACCGCCGAAGAGAGCAGCGAACGAGGTGAGCGGGGCAGAGCGGGCGTGTTCACAGCCCCAACACCGCGTCCACCGCCGAAGAGAGCAGCGAACGAGGTGAGCGGGGCAGA

>NZ_CP011454|2|2|4540336-4540447|CRISPRCasFinder
CCACCGCCGAAGAGAGCAGCGAACGAGGTGAGCGGGGCAGA	GCGGGCGTGTTCACAGCCCCAACACCGCGT
CCACCGCCGAAGAGAGCAGCGAACGAGGTGAGCGGGGCAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011454.1\|WP_075071577.1\|4550924_4552325_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236430
NZ_CP011454.1\|WP_026851001.1\|4536166_4536439_+\|zf-HC2-domain-containing-protein	unknown	unknown	gnl\|CDD\|274904
NZ_CP011454.1\|WP_075071575.1\|4533395_4534118_-\|cytochrome-b/b6-domain-containing-protein	unknown	unknown	gnl\|CDD\|226602
NZ_CP011454.1\|WP_026851007.1\|4545283_4546327_-\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|181535
NZ_CP011454.1\|WP_043581848.1\|4546602_4547172_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270349
NZ_CP011454.1\|WP_026851009.1\|4549369_4550971_+\|magnesium-protoporphyrin-IX-monomethyl-ester-anaerobic-oxidative-cyclase	unknown	unknown	gnl\|CDD\|131081
NZ_CP011454.1\|WP_026850999.1\|4535013_4535544_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP011454.1\|WP_043581782.1\|4547497_4549228_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349895
NZ_CP011454.1\|WP_026851005.1\|4541638_4542319_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP011454.1\|WP_158514936.1\|4532613_4533390_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239026
NZ_CP011454.1\|WP_053334620.1\|4543852_4544911_+\|lyase	unknown	unknown	gnl\|CDD\|226708
NZ_CP011454.1\|WP_053334618.1\|4540494_4541658_+\|UvrB/UvrC-motif-containing-protein	unknown	unknown	gnl\|CDD\|223399
NZ_CP011454.1\|WP_026851000.1\|4535540_4536170_+\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_CP011454.1\|WP_043581781.1\|4537359_4537896_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_053334616.1\|4537888_4538320_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011454.1\|WP_075071576.1\|4538397_4539960_+\|cryptochrome/photolyase-family-protein	unknown	unknown	gnl\|CDD\|225588
NZ_CP011454.1\|WP_053334619.1\|4542326_4543856_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|273593
NZ_CP011454.1\|WP_026851002.1\|4536665_4537256_-\|DUF4126-domain-containing-protein	unknown	unknown	gnl\|CDD\|379253
NZ_CP011454.1\|WP_026851011.1\|4552344_4552944_+\|bacteriochlorophyll-4-vinyl-reductase	unknown	unknown	gnl\|CDD\|131074
NZ_CP011454.1\|WP_053334615.1\|4534268_4534988_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|234717

Protein	Function_ID	Function_description	E-value
NZ_CP011454.1\|WP_075071577.1\|4550924_4552325_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236430	PRK09249, PRK09249, coproporphyrinogen dehydrogenase.	0
NZ_CP011454.1\|WP_026851001.1\|4536166_4536439_+\|zf-HC2-domain-containing-protein	gnl\|CDD\|274904	TIGR03988, antisig_RsrA, mycothiol system anti-sigma-R factor. Members of this family are the anti-sigma-R factor RsrA, which contains a CXXC motif as a thiol-disulphide redox switch. It interacts with sigma-R. It regulates and is regulated by the mycothiol system, which occurs in many actinomycetes. [Transcription, Transcription factors].	2.0172e-06
NZ_CP011454.1\|WP_075071575.1\|4533395_4534118_-\|cytochrome-b/b6-domain-containing-protein	gnl\|CDD\|226602	COG4117, COG4117, Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion].	2.41251e-34
NZ_CP011454.1\|WP_026851007.1\|4545283_4546327_-\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|181535	PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate synthase; Reviewed.	0
NZ_CP011454.1\|WP_043581848.1\|4546602_4547172_+\|hypothetical-protein	gnl\|CDD\|270349	cd13631, PBP2_Ct-PDT_like, Catalytic domain of prephenate dehydratase from Chlorobium tepidum and similar proteins, subgroup 2; the type 2 periplasmic binding protein fold. Prephenate dehydratase (PDT, EC:4.2.1.51) converts prephenate to phenylpyruvate through dehydration and decarboxylation reactions. PDT plays a key role in the biosynthesis of L-Phe in organisms that utilize the shikimate pathway. PDT is allosterically regulated by L-Phe and other amino acids. The catalytic PDT domain consists of two similar subdomains with a cleft in between, which hosts the highly conserved active site. In gram-postive bacteria and archaea, PDT is a monofunctional enzyme, consisting of a catalytic domain (PDT domain) and a regulatory domain (ACT) (aspartokinase, chorismate mustase domain). In gram-negative bacteria, PDT exists as fusion protein with chorismate mutase (CM), forming a bifunctional enzyme, P-protein (PheA). The CM in the P-protein catalyzes the pericycle isomerization of chorismate to prephenate that serves as a substrate for PDT. The CM and PDT are essentail enzymes for the biosynthesis of aromatic amino acids in microorganisms but are not found in humans. Thus, both CM and PDT can potentially serve as drug targets against microbial pathogens. The PDT domain has the same structural fold as the type 2 periplasmic binding proteins (PBP2), many of which are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.42536e-75
NZ_CP011454.1\|WP_026851009.1\|4549369_4550971_+\|magnesium-protoporphyrin-IX-monomethyl-ester-anaerobic-oxidative-cyclase	gnl\|CDD\|131081	TIGR02026, BchE, magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase. This model represents the cobalamin-dependent oxidative cyclase, a radical SAM enzyme responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions. This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under anaerobic conditions (a separate enzyme, AcsF, acts under aerobic conditions). This model identifies two clades of sequences, one from photosynthetic, non-cyanobacterial bacteria and another including Synechocystis and several non-photosynthetic bacteria. The function of the Synechocystis gene is supported by gene clustering with other photosynthetic genes, so the purpose of the gene in the non-photosynthetic bacteria is uncertain. Note that homologs of this gene are not found in plants which rely solely on the aerobic cyclase.	0
NZ_CP011454.1\|WP_026850999.1\|4535013_4535544_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.77473e-21
NZ_CP011454.1\|WP_043581782.1\|4547497_4549228_+\|M28-family-peptidase	gnl\|CDD\|349895	cd05643, M28_like, M28 Zn-peptidase-like. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They typically have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions. This protein subfamily conserves some of the metal-coordinating residues of the typically co-catalytic M28 family which might suggest binding of a single metal ion.	2.09978e-51
NZ_CP011454.1\|WP_026851005.1\|4541638_4542319_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	8.66373e-86
NZ_CP011454.1\|WP_158514936.1\|4532613_4533390_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239026	cd02108, bact_SO_family_Moco, bacterial subgroup of the sulfite oxidase (SO) family of molybdopterin binding domains. This domain is found in a variety of oxidoreductases. Common features of all known members of this family, like sulfite oxidase and nitrite reductase, are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	5.90902e-48
NZ_CP011454.1\|WP_053334620.1\|4543852_4544911_+\|lyase	gnl\|CDD\|226708	COG4257, Vgb, Streptogramin lyase [Defense mechanisms].	1.05928e-43
NZ_CP011454.1\|WP_053334618.1\|4540494_4541658_+\|UvrB/UvrC-motif-containing-protein	gnl\|CDD\|223399	COG0322, UvrC, Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair].	3.1503e-50
NZ_CP011454.1\|WP_026851000.1\|4535540_4536170_+\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	1.61929e-32
NZ_CP011454.1\|WP_075071576.1\|4538397_4539960_+\|cryptochrome/photolyase-family-protein	gnl\|CDD\|225588	COG3046, COG3046, Uncharacterized protein related to deoxyribodipyrimidine photolyase [General function prediction only].	0
NZ_CP011454.1\|WP_053334619.1\|4542326_4543856_+\|HAMP-domain-containing-protein	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	5.45706e-60
NZ_CP011454.1\|WP_026851002.1\|4536665_4537256_-\|DUF4126-domain-containing-protein	gnl\|CDD\|379253	pfam13548, DUF4126, Domain of unknown function (DUF4126).	1.09872e-32
NZ_CP011454.1\|WP_026851011.1\|4552344_4552944_+\|bacteriochlorophyll-4-vinyl-reductase	gnl\|CDD\|131074	TIGR02019, Bacteriochlorophyll_synthase_23_kDa_chain, bacteriochlorophyll 4-vinyl reductase. This model represents the component of bacteriochlorophyll synthetase responsible for reduction of the B-ring pendant ethylene (4-vinyl) group. It appears that this step must precede the reduction of ring D, at least by the "dark" protochlorophyllide reductase enzymes BchN, BchB and BchL. This family appears to be present in photosynthetic bacteria except for the cyanobacterial clade. Cyanobacteria must use a non-orthologous gene to carry out this required step for the biosynthesis of both bacteriochlorophyll and chlorophyll. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll].	2.51298e-46
NZ_CP011454.1\|WP_053334615.1\|4534268_4534988_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|234717	PRK00293, dipZ, thiol:disulfide interchange protein precursor; Provisional.	3.52327e-42

>NZ_CP011454.1|WP_075071576.1|4538397_4539960_+|cryptochrome/photolyase-family-protein
MTATTLAFVAPWECSRAVANIPREPREDVVVVLLESVAKGASLPWHRQKLVLILSAMRHFAASLEKAGHRVVLRKAPTYAEGLATLAQEFGATRVVATEGREQDMVDELERARTQLDALGVSLVLREDRGFLATREEFATWARGRKEHRMEWFYREMRRKHNILMEPDGTPSGGDWNFDADNRKPWPKGREVPPLWRTEPDAITREQMERVRGWSNRWGTVDTFALPVSRADAKAWLERFIVERLPEFGPYEDALVHGAPDLLHSSLSSLINVGLLHPLEVVKRAERAYREGHVPIASAEGFIRQILGWREYIRGMYWHLMPGLRTANALNAPLPLPQWFWAPDGEAYNGTTGGACEMRCLSDTIRQVRDYGRTHHIGRLMVQCNFATMLGVQPAALSRWFWAGFTDAYEWVELPNVAGMGTWGDGGALASKPYVASGAYVNRMSNYCGGCRYNVKQRTGPDACPMNFLYWDFMDRHRERFAKHPRMRMMTKHLDGMDADELVQIRTQAQQFRESLSYDG
>NZ_CP011454.1|WP_053334616.1|4537888_4538320_+|hypothetical-protein
MANGPGFGGIAARTVAALVLVFATYNPERWSYFHWAVAPLRSGEPTAGPASLKFLLGLALLGGWAIFLNATRRSIGLGGALLVLAMSGGLVWLLIDFGVVSAGSARGISYVVLVCTALLLAVGMNWSHLSRKLSGQVDIDPTD
>NZ_CP011454.1|WP_043581781.1|4537359_4537896_+|hypothetical-protein
MSRALSWLFVATLSLILLLQLRGLDAPLAAVTPGGIVAYELAFTVERARGILDIWRSAGVTEQARVSLGVDVGFLLVYPWFFWHTVRLLRRPGFSTPGTAFDRVGHLLGVAVLACMPLDALENWLLWRMLETGASSSGAALAGGAATLKFLLVLLTTLWCLAALSRRLTRSSSSPSHG
>NZ_CP011454.1|WP_026851002.1|4536665_4537256_-|DUF4126-domain-containing-protein
MGFGLAAAAGFRVFVPLLAAAIAAKTGVLTLSPGFSWLATTPALAALGTATVLEVGAYSVPWLDQLLDIIATPAAMLAGMLAAASVVVDLPPVLKWGAVLLAGGAAGVTQGATVFTRFKSTTLTGGVGNPVVSTAELVAAVATSALAIFVPVLTLVAVLLLFVFFTRRVHGIFFGRRAARVAGVAAGGPPKVPRGP
>NZ_CP011454.1|WP_026851001.1|4536166_4536439_+|zf-HC2-domain-containing-protein
MNTSSGTPIRAIDCDTTVRRLWDYLDEELESMPYAEVEAHLRDCVHCAEHFSFAQAFLGAVNTSLQQPQEAGSLREQVLQTLKAEGFRAA
>NZ_CP011454.1|WP_026851000.1|4535540_4536170_+|RNA-polymerase-sigma-factor
MTADSFSDGLVPGSPERDAAFEREALACLPHVARFAQSLTRNASEADDLTQETFLLAYRGYATFQPGGDVKRWLFSICHHAWLRISQRQQRMVLTAEGDDAELETMGAVMGHVAAQRSGIDRFVTSIDLGPAIREAVSQLEPNYRAVVQLVDVDGYAYDEAAAVLEIPVGTVRSRLFRARRLLQEALLEFARDAGVARVPSISRQDQSS
>NZ_CP011454.1|WP_026850999.1|4535013_4535544_+|TlpA-family-protein-disulfide-reductase
MSFSRTLKHTAAAVAVALALPVVGVQQVQAQVGGIAVGSMAPTAMTVPTLDNTSFDFAGVVGKQPVVMEFWATWCPLCRKLEPAMEAAKAKYGNRISFIHVGVPENQSAERQKAYVQQKGLKGMFLFDQDNKVSKAYQVPHTSFIVVLDAKGAVVYTGVGAEQDVDAAIRRALPNS
>NZ_CP011454.1|WP_053334615.1|4534268_4534988_+|sulfite-exporter-TauE/SafE-family-protein
MPLPDVAELLKSNPLLAYPVVFAGGLLTSLTPCIYPMIPITAAVVGGQQTAPSGARSSAPAWLMTGAYVTGLALAYAMLGLIAGLSGEIFGSISTNKWMLLGMANLLLLFALMMFDVIPVPVPQALMARAAGMNTGGRVLGALGMGAASGLVAAPCGAPVMATLLTWVAATHSAWRGFSYLFVFSLGMSALLVAVGLTAGNLSKLPRAGLWMVRVKTFFAVVMLGAAEYYLLQAGQVWF
>NZ_CP011454.1|WP_075071575.1|4533395_4534118_-|cytochrome-b/b6-domain-containing-protein
MTTPSASPRHHPIARATHWISAIAVTVMAMSGLRIFNAFPAFSPKGAGAWPWWPFEGMRAPAWATFGGWLGGARHWHFAMMWVLVINALVYLVHLYHRGRWRTIVPRVNTWRDAIEMARFYLFVRKDHPIQGKHNALQQYAYTTMLACGALLVVSGLAIWKPVTLGWITRLLGGYAYARWWHFSAMLLLALLVLVHVIMVFTVDPYAIRAMTTGKYDDEHWSPEARNARPLFNLWPRKDQ
>NZ_CP011454.1|WP_158514936.1|4532613_4533390_-|molybdopterin-dependent-oxidoreductase
MVKRILTQRVEQAAEQLRESGALDRRGFMRLMSLGVVAPLVTACGLPGSEGAQRLLKSAEKNNERLERWLLKTANASDRVPRGVPIAGNAFPSYFVSRQMPVWDAATMGNWTLTVDGAVQAPRTFTWDEVRRLSTRSHTVQHYCVEGWNAAAQFQGIPFTQLARLVKPTADAGFVDFSSFDSGYHESWDVESTMHPQTLVVVAKDGQALSPAYGAPARVHSPIKLGYKNTKYLTRITFMSAPNGGYWSSKGYEWFGGT
>NZ_CP011454.1|WP_053334618.1|4540494_4541658_+|UvrB/UvrC-motif-containing-protein
MSLEPAPRLHTKPPQTTPAHRKQLRALVRAGVENRPGVYRMLGPTGTVIYVGQSRVLRTRLLSYFRATGRRNKAARILRHAFQIEWEYTNTEFGALLRELRLIKQYRPHFNTMMVMDEWPRAYVALTGGTVPGLRVVARSDDPGAVALFGPFRRVAHLREAVRALAEATGLRDCTLEDTVRGSGSQRGSALWFSDDPATRPKAVPRSRAPGCLRHDLGTCAGPCIGQGQSAAYRTAALTLREFLDGRSDGPVQQLEQAMQQAAAELAFEKAGILRDRLALVRWLHERVQHFHANVDRLTFRYHAVGHADAEWVYLIRRGTVRAEVRAPRTAEEQEAFEALVTRIYDGTDPTGADIPTHDLDEFYLVASWFRRRAEEKKRTRHAHTRR
>NZ_CP011454.1|WP_026851005.1|4541638_4542319_+|response-regulator-transcription-factor
MRILVVEDDPRLQALIARGLREESYAVDTVENGHEAITQAAVNSYDAIVLDVMLPGLDGLQVVQRLRERRIHTPVLMLTARDTVADRIAGLDAGADDYLVKPFDFGELLARLRALLRRPEAVQPMRVQVADLEIDMQAHSVHRSGVALTLTAKEYALLELLARHAGHVVSRADIVAHVWDDNHDPFSNAVEVYVNRLRGKIDREPFTPLLHTRRGAGYILTDTPPV
>NZ_CP011454.1|WP_053334619.1|4542326_4543856_+|HAMP-domain-containing-protein
MTTPVRMSILLRFTLWNASVVALILVTFAAAGWFTFERVVQQRAATVVRESARAVAGAILAERRAAAARGEVESVRGEHEQAVLRELRVGDLDIIITDEAEQLMAAQSDVVLPAAVRTLMAEVRAARDAGRLTDSAVVVRPVTLPAGPARAALLRIEPEANDEEEPALLITAIRPDMDDLQLLRQVRTTIFFAIPMALLVSIVAGFLLARRSLAPLEAIVSRTASITAQNLDSRLKVVNPHDELGRLAQIINDLLGRVDDAFRTQRQFVADASHELRTPIAIIRGEADVTLRRAERSPQEYRESLGVIHEESIRLSRIVDDLFLLARVDAAGHAVRREDVNISDLVTDAVRSVRTLADSQQVTLLAAEQPTATVRGDAVLLRRLLLNLLDNALKHAPPGSTVQVQQQRVGNVVHVSVGDQGPGIPADQRERVFERFVHGVQGSGNGGPGAAHSSATGASGVTGTGAGLGLAIAQAIAHAHEGQITLLDAPLGATFDVALPLLPVSGDAV
>NZ_CP011454.1|WP_053334620.1|4543852_4544911_+|lyase
MMPPLSRWSRTGAALVALSVPALPAVLPAQARAATADTVALTEWDVPWGAATRPRDPSVDPQGRVWFVGQEGNYVARFDPKTKKFERFEIDPGTNPHTVNVDPTGDAWYAGNRNGMIGRIDGKTGKITRYPMPEAAAKDPHTITFTPKGDLWFTLQNSNMVGFLDKQSGAVKVIPMPTPRSRPYGIVLDKSGRPWFNLFGTNKLGTIDPTSLRVREYVLPDERARGRRIALTTDGAVWYGDYSRGYVGRLDPVSGAVKEWPLPGGGTSMPYAMTVDDADRLWLVETGRQPNRLVAFDPRSNSFVAQIDLGPAVPNTVRHMVFDKTTRSIWFGSDRGTIGRAAVPAPGRKPIG
>NZ_CP011454.1|WP_026851007.1|4545283_4546327_-|3-deoxy-7-phosphoheptulonate-synthase
MIIVTTAGITPEALDRIIEHVEAAGLRTHVSRGEQRTIVGCIGDEGALSEHGLTQLDGVERVMPVLKPYKIASREFSVGNTAIRLGDPADTVIGGRDVVVMAGPCSVEGREMMFDTARAVQQAGARLLRGGAFKPRSSPYAFQGMGEDGLKILADVRAETGMPIVTEVMDPRQVELVASYADVMQIGARNMQNFPLLSEVGKVQRPVLLKRGLSGTITELLMAAEYVLAQGNGDVMLCERGIRTYETATRNTMDVAAIPVLKRETHLPVIVDPSHAGGRAHLVTPLALAAVAAGADGLIVEVHPDPKCAKSDGEQSLEFSAFTQLMQQVQAVARAIGRECTWPSEVS
>NZ_CP011454.1|WP_043581848.1|4546602_4547172_+|hypothetical-protein
MTESDSPRVAFQGELGAFSEMAIRQQWPSGAVAVPCLTFPEAVAQVMDGRAHFGIIPVENAIVGPVKVAMDALAAAGDALVVRAETRVPVHLCLMAPAGATLAELREIHSHPVALAQCRIFFARHGWLQSAPHADTAGAARDVAQRGDRTQGAVASEMAAERYGLEVIARRIEDVAANWTRFVVVSRAG
>NZ_CP011454.1|WP_043581782.1|4547497_4549228_+|M28-family-peptidase
MTLPVTPRRVLAAAAATLFATELTAQSAATPAPFAPITQAVHRDVNGDRAFTTVDFVQRRFRLPGNEGFDLAIDTVAALLRAAGYVNETEAKPTDRLVYRIESRDMPNEAWTPHDARITIAGRSTPLQTLAGNLNMIAINSVSTPPNGVTAELVDVGAGSDSAFKANTVAGRIVLSTGNARLVLPRAQRYGALGVLNTQTLPAYNQQGKHPRAIQFTGIARDTIRPGWVLFVSSVTRDSLQAALKQGAVQLHVLINTSFARRPERTLVAEIRGTTAPNERFVYSAHVQEPGANDNASGVGTLAEMARVAASLVQRGIAQPRRTLTFLWGDEIRSTDRYLKEDSTRRAGVKWGMSLDMVGENTALTGGTFLIEKMPDPSAVWVRGDDQHSEWGGKPIPENEIKAYWFNDFVRNRCLDRARTTKWVVKANPFEGGSDHTPFLNADIPAVLLWHFTDVFYHTDLDRIENVSATTLANVGACALTTGLLLTQGTPVIARAALEELTVTAQQALRTQAALSRDTLARGGNVQYEQHILNVWRDYYLAALDRVADIAVGPVDLRTALANAKRRVRAATVTLQ
>NZ_CP011454.1|WP_026851009.1|4549369_4550971_+|magnesium-protoporphyrin-IX-monomethyl-ester-anaerobic-oxidative-cyclase
MKLVFVQPNYHAGGAEIAGNWPPGWVAYIGGALKHAGFTDITFVDAMTNHIDDESLRQRLIELKPDAVLATAITPMIYQAQRTLQIAREVAPQAHTILGGIHPTFMYQQVFNEAPWIDYIVRGEGEEIIVELMQHLRDGTALATRRDIRGIAFVEDGQVVATPARPPIANLDDLTPDWSLLEWNKYIYIPLNCRVAVPNFARGCPFTCRFCSQWKFWRKYRTRDPKKFVDEIETLVRDHKVGFFILADEEPTINKKKFIALCEELIARDLPVHWGINTRVTDILRDEKELPLYRKAGLVHVSLGTEAAAQLKLDRFRKQTTLEQNKRAIKMLKDAGMIAEAQFIIGLENETQETIEETYKYSQDWQPDMANWNMYTPWPFAELFQELGERVEVRDYAKYNFVTPIIQPDEMTRDQVLKGVLRNYARFYAKKAFLSYPWQKDPFKRKYLRGCLRAFAKTTINKKFYDLERLKFNGTGLESDFGFDEDKVFTREELRTMSEARPEFAADVDFSGSVPVLGHAAVRPQEEEAVRAC
>NZ_CP011454.1|WP_075071577.1|4550924_4552325_+|oxygen-independent-coproporphyrinogen-III-oxidase
MPPFGRRKRKPSVPVDLQVPDVSPALLAKYDIPGPRYTSYPAVPDWRGAFDADAWAGHLGVLGTTDAPLALYVHLPFCASRCLYCGCNATVTTRSEIVDRYLTRLYRELEMLAQAIGSAPRVVEMHWGGGTPNFLTDMQVERLFSRLQQTFGIDARTECSVEADPRLVTRDQLRTFRQLGFSRISYGVQDVDTEVQEAIGRVQPVDMVRNCVEMAREEGFAGLNLDLIYGLPQQTPSSFANSIETALSFNPDRVACFGYAHVPWMKSHQKRIDENALPRAWDRFRLFQQAVQRFTDDGYRWIGIDHFARPEDPLALAADAGRLHRNFMGYTTRSGDHLLGIGTSSISEVDGWFGQNAADLGPWQRDIDANRLPLSRGHVLSDDDRARGAAVSHLMCNAELPFDLFVGDIDDLVDRYEQFAADGLVMFETDRITVTPLGRFFLRNLAFPLDAYRGATDGPRRFSRAV
>NZ_CP011454.1|WP_026851011.1|4552344_4552944_+|bacteriochlorophyll-4-vinyl-reductase
MRAVQPARIGPNTIIQIAQVLRDRFGESTAATLLFESTGYAMGALPAAMVDEREAQAFVQTVMRSLGEDRGARVLHEAGHRTATYLMANRIPHAAQWVMKLLPKRAGLAVLLKAMQANAWTFAGSGSFGVKRTPKGAELTFHACAMCRDMHSHGPVCDFYAGTFEHLIRSLVSPRATVREVECQALGAHCCRFEVLAIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011454_2	2.1\|4540377\|30\|NZ_CP011454\|CRISPRCasFinder	4540377-4540406	30	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	41057-41086	8	0.733

1. spacer 2.1|4540377|30|NZ_CP011454|CRISPRCasFinder matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gcgggcgtgttcacagccccaacaccgcgt	CRISPR spacer
gtgccaatgttcacatccccaacaccgcac	Protospacer
*.*   .******** ************..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2131920 : 2141742

Tetraselmis_virus(14.29%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053334560.1\|2131920_2132892_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	9.8e-35	34.0
WP_053334541.1\|2132924_2133557_-	HAD hydrolase family protein	NA	NA	NA	NA
WP_026850827.1\|2133556_2134390_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.3e-39	39.3
WP_026850826.1\|2134386_2136069_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.1e-163	53.0
WP_053334540.1\|2136111_2136885_-	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_043581654.1\|2137000_2137945_+	TerC family protein	K4F9T9	Cronobacter_phage	1.4e-41	36.5
WP_026850825.1\|2137989_2138589_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.2e-61	56.8
WP_053334539.1\|2138596_2139532_-	site-specific tyrosine recombinase XerD	A0A2K9VF00	Mycobacterium_phage	2.0e-16	31.7
WP_053334538.1\|2139528_2140143_-	DedA family protein	NA	NA	NA	NA
WP_026850823.1\|2140180_2140663_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_026850822.1\|2140683_2141742_-	dehypoxanthine futalosine cyclase	A9ZMK9	Mamastrovirus	5.9e-17	37.8

DBSCAN-SWA_2

4570872 : 4605031

Staphylococcus_phage(33.33%)

holin,protease,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026851024.1\|4570872_4571244_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_026851025.1\|4571268_4572261_-	WYL domain-containing protein	NA	NA	NA	NA
WP_026851026.1\|4572257_4573391_-	WYL domain-containing protein	NA	NA	NA	NA
WP_053334627.1\|4573463_4574711_-	hypothetical protein	NA	NA	NA	NA
WP_075071709.1\|4574736_4576215_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	3.2e-37	32.8
WP_043581785.1\|4576294_4576564_-	hypothetical protein	NA	NA	NA	NA
WP_026851027.1\|4576715_4577183_-	hypothetical protein	NA	NA	NA	NA
WP_158514937.1\|4577197_4578373_+	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	6.8e-06	23.8
WP_026851029.1\|4578937_4580374_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_043581786.1\|4580573_4581563_+	hypothetical protein	NA	NA	NA	NA
WP_082821516.1\|4581559_4582786_+	hypothetical protein	NA	NA	NA	NA
WP_082821517.1\|4582797_4585020_+	Ig-like domain-containing protein	NA	NA	NA	NA
WP_026851033.1\|4585104_4585857_-	hypothetical protein	NA	NA	NA	NA
WP_053334628.1\|4585967_4587812_+	serine/threonine protein kinase	A0A2K9L4D5	Tupanvirus	1.3e-14	27.0
WP_026851034.1\|4587892_4591429_-	hypothetical protein	NA	NA	NA	NA
WP_053334629.1\|4591440_4592154_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_026851035.1\|4592238_4593606_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_075071580.1\|4593850_4595608_+	hypothetical protein	NA	NA	NA	NA
WP_026848842.1\|4595935_4597282_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_026848843.1\|4597485_4597992_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_026848844.1\|4597994_4599473_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_158514938.1\|4599550_4600018_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_026848846.1\|4600100_4600805_+	virulence protein SciE type	NA	NA	NA	NA
WP_026848847.1\|4600831_4602676_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_043580046.1\|4602694_4603183_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_026848848.1\|4603186_4605031_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011454

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection