CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP013731	Burkholderia cepacia JBK9 chromosome 2, complete sequence	0 crisprs	cas3,csa3,WYL,DinG	1
NZ_CP013730	Burkholderia cepacia JBK9 chromosome 1, complete sequence	1 crisprs	DinG,WYL,DEDDh,csa3,cas3	7
NZ_CP013732	Burkholderia cepacia JBK9 chromosome 3, complete sequence	0 crisprs	RT,WYL,csa3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3062683 : 3143198

uncultured_Caudovirales_phage(18.18%)

plate,protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059240496.1\|3062683_3064657_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	2.9e-102	42.3
WP_059240497.1\|3064742_3065210_+	OsmC family protein	NA	NA	NA	NA
WP_059240498.1\|3065225_3066632_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_081052035.1\|3067264_3068884_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-25	31.0
WP_059240501.1\|3069350_3071381_-	TonB-dependent receptor	NA	NA	NA	NA
WP_059240502.1\|3072022_3072529_+	6,7-dimethyl-8-ribityllumazine synthase	NA	NA	NA	NA
WP_059240503.1\|3072634_3073066_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_059240504.1\|3073062_3073980_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_059240988.1\|3074281_3075247_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059240505.1\|3075299_3076394_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_059240506.1\|3076464_3077397_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081052036.1\|3077431_3079234_-	amino acid ABC transporter permease/ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-30	37.3
WP_059240507.1\|3079295_3080648_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_059240508.1\|3080655_3081705_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_059240509.1\|3081757_3082705_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059240510.1\|3082763_3083324_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_059240511.1\|3083803_3084727_-	recombination-associated protein RdgC	A0A218M310	Acidovorax_phage	7.3e-56	40.3
WP_081052037.1\|3085160_3086231_+	hypothetical protein	NA	NA	NA	NA
WP_059240991.1\|3086495_3086972_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_059240512.1\|3087098_3088133_-	deacylase	NA	NA	NA	NA
WP_059240513.1\|3088229_3089135_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059240514.1\|3089253_3089835_+	flavodoxin family protein	NA	NA	NA	NA
WP_059240515.1\|3089918_3090974_+	aldo/keto reductase	NA	NA	NA	NA
WP_081052073.1\|3091254_3091713_+	MEKHLA domain-containing protein	NA	NA	NA	NA
WP_059240517.1\|3091884_3092268_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_059240518.1\|3092437_3092713_-	hypothetical protein	NA	NA	NA	NA
WP_059240519.1\|3092976_3094527_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	4.4e-21	38.0
WP_059240520.1\|3095017_3097897_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_059240521.1\|3097893_3098598_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_059240522.1\|3098594_3099854_+	cytochrome c	NA	NA	NA	NA
WP_059240523.1\|3100933_3101425_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_059240524.1\|3101835_3103047_-	porin	NA	NA	NA	NA
WP_059240525.1\|3103270_3103849_-	hypothetical protein	NA	NA	NA	NA
WP_059240526.1\|3104145_3105234_+	hypothetical protein	NA	NA	NA	NA
WP_059240527.1\|3105254_3106670_-	HAMP domain-containing protein	Q6XM27	Feldmannia_irregularis_virus	4.1e-05	31.1
WP_059240528.1\|3106669_3107383_-	response regulator	W8CYM9	Bacillus_phage	5.0e-28	31.0
WP_059240529.1\|3107540_3108746_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059240992.1\|3108742_3109837_+	iron ABC transporter permease	NA	NA	NA	NA
WP_059240530.1\|3109833_3110661_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.4e-11	30.3
WP_059240531.1\|3110697_3113067_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_059240532.1\|3113108_3113789_+	Fe2+-dependent dioxygenase	A0A0E3G1Q6	Synechococcus_phage	1.7e-09	32.7
WP_081052074.1\|3115514_3117464_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_155627307.1\|3117715_3119359_+	peptidase	NA	NA	NA	NA
WP_059240535.1\|3119372_3119774_+	hypothetical protein	NA	NA	NA	NA
WP_155627286.1\|3119952_3122871_-	hypothetical protein	NA	NA	NA	NA
WP_059234118.1\|3123901_3125392_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_059240538.1\|3125596_3127087_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_155627287.1\|3127391_3128189_-	hypothetical protein	NA	NA	NA	NA
WP_059240539.1\|3128188_3132763_-	hypothetical protein	NA	NA	NA	NA
WP_059240540.1\|3132759_3134058_-	hypothetical protein	NA	NA	NA	NA
WP_059240541.1\|3134074_3134698_-	hypothetical protein	NA	NA	NA	NA
WP_059240542.1\|3134754_3137028_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.6e-27	26.4
WP_059240543.1\|3137024_3139673_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.6e-77	29.3
WP_059240993.1\|3139685_3140777_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_059240544.1\|3140773_3142645_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059240545.1\|3142649_3143198_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013730

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013730_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013730_1

2854573-2854670

Orphan

Consensus_repeat	Method
ACCGGCCTGTCGTCGACCAACGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013730_1

>merge|NZ_CP013730|1|2854573-2854670|CRISPRCasFinder
ACCGGCCTGTCGTCGACCAACGAAGCGCTGGGCTCGCTGTCGACGTCCACGTCGACGAGCGTGACGTCGCTGTCAACCGGCCTGTCGACGACCAACGA

>NZ_CP013730|1|1|2854573-2854670|CRISPRCasFinder
ACCGGCCTGTCGTCGACCAACGA	AGCGCTGGGCTCGCTGTCGACGTCCACGTCGACGAGCGTGACGTCGCTGTCA
ACCGGCCTGTCGACGACCAACGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013730.1\|WP_059235141.1\|2863544_2864303_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP013730.1\|WP_059235127.1\|2849639_2850557_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP013730.1\|WP_059235114.1\|2841799_2843110_-\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP013730.1\|WP_059235133.1\|2857333_2858644_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
NZ_CP013730.1\|WP_059235148.1\|2866112_2866544_+\|biopolymer-transporter-ExbD	unknown	unknown	gnl\|CDD\|223917
NZ_CP013730.1\|WP_059236834.1\|2861395_2862421_-\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176207
NZ_CP013730.1\|WP_059235125.1\|2848541_2849510_-\|agmatinase	unknown	unknown	gnl\|CDD\|235011
NZ_CP013730.1\|WP_059236830.1\|2847276_2847954_-\|DUF159-family-protein	unknown	unknown	gnl\|CDD\|376837
NZ_CP013730.1\|WP_059236832.1\|2855936_2857328_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235660
NZ_CP013730.1\|WP_059235138.1\|2859688_2860921_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	unknown	unknown	gnl\|CDD\|223997
NZ_CP013730.1\|WP_081051910.1\|2865323_2866109_+\|biopolymer-transporter-ExbB	unknown	unknown	gnl\|CDD\|131843
NZ_CP013730.1\|WP_059235140.1\|2862586_2863531_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176163
NZ_CP013730.1\|WP_059235136.1\|2858645_2859686_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP013730.1\|WP_059235121.1\|2845543_2846974_-\|cytosine-permease	unknown	unknown	gnl\|CDD\|271377
NZ_CP013730.1\|WP_059235143.1\|2864629_2865265_+\|energy-transducer-TonB	unknown	unknown	gnl\|CDD\|367555
NZ_CP013730.1\|WP_059235119.1\|2844314_2845385_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP013730.1\|WP_059235116.1\|2843299_2844256_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP013730.1\|WP_059235123.1\|2848084_2848549_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NZ_CP013730.1\|WP_059235112.1\|2840496_2841768_-\|Zn-dependent-hydrolase	unknown	unknown	gnl\|CDD\|237250
NZ_CP013730.1\|WP_059235129.1\|2850584_2851214_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187560

Protein	Function_ID	Function_description	E-value
NZ_CP013730.1\|WP_059235141.1\|2863544_2864303_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.18733e-74
NZ_CP013730.1\|WP_059235127.1\|2849639_2850557_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.86309e-35
NZ_CP013730.1\|WP_059235114.1\|2841799_2843110_-\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.52243e-147
NZ_CP013730.1\|WP_059235133.1\|2857333_2858644_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	5.64647e-178
NZ_CP013730.1\|WP_059235148.1\|2866112_2866544_+\|biopolymer-transporter-ExbD	gnl\|CDD\|223917	COG0848, ExbD, Biopolymer transport protein [Intracellular trafficking and secretion].	2.68376e-31
NZ_CP013730.1\|WP_059236834.1\|2861395_2862421_-\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176207	cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes, or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.05432e-171
NZ_CP013730.1\|WP_059235125.1\|2848541_2849510_-\|agmatinase	gnl\|CDD\|235011	PRK02190, PRK02190, agmatinase; Provisional.	0
NZ_CP013730.1\|WP_059236830.1\|2847276_2847954_-\|DUF159-family-protein	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	1.23229e-15
NZ_CP013730.1\|WP_059236832.1\|2855936_2857328_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235660	PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated.	0
NZ_CP013730.1\|WP_059235138.1\|2859688_2860921_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	gnl\|CDD\|223997	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion].	6.41429e-146
NZ_CP013730.1\|WP_081051910.1\|2865323_2866109_+\|biopolymer-transporter-ExbB	gnl\|CDD\|131843	TIGR02796, Protein_TolQ, TolQ protein. TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	2.89741e-43
NZ_CP013730.1\|WP_059235140.1\|2862586_2863531_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176163	cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.21031e-105
NZ_CP013730.1\|WP_059235136.1\|2858645_2859686_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
NZ_CP013730.1\|WP_059235121.1\|2845543_2846974_-\|cytosine-permease	gnl\|CDD\|271377	cd11484, SLC-NCS1sbd_CobB-like, nucleobase-cation-symport-1 (NCS1) transporter CobB-like; solute-binding domain. This NCS1 subfamily includes Escherichia coli CodB (cytosine permease), and the Saccharomyces cerevisiae transporters: Fcy21p (Purine-cytosine permease), and vitamin B6 transporter Tpn1. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and solute carrier 6 family neurotransmitter transporters (SLC6s).	3.50351e-95
NZ_CP013730.1\|WP_059235143.1\|2864629_2865265_+\|energy-transducer-TonB	gnl\|CDD\|367555	pfam03544, TonB_C, Gram-negative bacterial TonB protein C-terminal. The TonB_C domain is the well-characterized C-terminal region of the TonB receptor molecule. This protein is bound to an inner membrane-bound protein ExbB via a globular domain and has a flexible middle region that is likely to help in positioning the C-terminal domain into the iron-transporter barrel in the outer membrane. TonB_C interacts with the N-terminal TonB box of the outer membrane transporter that binds the Fe3+-siderophore complex. The barrel of the transporter, consisting of 22 beta-sheets and an inside plug, binds the iron complex in the barrel entrance.	8.83056e-13
NZ_CP013730.1\|WP_059235119.1\|2844314_2845385_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	4.99211e-72
NZ_CP013730.1\|WP_059235116.1\|2843299_2844256_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	7.49782e-42
NZ_CP013730.1\|WP_059235123.1\|2848084_2848549_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	6.99195e-10
NZ_CP013730.1\|WP_059235112.1\|2840496_2841768_-\|Zn-dependent-hydrolase	gnl\|CDD\|237250	PRK12893, PRK12893, Zn-dependent hydrolase.	0
NZ_CP013730.1\|WP_059235129.1\|2850584_2851214_-\|NAD(P)H-binding-protein	gnl\|CDD\|187560	cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs. Atypical SDRs in this subgroup include CC3 (also known as TIP30) which is implicated in tumor suppression. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine rich NAD(P)-binding motif that resembles the extended SDRs, and have an active site triad of the SDRs (YXXXK and upstream Ser), although the upstream Asn of the usual SDR active site is substituted with Asp. For CC3, the Tyr of the triad is displaced compared to the usual SDRs and the protein is monomeric, both these observations suggest that the usual SDR catalytic activity is not present. NADP appears to serve an important role as a ligand, and may be important in the interaction with other macromolecules. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.8625e-67

>NZ_CP013730.1|WP_059235129.1|2850584_2851214_-|NAD(P)H-binding-protein
MKLLLVGATGLVGRHVLEVALADSRVDQVVVLARRPLSPHPKMRALEVDFDQLPAAADGWQADAVICTLGTTMRAAGSQAAFRRVDHDYPLAVARLAHRHGTPTYVLNSALGADAASRIFYNRVKGEVEQALAGVGFASLTYVRPGLIGGSRDEFRFGERLFVFALNAAGPMLPAKWRVNPASRIARALVDAAIDAWPGVHVVASDRLA
>NZ_CP013730.1|WP_059235127.1|2849639_2850557_+|LysR-family-transcriptional-regulator
MLTRLRDMDLQLLRLFLTIVESGGFSAAQGTLGMAPSTISTQMAKLETRLGFRLCDRGKSGFRLTPKGERVLQSTRRLLQAMDVFTRDTQHVSDTMLGELRIGLSERLAPDVVESIAAAVGRFREQAPDVLIEMIAIPPDELERRLLKGELQLAIGYFSGHQAGLHYAPLFVEHQSLHCGARHPLFAKKSVSVNDIARTSNVARLYKTNTSGAALRNAQPTAFSENVDADVIFILSGAHVGFLPDHVAAPWVAAGKMRRLLASKLSHTVEFQLATPRNCDGSEALDAFTAALAEQFGELDGCAGG
>NZ_CP013730.1|WP_059235125.1|2848541_2849510_-|agmatinase
MSQNDFAFTRDSLYGTQAEPTFAGATSFMRRRFSRDLDGVDLAITGVPFDSAASHRPGTRFGPRGLRIASTGIAWERPWPWSFDPFDVLAAVDYGDCAFDLGQPESVPGAIERHADAILASGCAMLTLGGDHFITYPLLKAHAKVHGPLSLVHFDAHTDTWPDRDVKRIDHGTMFWHAAREGWVVPERSAQIGIRTTNDEPMGFDIQDARRVHASTPAAVAARIRERVGDHPVYLTFDIDCLDPAFAPGTGTPVSGGLSSHQAFEILRHLDGINLVGMDVVEVSPPYDHAEITSLAGATIALELICLYASRRRQTREASIDG
>NZ_CP013730.1|WP_059235123.1|2848084_2848549_-|GNAT-family-N-acetyltransferase
MDDLIWRKAVPGDAAACIALRGRTRENALTEAQLRDLGITAESWDAGIRDGLFSGHACFANGTMVGYCFGDTGSGEIVVLAMLPAYEGAGIGKRLLRRVIDDFAASGFTSLFLGCSTDPASRSYGFYRHLGWIPTGQLDEAGDEILTLRVGSST
>NZ_CP013730.1|WP_059236830.1|2847276_2847954_-|DUF159-family-protein
MCTHYRAPGEDPGISELKIGIGDLYRRDPWAPDVYPDYAAPVACAEGDSLAVVGAVFGFWPKFMQPERLDEHGRKKKKLDTVNARTETVGSSRLYGKAWRNGQRCLIPVRWICEPCYETGRNVWHRIGVDGWQPYCVAGIWRRYEDSDGRACIGMTMLTVNADDHPLFARMHRPGDEKRGVVILRHDDYDEWLHGRDIEAARRMLNLLPAGDMTAAPDQAPPAAT
>NZ_CP013730.1|WP_059235121.1|2845543_2846974_-|cytosine-permease
MSTNSSGKAGGLIEVRSIDFIPDAERHGGLLSQFTLWLSANMQITAIVTGALAVVLGGDVFWSLVALLLGQLVGGAVMALHGAQGPQLGLPQMISSRVQFGVYGAMIPIVLVCLMYIGFSASGSVLAGQAVAQLLHVDDAAGILLFAAVIVVLTVFGYRAIHFVGRIASVVGIVAFVYMFTQLFANHDVGALLANRHFSLASFLLSMSLSASWQIAFGPYVADYSRYLPRSTSSVATFLAVGLGSVIGAQAAMVFGVFAAALAGGQFAHHEVAYIVGLGSTGAVAALLYFSIAFGKVTVTALNAYGSFMSMATIVSGFRGKGAVSSKSRLVYIFGMICVSTLIALAGRHSFLKEFTAFILFLLAFFTPWSAINLVDYYCFTRSRYDVPALSDPDGRYGRWNAMAITIYVVGILVQLPFMSTHIYTGPLVDALGGTDISWILGLIVPAVLYYIGARASRRSIPERLILPLERGEVHH
>NZ_CP013730.1|WP_059235119.1|2844314_2845385_-|porin
MTKQLEARGRDCSVRPVHAGLRMTVAVACLAGSGTALAQDGVTLYGVIDEFAQYVNTGNGYTAAINSGGQWGSRFGLKGGEDIGGGQKIEFALENGFNPNDGSLASAGSMFNRQAWVGLAGQWGKVRAGRQNSPLFNDQGGQDAFGGVTQASGMDNLTVFAFRTSNTLSYQSPEIAGFQGGLYFGFGDAGGVRSAGSSQQFDLTYEHGPFGAFVAGQWLKNATAATTDRTIMAGASYEIGKATVYGGFSAVKWADFGIDSRVYGLSVKYQFNPANTIALGYAYLHDQSSQGNNAEQLGLMYEYDLSKRTSFYGALSYLRNRNQAGYTLAGAANPGLPLAYPGANARGVQLGIVHRF
>NZ_CP013730.1|WP_059235116.1|2843299_2844256_+|LysR-family-transcriptional-regulator
MRPDLAPFLNDRLDWNLLRTYLVIMQERSVSRAAARLHVTQPAVSQALRRLEETLERRLIERRGAHFAPTPAGEAVYRIASDIYGGISRLETEIDDSTADLTGSIRLLTVSRIESPVYDEFLAEFHRAYPRIDLQIEVMRSSDILSSLLQKTATAGLGLCRTPHDKLEMRCFLRQRYAIYCGRHHRLFGQTQLRMDDLLAENFVSFTSDQIGDSLSPLTVFRDQKGFTGRIVASSPSLEEVRRLIFAGYGIGCLPEHIVRDDIAQQRLWRLPPDDGLVDVDVFLLWHRDRKMNAAEHAFLDAMERCMQRYSLAQRLGK
>NZ_CP013730.1|WP_059235114.1|2841799_2843110_-|MHS-family-MFS-transporter
MTQSLPSARQPGRAATAAFIGTMIEWYDFYIYATAAALVFGELYFPSHDRFVSTMASFATFAVGFFARPLGGVIFGHLGDRIGRKKALMTTLMMMGVATVCVGLLPDYSKVGMLAPVLLVALRVVQGIAVGGEWGGAVLMAGEHAPQGRRTFFASFAQLGSPAGLILSLIAFRAVTSMDKADFLAWGWRLPFLASSVLLVVGILIRLGVNESPEFARVKATNRTVKLPVAEVFRSASGLVLLCIGANTIGIAGVYFTNTFMIAYTTQYVGVSRSLILDSLFAVAIIQFIAQPIAAWTAERIGGARFLKIAALLAMLSPYPMFMLVQGGTSVSLIAGIALAVVCMAGFYSVIAGFVSDVFPAHVRYSAISLAYQICGAIAGGLTPLVGTWLAHRFAGQWWPLAVFYTCLAGVSLLCIVALDARRAAQPAAAEALGSH
>NZ_CP013730.1|WP_059235112.1|2840496_2841768_-|Zn-dependent-hydrolase
MKDLLEIDGARLWQSLADMARVGATPRGGVRRLALTDDDRRGRDLFAQWCRDAGMTVSVDAVGNLFARRDGADAQAAPVLIGSHLDTQPEGGRFDGVYGVLAALELVRTLNDAGIATGKPLEIVSWTNEEGARFAPAMLGSAVFTGALPLDEALAKQDADGVALGAALDACGYRGTRATGGAVDAYFEAHIEQGPVLEANGTTIGIVTGGQAIRWLDVTVTGVAAHAGTTPMPYRKDACFASAQIALELERIVAGYAPRGLATIGQVGIRNASRNTIAGDLTFTVDLRHHDDAEVDAMERDLRDACTRIAAARGVRVAIDTCWRSPATPFDRDCVELVAQATEAFGYTNERIVSGAGHDAILLARRVPTAMVFIPCVDGLSHNEAEDALPDDVTRGTNVLLHAVLARAGIAARVEAAATAHDA
>NZ_CP013730.1|WP_059236832.1|2855936_2857328_-|dihydrolipoyl-dehydrogenase
MKNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERDRLGGTCLNIGCIPSKALIHVADAFEQACGHAGEGALGIRVHKPEIDIGKSVAWKDGIVDRLTRGVGALLKKNGVRVLHGDAHVVDGKTVDVVTGGHSVRISCEHLLLATGSEPVELPTMPFGGHVVSSTEALSPATLPKRLVVVGAGYIGLELGTVYRKLGVDVSIVEAAERVLPAYDAELGRPVADSLARLGVRLWLGHKVLGLAEHGAVRVQAADGAEQTLPADRVLVAVGRRPRVDGFGLETLQLDRNGRALRIDDECRTSMRNVWAIGDVAGEPMLAHRAMAQGEMVAELIAGRRRQFVPASIPAVCFTDPEIVTAGWSPDDAHAAGVDCLSASFPFAANGRAMTLQATEGFVRVVARRDNHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEALQEAALRALGHALHV
>NZ_CP013730.1|WP_059235133.1|2857333_2858644_-|2-oxo-acid-dehydrogenase-subunit-E2
MGIHVIKMPDIGEGIAEVELVAWHVEVGQMIKEDQPLADVMTDKAAVEIPSPVTGKVIELGGRIGEMMAVGSELIRLEVEGGGNLKAGAPVRESKVETAPVAAAPSKPVADVPAEPPVRPAASHAPAKPSRAEPATQPRAALAPGERPLASPAVRQRAWDMGIELRYVRGTGEAGRILHADLDAYAGTGGGAARPSHAHGYDERNDETEVPVIGLRRAIARKMQEAKRRIPHFSYVEEIDVTELESLRTELNRRYGDTRGKLTPLPLLIRAMVIALRDFPQINARFDDEAGVVTRYGAVHMGVATQTDGGLTVPVLRHAEARDAWSISAEIARLADAVRANRAQRDELSGSTITISSLGALGGIVSTPVINHPEVGIVGVNRIVERPMIRDGAIVARKMMNLSSSFDHRVVDGADAAEFIQAVRAVLERPALLFVE
>NZ_CP013730.1|WP_059235136.1|2858645_2859686_-|alpha-ketoacid-dehydrogenase-subunit-beta
MAQHETDTATQPMTMIQALRSAMDVMLGRDSDVVVFGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPISEGGIVGAAVGMGAYGLRPVCEIQFADYFYPASDQIVSEGARLRYRSAGQFIAPMTIRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIENDDPVIFLEPKRLYNGPFDGHHERPVTSWLKHPASAVPEGYYTVPLDTAAIVRPGNDVTVLTYGTTVHVSLAAAEETGIDAEVIDLRTLWPLDLDTIVASVRKTGRCVVVHEATRTCGYGAELVSLVQEHCFYHLEAPVERTTGWDTPYPHAQEWAYFPGPARVGEALRRVMEA
>NZ_CP013730.1|WP_059235138.1|2859688_2860921_-|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha
MSLSEPLRLHVPEPTGRPGCKTDFSYLHLSPAGAVRRPPIDVAAADTADLARSLVRVLDDNGKAVGPWAPDLDDARLIAGLRAMLKTRIFDARMMIAQRQKKISFYMLSLGEEAIGTAHAMALRDGDMCFPTYRQQSILIARDVSLERMICQLMSNEGDPLKGRQLPVMYSDREAGFFSISGNLATQFIQAVGWAMASAIKGDTKIASAWIGDGATAEADFHTALTFAHVYRAPVVLNVVNNQWAISTFQAIAGGEGTTFAGRGVGCGIASLRVDGNDFLAIYAASSWAAERARRNLGPTLIEWVTYRAGAHSTSDDPTKYRPSDDWSHFPLGDPIERFKRHLIVKGIWSDSAHDALTAELEAEVIAAQKEAEKYGTLADDRIPSPASMFDDVYKELPAHLRRQRQELGA
>NZ_CP013730.1|WP_059236834.1|2861395_2862421_-|alcohol-dehydrogenase-catalytic-domain-containing-protein
MKAVVMTGANRPWEVQEVPVPVAGPGQVLVKVHASGMCYTDVWATQGFGGDIYPQTPGHEVVGEIVEVGAGVHARRVGDRIGTTWVQSACGRCAYCRENRPLSGQTAVNCDTPRTTGFASQGGHAEYIAVAAEGTVLLPDGLTYVDAAPMMCAGYTTWSGLRDAAPQPHEQVAVLGIGGLGHVALQLSRACGFETIAITHSADKRDLAIRLGADQVVANGAELREAGGADVLLVTTNEFSTAEEAMAGLRVDGRVILCGLDFSKPFSIASQRKPFHMMRQQVIGSTHGGLRYLSEVLELAARGKVKPIVETFALDQATEAYDRLASGKMRFRGVFTPAGHH
>NZ_CP013730.1|WP_059235140.1|2862586_2863531_+|LysR-family-transcriptional-regulator
MNSAHQLKSGDLFSLNVFLVAATHLSFRAASIELDVTPSAISHSIKSLEQRLGVRLFNRTTRSVSLTDAGERLVEKLRPAISSVADAMLAVDGMRDTPSGTVRINASEGAIRMVLKPVLARFLRDYPQVHLDIVTDGTLGDIVAGGFDAGIRLAEAVPQDMIAVRVSEPVQFAAVASPAYFAARGRPAVPQDLHRHDCIRFRFDSGAIYRWEFERRGVVETVNVGGPLTLTDQPLMVDAAIDGIGIAFVPDHLVRAALDDGRLERVLTDWCPVMPGLCLYYPGHRHVSGGLRALIETLRVRSAGADPALARSGQ
>NZ_CP013730.1|WP_059235141.1|2863544_2864303_-|response-regulator-transcription-factor
MSAGHTSPPQHRRQDAVNKAIRILVVDDDSQIRSLLCDCLADFGMTTAQAGTGAEMHLALGEGGFDLVVLDLMLPDDDGLNLCREIRATSEIPLIILTARGEMTDRIVGLELGADDYIVKPFEPRELVARIQTILRRVRAQTQGRTRAQEESRFAGWRLHQIGRHLIAADNTVIPLSNAEFRLLNAFLAAPGRVLSREYLMDTARGKSIDTFDRSIDVQISRLRQKLREDIKEPRLIRTIRGEGYMLDVGHR
>NZ_CP013730.1|WP_059235143.1|2864629_2865265_+|energy-transducer-TonB
MNYAQPKPPVRRIGGIAFVVGLHAAIVYALLTGLATKVVDVIRQPIETRIIEEIKPPPPPPPPKRIAPPPPKHVAPPPPFAPPPDVHVAAPPSPNAIATQSATPAPSAPVAPPAPPAAAAPVSTSVGVVCPNSTQVRAAIRYPREALKDNLTGDVVVTFVVGTDGNVKDLSVTQSAAPVLDRAAENAVRQFHCVAQGEEVRVQVPFSFKLD
>NZ_CP013730.1|WP_081051910.1|2865323_2866109_+|biopolymer-transporter-ExbB
MNRTRKAALVTALFLAASAAHAATDTVTNPYGLDALWKGGDFIARGTLLILVVMSMGSWYIIVAKLLEQTRVLRRAKAAEKGFWKAANLGEGTRQLDTGSPFRFIAETGLAAFDHHEGALLEQVDLNHWVAAAIERATTSVSSRLQDGLAFLGTVGSTAPFIGLFGTVWGIYHALTAIGIAGQASIDKVAGPVGEALIMTAIGLAVAVPAVLGYNWLVRRNKAVMERVRGFSTELHIVILTGTTTAGAAAATKAAALSRVG
>NZ_CP013730.1|WP_059235148.1|2866112_2866544_+|biopolymer-transporter-ExbD
MAMTTGSRDGDDHDETMSSINTTPLVDVMLVLLIIFLITIPVVSHTVPVTLPKETVQPLQTTPQNVILAVTKEGDVFWDERRVPDAATLVEKLKAVAVQSPQPEVHIRGDLDARYAAIGRVVFACQRAGIVKVDFITEPPPRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

193070 : 288247

Burkholderia_phage(66.67%)

tail,integrase,plate,holin

attL 264024:264072|attR 288388:288436

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006477367.1\|193070_193424_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_059232686.1\|193522_194941_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.3e-43	30.1
WP_059232687.1\|195185_195920_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_059232688.1\|195938_196757_-	flagellar biosynthesis protein FlhG	NA	NA	NA	NA
WP_059232689.1\|196749_198510_-	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_059232690.1\|198506_200606_-	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_059232691.1\|200805_202005_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_059232692.1\|202315_202696_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_155627095.1\|202880_203054_-	hypothetical protein	NA	NA	NA	NA
WP_059232693.1\|203188_203686_-	VOC family protein	NA	NA	NA	NA
WP_059232694.1\|203851_205081_-	DUF3443 family protein	NA	NA	NA	NA
WP_059232695.1\|205097_205601_-	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_059232696.1\|205860_206592_-	protein phosphatase CheZ	NA	NA	NA	NA
WP_006485893.1\|206593_206989_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	6.0e-07	31.9
WP_059232697.1\|207056_208148_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_059232698.1\|208144_208900_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_059232699.1\|208896_209889_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_059232700.1\|209892_211857_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	45.0
WP_059232701.1\|211894_212410_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_059232702.1\|212457_214692_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_034188085.1\|214725_215103_-	response regulator	NA	NA	NA	NA
WP_059232703.1\|215132_216152_-	flagellar motor protein MotB	NA	NA	NA	NA
WP_006482649.1\|216165_217026_-	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_034209584.1\|217193_217748_-	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_081051758.1\|217841_218288_-	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_059232704.1\|218826_219891_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_059232705.1\|219994_220291_-	H-NS histone family protein	F8TUP5	EBPR_podovirus	1.9e-10	40.8
WP_006477345.1\|220591_221335_+	aquaporin Z	A0A1B1ISL4	uncultured_Mediterranean_phage	8.1e-05	50.8
WP_059232706.1\|221467_222292_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_059232707.1\|222438_223320_-	ATPase	NA	NA	NA	NA
WP_059232708.1\|223462_224065_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_059232709.1\|224130_225366_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_059232710.1\|225596_227720_+	TonB-dependent receptor	NA	NA	NA	NA
WP_006401410.1\|227880_228093_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_155627096.1\|228421_228616_-	hypothetical protein	NA	NA	NA	NA
WP_059232711.1\|228614_229772_+	flagellin	NA	NA	NA	NA
WP_059232712.1\|229904_231413_+	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_059232713.1\|231438_231738_+	flagellar protein FliT	NA	NA	NA	NA
WP_059232714.1\|231979_234328_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_059232715.1\|234356_235499_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A0P0CNN6	Ostreococcus_mediterraneus_virus	1.6e-12	26.0
WP_059232716.1\|235509_236172_-	acetyltransferase	NA	NA	NA	NA
WP_059232717.1\|236265_238206_-	glycosyltransferase family protein	NA	NA	NA	NA
WP_059232718.1\|238245_238989_-	acetyltransferase	NA	NA	NA	NA
WP_059232719.1\|239253_240864_-	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
WP_059232720.1\|241425_241632_+\|tail	phage tail protein	E5E3W5	Burkholderia_phage	3.3e-17	63.2
WP_059232721.1\|241648_241993_+	hypothetical protein	A4JWU2	Burkholderia_virus	5.7e-38	77.9
WP_059232722.1\|241994_242261_+\|holin	phage holin family protein	E5E3W3	Burkholderia_phage	4.3e-25	66.7
WP_059232723.1\|242264_243110_+	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	1.7e-91	66.9
WP_059232724.1\|243106_243547_+	protein lysB	NA	NA	NA	NA
WP_081051759.1\|243500_243671_+	peptidase	K4PAX1	Burkholderia_phage	1.6e-09	69.8
WP_059232726.1\|243663_244113_+\|tail	phage tail protein	E5E3V9	Burkholderia_phage	3.0e-31	55.7
WP_155627097.1\|244272_244431_-	hypothetical protein	NA	NA	NA	NA
WP_059232727.1\|244598_245285_+\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	8.9e-83	69.2
WP_059232728.1\|245281_245644_+\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	2.0e-41	69.2
WP_059232729.1\|245640_246555_+\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	5.6e-117	71.9
WP_059232730.1\|246547_247090_+\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	7.5e-69	70.9
WP_059232731.1\|247096_249739_+\|tail	phage tail protein	E5E3V2	Burkholderia_phage	0.0e+00	71.9
WP_059232732.1\|249756_250533_+\|tail	phage tail protein	E5E3V1	Burkholderia_phage	2.6e-86	79.5
WP_059232733.1\|250588_251761_+\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.6e-185	81.5
WP_081051760.1\|251795_252299_+\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	1.7e-70	74.9
WP_059232735.1\|252372_252753_+\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	1.0e-27	68.0
WP_006484104.1\|252761_252875_+\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	1.1e-09	85.7
WP_059232736.1\|252890_255464_+	hypothetical protein	E5E3U6	Burkholderia_phage	8.1e-145	44.4
WP_059232737.1\|255488_255920_+\|tail	phage tail protein	K4NXK5	Burkholderia_phage	3.7e-42	67.4
WP_059232738.1\|255916_256987_+	phage late control D family protein	K4PAY4	Burkholderia_phage	3.0e-133	71.9
WP_059232739.1\|257161_257458_-	hypothetical protein	E5E3U3	Burkholderia_phage	5.5e-13	50.5
WP_155627182.1\|257775_258231_-	transcriptional regulator	E5E3U2	Burkholderia_phage	6.6e-42	60.3
WP_059232740.1\|258357_258573_+	hypothetical protein	E5E3U1	Burkholderia_phage	1.5e-20	81.4
WP_006485448.1\|258754_259003_+	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	3.5e-37	91.5
WP_059236519.1\|259131_259395_+	hypothetical protein	A4JWQ9	Burkholderia_virus	6.5e-18	61.9
WP_059236521.1\|259400_262193_+	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	90.7
WP_081051761.1\|262189_262561_+	hypothetical protein	A0A089FGR9	Burkholderia_phage	1.1e-07	52.5
WP_059232742.1\|262893_263970_+\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	2.7e-166	81.7
264024:264072	attL	NA	NA	NA	NA
WP_081051762.1\|264302_264575_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059236523.1\|264929_265535_+	hypothetical protein	NA	NA	NA	NA
WP_155627098.1\|265846_266578_+	hypothetical protein	NA	NA	NA	NA
WP_155627099.1\|266586_267057_+	hypothetical protein	NA	NA	NA	NA
WP_155627100.1\|267375_267795_+	hypothetical protein	NA	NA	NA	NA
WP_059232746.1\|268089_268284_-	hypothetical protein	NA	NA	NA	NA
WP_059232747.1\|269041_269758_+	hypothetical protein	NA	NA	NA	NA
WP_059232748.1\|270001_270574_+	recombinase family protein	E5FFF9	Burkholderia_phage	5.9e-48	55.3
WP_081051763.1\|270654_271299_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_081051764.1\|271291_271747_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_155627101.1\|271993_272806_+	hypothetical protein	NA	NA	NA	NA
WP_059232751.1\|272802_273282_+	hypothetical protein	NA	NA	NA	NA
WP_155627102.1\|273278_273758_+	hypothetical protein	NA	NA	NA	NA
WP_155627103.1\|273715_275224_+	hypothetical protein	NA	NA	NA	NA
WP_059232753.1\|275421_276051_-	hypothetical protein	NA	NA	NA	NA
WP_059232754.1\|277558_279400_+	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	3.5e-33	27.5
WP_081051766.1\|279396_280746_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_059232756.1\|280742_281675_+	transporter	NA	NA	NA	NA
WP_059232757.1\|281730_284844_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_059232758.1\|285004_285931_+	DNA-processing protein DprA	NA	NA	NA	NA
WP_155627104.1\|285943_287158_+	hypothetical protein	NA	NA	NA	NA
WP_059232760.1\|287239_288247_-\|integrase	site-specific integrase	A0A1L7DQ84	Ralstonia_phage	6.1e-48	38.1
288388:288436	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1329095 : 1339560

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059233509.1\|1329095_1330211_-	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	1.4e-173	80.7
WP_081051801.1\|1330215_1330968_-	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	2.2e-42	44.5
WP_059233510.1\|1330964_1331492_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	4.5e-50	58.0
WP_034190709.1\|1332027_1332210_-	rubredoxin	NA	NA	NA	NA
WP_059233511.1\|1332409_1332814_+	DUF4399 domain-containing protein	NA	NA	NA	NA
WP_059233512.1\|1333016_1334966_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.1e-48	29.1
WP_059233513.1\|1335186_1337169_+	type IIA DNA topoisomerase subunit B	G3M9Z3	Bacillus_virus	3.6e-92	34.8
WP_059233514.1\|1337238_1339560_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.1e-83	36.0

DBSCAN-SWA_3

1632188 : 1726340

100

uncultured_Caudovirales_phage(29.27%)

plate,terminase,head,tail,capsid,tRNA,portal,protease,integrase,holin

attL 1666512:1666537|attR 1705445:1705470

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059233721.1\|1632188_1633715_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	3.6e-84	40.5
WP_155627123.1\|1633788_1634893_-	peptide chain release factor 2	W8EDB3	Pseudomonas_phage	1.3e-06	35.4
WP_059233722.1\|1635048_1636746_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	7.1e-57	30.5
WP_155627124.1\|1636760_1637825_-	regulator	NA	NA	NA	NA
WP_059233724.1\|1637987_1639241_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_059233725.1\|1639296_1639992_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	1.7e-33	41.0
WP_059233726.1\|1640059_1640848_+	TatD family hydrolase	NA	NA	NA	NA
WP_059233727.1\|1640905_1643389_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_059233728.1\|1643577_1644423_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_059233729.1\|1644604_1646257_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.9e-151	51.8
WP_047898480.1\|1646260_1647115_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	6.8e-48	40.5
WP_011352544.1\|1647221_1648505_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.1e-150	62.1
WP_059233730.1\|1648586_1649012_+	cell division protein FtsB	NA	NA	NA	NA
WP_059233731.1\|1649098_1649455_-	hypothetical protein	NA	NA	NA	NA
WP_034188925.1\|1649590_1650541_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_059233732.1\|1650566_1651091_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_059233733.1\|1651240_1652092_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_059233734.1\|1652260_1653151_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_155627125.1\|1653222_1654062_+	PHP domain-containing protein	NA	NA	NA	NA
WP_059233735.1\|1654128_1654761_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_059233736.1\|1654808_1655471_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_006487046.1\|1655479_1656682_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_059233737.1\|1656690_1657293_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_059233738.1\|1657339_1658242_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_059233739.1\|1658353_1659499_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_059233740.1\|1659503_1660280_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_034195863.1\|1660393_1660657_-	hypothetical protein	NA	NA	NA	NA
WP_059233741.1\|1660889_1662110_-	cupin domain-containing protein	NA	NA	NA	NA
WP_059233742.1\|1662142_1662685_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_059236691.1\|1662664_1663912_-	hypothetical protein	NA	NA	NA	NA
WP_059233743.1\|1663916_1666607_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	3.7e-23	24.1
1666512:1666537	attL	NA	NA	NA	NA
WP_059233744.1\|1666766_1668041_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	1.1e-147	58.7
WP_081051898.1\|1668018_1668261_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	1.2e-18	66.2
WP_059233745.1\|1668269_1668641_-	hypothetical protein	NA	NA	NA	NA
WP_059233746.1\|1668742_1670347_-	hypothetical protein	NA	NA	NA	NA
WP_059236693.1\|1670346_1670709_-	hypothetical protein	NA	NA	NA	NA
WP_059233747.1\|1670759_1670978_-	hypothetical protein	NA	NA	NA	NA
WP_155627126.1\|1671283_1671892_-	hypothetical protein	NA	NA	NA	NA
WP_059233748.1\|1671908_1672127_+	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	1.0e-08	50.8
WP_059236695.1\|1672138_1672711_+	hypothetical protein	C7BGG0	Burkholderia_phage	4.7e-29	46.8
WP_059236697.1\|1672697_1673081_+	hypothetical protein	NA	NA	NA	NA
WP_059233749.1\|1673341_1675849_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	3.1e-93	40.0
WP_059233750.1\|1676069_1676843_+	hypothetical protein	NA	NA	NA	NA
WP_059233751.1\|1677096_1677693_+	hypothetical protein	NA	NA	NA	NA
WP_059233754.1\|1678454_1680566_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	1.0e-177	53.3
WP_059233755.1\|1680579_1680786_+	hypothetical protein	NA	NA	NA	NA
WP_059233756.1\|1680782_1682267_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.8e-133	50.9
WP_059233757.1\|1682272_1683346_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	2.0e-44	35.7
WP_059233758.1\|1683376_1683721_+\|head	head decoration protein	NA	NA	NA	NA
WP_059233759.1\|1683794_1684790_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.8e-101	55.8
WP_059233760.1\|1684791_1685082_+	hypothetical protein	NA	NA	NA	NA
WP_059233761.1\|1685085_1685616_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	8.3e-12	31.0
WP_059233762.1\|1685605_1686136_+	hypothetical protein	Q75QM3	Wolbachia_phage	8.5e-25	38.2
WP_059233763.1\|1686132_1686813_+\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	8.4e-17	29.8
WP_059233764.1\|1686873_1687074_+	hypothetical protein	NA	NA	NA	NA
WP_034188724.1\|1687073_1687409_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	5.0e-23	48.1
WP_059233765.1\|1687405_1688302_+\|plate	baseplate J protein	A0A2H4JFK9	uncultured_Caudovirales_phage	4.6e-47	43.8
WP_059233766.1\|1688291_1688870_+\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	7.4e-30	44.1
WP_059233767.1\|1688857_1690810_+\|tail	tail fiber protein	A4JWS9	Burkholderia_virus	7.9e-100	41.6
WP_059233768.1\|1690825_1691605_+\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	2.8e-56	56.5
WP_059233769.1\|1691689_1692859_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	9.3e-157	72.1
WP_059233770.1\|1692869_1693373_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	4.3e-42	51.9
WP_059233771.1\|1693469_1693772_+\|tail	phage tail assembly protein	A0A1B2LRV6	Wolbachia_phage	3.5e-07	38.7
WP_059233772.1\|1693852_1696294_+\|tail	phage tail protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.0e-56	37.6
WP_059233773.1\|1696303_1697182_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.5e-34	37.5
WP_059236699.1\|1697156_1697363_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.5e-14	58.2
WP_059233774.1\|1697372_1698419_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.6e-81	46.9
WP_059233775.1\|1698499_1698784_+\|holin	holin	C7BGD7	Burkholderia_phage	2.8e-38	92.6
WP_059233776.1\|1698786_1699281_+	glycoside hydrolase family 104 protein	Q6J1Q5	Burkholderia_virus	6.9e-77	87.8
WP_059233777.1\|1699277_1699772_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	4.7e-33	51.3
WP_059233778.1\|1699941_1700727_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	2.4e-132	82.8
WP_155627127.1\|1700791_1701292_-	hypothetical protein	Q8W6R9	Burkholderia_virus	4.7e-25	45.5
WP_059233780.1\|1701500_1702157_+	DUF159 family protein	Q8W6R8	Burkholderia_virus	3.6e-81	62.3
WP_155627128.1\|1702219_1702708_+	hypothetical protein	NA	NA	NA	NA
WP_155627129.1\|1702842_1703253_-	hypothetical protein	NA	NA	NA	NA
WP_155627130.1\|1703732_1704146_-	hypothetical protein	NA	NA	NA	NA
WP_059233783.1\|1704694_1704928_+	hypothetical protein	NA	NA	NA	NA
WP_059233785.1\|1705640_1706222_-	fasciclin domain-containing protein	NA	NA	NA	NA
1705445:1705470	attR	NA	NA	NA	NA
WP_059233786.1\|1706345_1707068_-	anti-sigma factor	NA	NA	NA	NA
WP_081051810.1\|1707064_1707751_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_059233788.1\|1708582_1708924_-	hypothetical protein	NA	NA	NA	NA
WP_059233789.1\|1709690_1709975_+	hypothetical protein	NA	NA	NA	NA
WP_081051811.1\|1710022_1710232_+	hypothetical protein	NA	NA	NA	NA
WP_059233790.1\|1710265_1710478_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_059233791.1\|1711080_1711398_+	hypothetical protein	NA	NA	NA	NA
WP_059236701.1\|1711867_1712152_+	hypothetical protein	NA	NA	NA	NA
WP_059236703.1\|1712204_1712444_-	hypothetical protein	NA	NA	NA	NA
WP_059233792.1\|1713008_1713335_+	EthD family reductase	NA	NA	NA	NA
WP_059233793.1\|1713575_1715198_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_006493635.1\|1715507_1716311_-	inositol monophosphatase	NA	NA	NA	NA
WP_059233794.1\|1716593_1717418_+	RNA methyltransferase	NA	NA	NA	NA
WP_059233795.1\|1717693_1718497_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_059233796.1\|1718554_1719355_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_011352518.1\|1719378_1719870_-	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	2.2e-06	29.6
WP_059233797.1\|1719958_1720534_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	1.2e-11	38.5
WP_155627190.1\|1720573_1721428_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_059233799.1\|1721528_1722926_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.7e-43	31.2
WP_059233800.1\|1722969_1723797_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_048248707.1\|1723900_1724872_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_059233801.1\|1724918_1726340_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA

DBSCAN-SWA_4

2021012 : 2072131

Powai_lake_megavirus(33.33%)

protease,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059234012.1\|2021012_2022353_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_059234013.1\|2022408_2023038_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_059234014.1\|2023079_2024225_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_059234015.1\|2024474_2025812_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_059234016.1\|2025941_2026196_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_059234017.1\|2026253_2027444_+	GTPase HflX	NA	NA	NA	NA
WP_059234018.1\|2027491_2028838_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_059234019.1\|2028853_2029753_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_009687995.1\|2029789_2029981_+	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_059234020.1\|2030084_2031233_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_059234021.1\|2031346_2032693_+	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	6.9e-71	36.6
WP_059234022.1\|2032700_2033297_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_059234023.1\|2033572_2035489_+	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	2.9e-78	33.0
WP_059234024.1\|2035511_2036537_-	sesquiterpene cyclase	NA	NA	NA	NA
WP_059234025.1\|2036945_2039270_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_059234026.1\|2039434_2040187_+	hypothetical protein	NA	NA	NA	NA
WP_006478692.1\|2040263_2040479_+	YdcH family protein	NA	NA	NA	NA
WP_059234027.1\|2040534_2042784_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.1e-76	29.1
WP_059234028.1\|2042904_2043729_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_059234029.1\|2043770_2044979_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_059236728.1\|2044985_2045825_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_059234030.1\|2046185_2048069_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_059234031.1\|2048168_2049350_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_059234032.1\|2049470_2050211_+	3-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_059234033.1\|2050329_2050896_+	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_059234034.1\|2051294_2052140_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_059234035.1\|2052336_2053377_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_059234036.1\|2053530_2053785_-	hypothetical protein	NA	NA	NA	NA
WP_059234038.1\|2054759_2058491_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_059234039.1\|2058506_2059943_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_081051819.1\|2059930_2060635_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_059234040.1\|2060631_2062194_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_081051820.1\|2062205_2062664_-	hypothetical protein	NA	NA	NA	NA
WP_059234042.1\|2063136_2063640_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_081051900.1\|2063674_2065162_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_059234044.1\|2065177_2065606_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059234045.1\|2065625_2067392_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059234046.1\|2067355_2068375_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_059234047.1\|2068371_2069724_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_059234048.1\|2069720_2070797_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_059234049.1\|2070793_2072131_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_5

2430843 : 2473734

Burkholderia_phage(70.73%)

head,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059234443.1\|2430843_2431341_-	lysozyme	Q3HQU9	Burkholderia_phage	1.9e-82	92.7
WP_006495243.1\|2431333_2431516_-	hypothetical protein	NA	NA	NA	NA
WP_059234445.1\|2431689_2431980_+	hypothetical protein	NA	NA	NA	NA
WP_155627147.1\|2432019_2432235_+	hypothetical protein	NA	NA	NA	NA
WP_155627148.1\|2432345_2432942_+	hypothetical protein	NA	NA	NA	NA
WP_081051843.1\|2432952_2433519_-	hypothetical protein	NA	NA	NA	NA
WP_155627149.1\|2433521_2435264_-	hypothetical protein	Q6QI97	Burkholderia_phage	2.4e-60	45.3
WP_059234451.1\|2435324_2435987_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	2.0e-111	88.2
WP_059234454.1\|2435986_2437168_-	hypothetical protein	A9YX12	Burkholderia_phage	1.4e-192	90.8
WP_059234456.1\|2437164_2437518_-	hypothetical protein	A9YX11	Burkholderia_phage	6.9e-55	91.5
WP_059234458.1\|2437526_2438279_-	hypothetical protein	A9YX06	Burkholderia_phage	2.9e-119	89.6
WP_059234460.1\|2438282_2438660_+	hypothetical protein	A9YX05	Burkholderia_phage	1.3e-59	90.4
WP_059234463.1\|2438656_2439625_-	hypothetical protein	A9YX04	Burkholderia_phage	1.2e-144	88.3
WP_059234465.1\|2439621_2439939_-	hypothetical protein	NA	NA	NA	NA
WP_059234467.1\|2439938_2440514_-	hypothetical protein	A0A0M3ULD5	Salmonella_phage	2.4e-20	38.0
WP_059234469.1\|2440510_2442637_-	hypothetical protein	A0A0M4REK7	Salmonella_phage	1.6e-37	35.8
WP_059234471.1\|2442820_2443381_-	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	3.7e-18	35.2
WP_059234473.1\|2443383_2443824_-	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	1.6e-40	57.5
WP_059234474.1\|2443839_2445315_-	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	6.3e-110	48.1
WP_059234476.1\|2445324_2445915_-	hypothetical protein	A9YX29	Burkholderia_phage	1.4e-100	91.8
WP_059234478.1\|2445919_2446291_-	hypothetical protein	A9YX28	Burkholderia_phage	8.8e-61	91.1
WP_059234480.1\|2446352_2446832_-	hypothetical protein	A9YX26	Burkholderia_phage	6.7e-77	94.3
WP_059234482.1\|2446861_2447242_-	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	1.1e-58	92.1
WP_059236779.1\|2447305_2447773_-	hypothetical protein	A9YX24	Burkholderia_phage	2.8e-27	90.0
WP_059234484.1\|2447783_2448875_-	DUF2184 domain-containing protein	A9YX23	Burkholderia_phage	2.1e-155	96.0
WP_059234486.1\|2448944_2449451_-	hypothetical protein	NA	NA	NA	NA
WP_059234488.1\|2449460_2450924_-	DUF2213 domain-containing protein	A9YX03	Burkholderia_phage	2.2e-195	82.5
WP_059234490.1\|2451069_2451591_-	hypothetical protein	A9YX01	Burkholderia_phage	1.8e-88	92.5
WP_059234492.1\|2451671_2452427_-\|head	phage head morphogenesis protein	A9YWZ8	Burkholderia_phage	3.0e-132	96.8
WP_059234494.1\|2452423_2453890_-	DUF1073 domain-containing protein	A9YWZ7	Burkholderia_phage	1.1e-263	94.4
WP_059234496.1\|2453910_2455464_-\|terminase	phage terminase large subunit	H9C0C7	Vibrio_phage	1.6e-111	45.0
WP_059234498.1\|2455414_2455894_-	DUF2280 domain-containing protein	A9YWZ5	Burkholderia_phage	2.9e-56	77.0
WP_059234500.1\|2455915_2456575_-	hypothetical protein	A9YWZ4	Burkholderia_phage	1.8e-112	88.0
WP_155627150.1\|2456718_2456907_+	hypothetical protein	NA	NA	NA	NA
WP_155627151.1\|2457039_2457222_+	hypothetical protein	NA	NA	NA	NA
WP_059234502.1\|2457467_2458061_-	hypothetical protein	A9YWZ1	Burkholderia_phage	8.2e-101	93.2
WP_059236781.1\|2458057_2458351_-	hypothetical protein	A9YWZ0	Burkholderia_phage	1.4e-40	86.6
WP_059234504.1\|2458395_2458866_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	3.6e-75	92.3
WP_059234506.1\|2458862_2459123_-	hypothetical protein	NA	NA	NA	NA
WP_059236783.1\|2459119_2459509_-	hypothetical protein	NA	NA	NA	NA
WP_155627152.1\|2460396_2461086_+	hypothetical protein	NA	NA	NA	NA
WP_155627153.1\|2461318_2461540_-	hypothetical protein	A9YWY0	Burkholderia_phage	1.5e-28	84.7
WP_059234510.1\|2461536_2461911_-	hypothetical protein	A9YWX9	Burkholderia_phage	1.6e-62	91.9
WP_059234512.1\|2462348_2462741_+	XRE family transcriptional regulator	E5AGE6	Erwinia_phage	2.4e-08	50.0
WP_059236786.1\|2463574_2464000_+	hypothetical protein	NA	NA	NA	NA
WP_059234513.1\|2464134_2464518_+	hypothetical protein	A9YWW9	Burkholderia_phage	1.3e-22	54.0
WP_059234516.1\|2464514_2464937_+	hypothetical protein	NA	NA	NA	NA
WP_059234520.1\|2464938_2465289_+	hypothetical protein	NA	NA	NA	NA
WP_059234522.1\|2465285_2465531_+	hypothetical protein	NA	NA	NA	NA
WP_059234523.1\|2465999_2466299_+	KTSC domain-containing protein	A9YWW2	Burkholderia_phage	1.8e-40	83.8
WP_059234525.1\|2466295_2467105_+	hypothetical protein	J7HXJ4	Pseudomonas_phage	6.1e-91	60.2
WP_059236788.1\|2467194_2468403_+	hypothetical protein	A0A2I7RZ22	Vibrio_phage	2.9e-20	34.6
WP_059234526.1\|2468433_2469318_+	cell division protein FtsK	J7I0T4	Pseudomonas_phage	1.7e-33	33.5
WP_059234529.1\|2469314_2471081_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	3.3e-73	36.4
WP_059234531.1\|2471077_2471710_+	hypothetical protein	A9YX18	Burkholderia_phage	3.1e-21	98.1
WP_059236790.1\|2471793_2472234_+	hypothetical protein	A9YX19	Burkholderia_phage	4.4e-75	89.9
WP_059234533.1\|2472243_2472879_-	hypothetical protein	NA	NA	NA	NA
WP_155627154.1\|2473107_2473734_-	hypothetical protein	Q8W6Q5	Burkholderia_virus	2.6e-36	52.0

DBSCAN-SWA_6

3078423 : 3086706

Tanapox_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059235469.1\|3078423_3079344_+	alpha/beta hydrolase	A7XCB7	Tanapox_virus	1.3e-20	26.5
WP_059235472.1\|3079369_3080293_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	6.7e-41	34.9
WP_081051863.1\|3080336_3081680_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_059235476.1\|3081756_3082659_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.8e-52	39.5
WP_059235478.1\|3082872_3083217_-	competence protein ComE	NA	NA	NA	NA
WP_059235479.1\|3083290_3084283_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.1e-28	31.2
WP_155627164.1\|3084347_3085298_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.7e-15	27.2
WP_059235484.1\|3085305_3086706_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.3e-75	38.3

DBSCAN-SWA_7

3267125 : 3275218

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059235769.1\|3267125_3268430_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.6e-11	36.3
WP_059235771.1\|3268416_3269562_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	3.7e-17	25.3
WP_059235773.1\|3269639_3270953_-	ABC transporter ATP-binding protein	M1HV27	Acanthocystis_turfacea_Chlorella_virus	1.7e-05	28.4
WP_059235775.1\|3270942_3271749_-	ABC transporter permease	NA	NA	NA	NA
WP_059235777.1\|3271825_3272722_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	9.4e-24	34.0
WP_059235779.1\|3272718_3273267_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.7e-45	47.5
WP_059235781.1\|3273251_3274145_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	5.7e-98	60.8
WP_059235783.1\|3274156_3275218_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.6e-85	48.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013731

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013730

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection