CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP004384	Burkholderia thailandensis USAMRU Malaysia #20 chromosome 2, complete sequence	1 crisprs	csa3,DinG,cas3	0	0	2	0
NZ_CP004383	Burkholderia thailandensis USAMRU Malaysia #20 chromosome 1, complete sequence	1 crisprs	cas3,RT,PrimPol,DEDDh,csa3,DinG	0	0	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP004384_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004384_1

1369160-1369251

Orphan

Consensus_repeat	Method
GCGACGCGCGCAAGGCCGAAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP004384_1

>merge|NZ_CP004384|1|1369160-1369251|CRISPRCasFinder
GCGACGCGCGCAAGGCCGAAGCGGGCGCGAAGCGCACGGCCGACGACGACAGGCACCGCAGGCACGACGGCGACGCGCGCAAGGCGGAAGCG

>NZ_CP004384|1|1|1369160-1369251|CRISPRCasFinder
GCGACGCGCGCAAGGCCGAAGCG	GGCGCGAAGCGCACGGCCGACGACGACAGGCACCGCAGGCACGACG
GCGACGCGCGCAAGGCGGAAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004384.1\|WP_127446362.1\|1362904_1363186_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004384.1\|WP_009896605.1\|1357595_1358531_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP004384.1\|WP_009899936.1\|1364870_1365512_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004384.1\|WP_011401144.1\|1373757_1375065_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP004384.1\|WP_025370244.1\|1371519_1372782_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP004384.1\|WP_009896587.1\|1379494_1380355_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377216
NZ_CP004384.1\|WP_041223610.1\|1366606_1367623_-\|1-aminocyclopropane-1-carboxylate-deaminase	unknown	unknown	gnl\|CDD\|183494
NZ_CP004384.1\|WP_009896604.1\|1358870_1360901_+\|BCCT-family-transporter	unknown	unknown	gnl\|CDD\|376718
NZ_CP004384.1\|WP_009907539.1\|1375116_1376007_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|226145
NZ_CP004384.1\|WP_009896599.1\|1365599_1365953_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004384.1\|WP_009896602.1\|1362538_1362880_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004384.1\|WP_009907537.1\|1377700_1379332_+\|cytochrome-c-methylamine-utilization-protein	unknown	unknown	gnl\|CDD\|224771
NZ_CP004384.1\|WP_009896586.1\|1380668_1380941_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004384.1\|WP_011401150.1\|1363301_1364693_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293737
NZ_CP004384.1\|WP_009896595.1\|1367815_1368325_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183009
NZ_CP004384.1\|WP_009899924.1\|1372982_1373708_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP004384.1\|WP_025370245.1\|1370537_1371158_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319799
NZ_CP004384.1\|WP_011401139.1\|1381245_1381458_+\|DUF3079-domain-containing-protein	unknown	unknown	gnl\|CDD\|337966
NZ_CP004384.1\|WP_009907544.1\|1361174_1362365_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP004384.1\|WP_011401142.1\|1376225_1377704_+\|ser/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277318

Protein	Function_ID	Function_description	E-value
NZ_CP004384.1\|WP_009896605.1\|1357595_1358531_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.09348e-55
NZ_CP004384.1\|WP_009907537.1\|1377700_1379332_+\|cytochrome-c-methylamine-utilization-protein	gnl\|CDD\|224771	COG1858, MauG, Cytochrome c peroxidase [Inorganic ion transport and metabolism].	3.50892e-82
NZ_CP004384.1\|WP_011401144.1\|1373757_1375065_+\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.05988e-132
NZ_CP004384.1\|WP_025370244.1\|1371519_1372782_-\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.27954e-73
NZ_CP004384.1\|WP_009896587.1\|1379494_1380355_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377216	pfam04072, LCM, Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence.	4.81736e-51
NZ_CP004384.1\|WP_041223610.1\|1366606_1367623_-\|1-aminocyclopropane-1-carboxylate-deaminase	gnl\|CDD\|183494	PRK12390, PRK12390, 1-aminocyclopropane-1-carboxylate deaminase; Provisional.	0
NZ_CP004384.1\|WP_009896604.1\|1358870_1360901_+\|BCCT-family-transporter	gnl\|CDD\|376718	pfam02028, BCCT, BCCT, betaine/carnitine/choline family transporter.	0
NZ_CP004384.1\|WP_009907539.1\|1375116_1376007_+\|amidohydrolase-family-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	1.26079e-68
NZ_CP004384.1\|WP_011401150.1\|1363301_1364693_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|293737	cd16013, AcpA, acid phosphatase A. Acid phosphatase A catalyzes the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at low pH. AcpA hydrolyzes a variety of substrates, including p-nitrophenylphosphate (pNPP), p-nitrophenylphosphorylcholine (pNPPC), peptides containing phosphotyrosine, inositol phosphates, AMP, ATP, fructose 1,6-bisphosphate, glucose and fructose 6-phosphates, NADP, and ribose 5-phosphate. AcpA is distinct from histidine ACPs and purple ACPs, as well as class A, B, and C bacterial nonspecific ACPs.	2.05264e-98
NZ_CP004384.1\|WP_009896595.1\|1367815_1368325_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	6.18054e-47
NZ_CP004384.1\|WP_009899924.1\|1372982_1373708_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	3.20406e-58
NZ_CP004384.1\|WP_025370245.1\|1370537_1371158_-\|HAD-hydrolase-like-protein	gnl\|CDD\|319799	cd04303, HAD_PGPase, phosphoglycolate phosphatase, similar to Synechococcus elongates phosphoglycolate phosphatase PGP/CbbZ. Phosphoglycolate phosphatase catalyzes the dephosphorylation of phosphoglycolate; its activity requires divalent cations, especially Mg++. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.01245e-67
NZ_CP004384.1\|WP_011401139.1\|1381245_1381458_+\|DUF3079-domain-containing-protein	gnl\|CDD\|337966	pfam11278, DUF3079, Protein of unknown function (DUF3079). This family of proteins with unknown function appears to be restricted to Proteobacteria.	1.88329e-34
NZ_CP004384.1\|WP_009907544.1\|1361174_1362365_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.37834e-55
NZ_CP004384.1\|WP_011401142.1\|1376225_1377704_+\|ser/threonine-protein-phosphatase	gnl\|CDD\|277318	cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain. Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	2.48527e-09

>NZ_CP004384.1|WP_009896595.1|1367815_1368325_+|winged-helix-turn-helix-transcriptional-regulator
MCATKKSAPKAAAQPAGADIDRVDRAILRMLQRDASISNVALAAKVNLSAPACLRRVERLKEMGLIRGIVALLEPKALNAGMLVMIGVVLDRSTPDSFGAFEQAAQKVSGCMECHVVTGEFDYIMLIRTRDSDTFNRLHAEQLLYLPGVRQIRTFVVLKEILSTTSFPI
>NZ_CP004384.1|WP_041223610.1|1366606_1367623_-|1-aminocyclopropane-1-carboxylate-deaminase
MNLQKFPRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMSRMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCSDHPLGGLGFVGFAEEVRAQEAELGYKFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPAQTREQILRIARNTADRVELGRDIASGDVVLDERFGRPEYGLPNEGTLEAIRLCAKLEGVLTDPVYEGKSMHGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG
>NZ_CP004384.1|WP_009896599.1|1365599_1365953_-|hypothetical-protein
MGFVGGERRRARIAESNEIDGATLITKVASEPLAALGGARSEATPPLTLYGAYRQGFADYLAGRPNPYRIGSRLAGIWHEGHAEAASNDALDFTARARTCGGARTAANPVAFFRRRR
>NZ_CP004384.1|WP_009899936.1|1364870_1365512_+|hypothetical-protein
MKIRSGLVAELTVNLLLPWAAYRAAVPHWGETGGLIASAVPPLAWSVIELARFRRIDALSAVVLFGIVLSIAAALAGGSPRMLLMRESLASGAIGVAFLGSLALRKPLVFHLARATIAREAHDGAARIDALWAERPAFVSAMRLMTLVWGSGLVAENLLRAWMVWNWPVERVLVVAPFVGYGIYGALMLWTLWYRKVMRAHALAGLPRGGALG
>NZ_CP004384.1|WP_011401150.1|1363301_1364693_+|alkaline-phosphatase-family-protein
MAKILENVEHIVVVMFENRSFDTMLGWLYPPGTQPAHVLPARGSPQFDGLKPDMSNPSRAGKTIAVTREATNNVIPDPQETFVNVTSQILGPGGAGNPWPPMQGFVVNYETTRTSDPGHVMQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEWDVPTIFDVLSSIGASWAVYSDTAVTPSLTHTMFPSLWNDKYADNFERFPDFVAACKNDALPRYAFVEPSFLFEPNDQHPPHDVLAGDKFLHDIWTAISTSPGWPRTLLVVTYDEHGGCFDHVLPPANATPPDAASNPGDETFEFDRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSILATLRDWLAIAPDKMLKSARIANAPTLAQLFTRSVPRGDLPAIAAPSADFVQPPPSAPLNDLQKSLVTGTSRRDGNDPAASVAPIATRQHALDFFTRRATAKPT
>NZ_CP004384.1|WP_127446362.1|1362904_1363186_+|hypothetical-protein
MTTEPARASGGARSFTHRADRAAIRRHRQRHLRHQRGYRRNESVFMGGGANSAPGDEFAAMIETAPARAHPPARRVAGTPAAPPCFSRNIGYT
>NZ_CP004384.1|WP_009896602.1|1362538_1362880_+|hypothetical-protein
MIAPATPAALAAGATTFAEWAALGTLALLYLFGLGWSLRGALARSRGRAYWLACAALIAGGTACALLAKPSAPNSGEMPPGFGLGVLVVMLGIAGTTAGCAWQAIARLRHGQR
>NZ_CP004384.1|WP_009907544.1|1361174_1362365_-|serine-hydrolase
MNLESVTPATAAAAATDHAALAGRLDRVFATALAERRVVGAVALVARGGELVYRRAHGFAERETQRPMREDTLFRLSSITKPIVTVAVLRLVAAGRMALDAPITRWLPEFAPALPDGRAPALTVHQLLTHTAGLSYWLLEAPGSAYHTLGISDGIDLVDFDLAENLRRIAAAPLAFEPGSAWRYSLALDVLGAAIERETGLALPDAVAQLVTTPLGLRDTGFVAADPARFAAAYANAAPQPVRITDNLDVPLPEGHGVAVRFAPSRVFDATAFASGGAGMYGSADDVLRVLETIRTGGDGFLPAALAAAMRTDHTGPAAETRGPGWGFGYGGAVLSDPARAQSPQSAGTLQWGGVYGHSWFVDAARGLTVLLMTNTAYEGMSGPLTVEVRDAVYAV
>NZ_CP004384.1|WP_009896604.1|1358870_1360901_+|BCCT-family-transporter
MPSSRSAPRTTLKPQVVVPSLAVIGALLAVCALLPNEAGALFGAGQQWIVERFDWFYVLAITTFLIFIVLIAASRFGNIKLGPDDAEPEFSFVSWTAMLFAAGMGIGLMYFGVGEPIQHYLKPPTALGGTPAAAREAMLMSFFHWGLHAWATYGVMGLVLAYFGFRYNLPLTLRSGLYPVLREGVNGWIGHTVDAFALVGTVAGIAVTLGYGVLQLSAGLHTIAGWQTDSDAFRIGLVAVVVALAGLSAASGLDKGVRRLSELNLMLAFALLAFVVVAGPTSFLLRAFGDNVGEYLSKLVSLSFRTYAYEAPNDKGWFGGWTLLYWAWWVSWSPFVGMFIARISRGRTIREFVIGVLLVPTAFNLVWMTAFGNSAIWLDTHAAAGALAQTATNVDALLFRFFDYLPLTQLLSVAAIVLIAVFFVTSADSGAFVIDAIATRGAPHSPVWQRLFWAAVLGVTASVLLVAGGLKALQALTLVAALPVALVMLALCYGLWRGLKADHAHYSQEMAPATSFWTGQHWRQRLSQILRHTTGADARRFIAQTVEPALRKVAEELKAGGVDAHVARDDDDAVRLTVPAPAQRDFVYGARVSRKSAPAFRIREAAEPEPQREHVCEVLTFFADGRLGYDIEYLRGDEIIADVLRQYERYVSLASDTRTHLLNRAPEHAGPDGLTQ
>NZ_CP004384.1|WP_009896605.1|1357595_1358531_-|MurR/RpiR-family-transcriptional-regulator
MSDSPDSPPDAEPSIAARIAAVLPSLTPIHRRMGEYVLANPFRAATMRIDELANAVDASIATANRFARALGFDGYPALRAALVRGFEATLAPVERLRSAQEHEAGARGGELIDASFEQALANLERTRARLDRANVEAAVDSLLAARRIFIVGMGASAFLAGLMEHGLSVYRDNVQSLALLGGPTDAARRLFSARGDDLVVAIAFPRYVHDTIELTRRAAERGAPVLAITDGPDSPVAPFAARALFVHAERRLAATSEAAVLALVEALIDALAHRSQRSARAAAEVTEFMLPWLEARGACAAPPRRSRKTDR
>NZ_CP004384.1|WP_025370245.1|1370537_1371158_-|HAD-hydrolase-like-protein
MAYKLIAFDFDGTLADSLACFLLALSESARQHGFRAIDGALLPQVRGMSAHEIVKLLGVPPWKVPLIAADMRRRMHARASDVRLFAGIDATLRALAQRGTRIAIATSNSEAVVRAIAGPATCAHIRHFSCGISLFGKARRLRALAHASGFACADVLYIGDEVRDAQAADRAGIAFRGVAWGYTAPDALQAHCRMPLIERPEELLAL
>NZ_CP004384.1|WP_025370244.1|1371519_1372782_-|MFS-transporter
MTKIARRLMPLLVIMFLIAFIDRQNVGFAKLQMVHALGMTETSYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMMTWGVITVLLGFTHSTSVFYVFRFLLGVAEAGFYPGVIYYLTLWFPQSHRTRVLGLFTLGSALANMLGSLAGGLLLSLDGRLGLAGWQWVFVATGLPAVAVAFVALRYLPESVERATFLADDEKRVVLAALKREASPEAVSESPWRALVDPRVLMFALAYMLMSTSLYGVTYWLPTLLKSSGVPASLNGLLNMIPWAIAALLLLWLPARLKRERLVLKAMAIVAGVGVAGFALSLALPGLPLCFAALVLGGACIPLLYPCFWSLPPRFFSGARAAASIAAINSIGNLGGFFAQNLMPYVGKAAGSTSAPMLVPVVCLAALGVGMLAAASVAGRRRAAGMAA
>NZ_CP004384.1|WP_009899924.1|1372982_1373708_+|GntR-family-transcriptional-regulator
MHATDDRLPRYQRLRDELAALIAARHWRPGEAIPTEQALAKRYDVAIGTVRKAVDLLVADGMLERFQGRGTFVRRASFDSSLFRFFRFQSKHGERRIPESRILRREVVEATSAVAAALQIPARAPVIEMTRVRLIDGAPMLAEEIWLPYDRFAAFSRLELDSIGDLLYPVYEAHCNQIVASATETLTVEAIGPVHARLLRIEPGTPAVVIERLAYGYDRRPLEWRRSRGPASEFIYQAEIR
>NZ_CP004384.1|WP_011401144.1|1373757_1375065_+|MFS-transporter
MFEWFATVSLRERRTFWACFGGWALDALDMQMFSLVIPAIVAEWSLSRTQAGFVGGATLVASAIGGWVAGMLSDRFGRVRTLQWTIACFAVGTFACAFATSYPQFVVLKALQGAGFGGEWAAGAVLMAETIRAEHRGKAMGAVQSAWALGWAAAVLLYALAFSLMPAALAWRAMFAIGLLPALLIVYVRRGIVEPSVSASSPSNTPAAARASVPLVGIFSRDTRRMTLIGALLGVGAHGGYYALMTWLPTYLKVERHLSVLGTGGYLAVIIVAFFCGCIASAQLLDRIGRRGTILAFAACCIATVIAYLFLPLGNAAMLVLGFPLGFFAAGIPASMGALFNELYPRGTRGTGVGFCYNFGRVASAGFPVLVGHMSADMPLGTAIGIDAAIAYSIVVVAVLLLPETRARALDDLAVAHATADARADRIGAPGARHR
>NZ_CP004384.1|WP_009907539.1|1375116_1376007_+|amidohydrolase-family-protein
MSGQEWSACAHAAAMRRAASDITAIDAHAHVFETGLPLAGRRRYAPDYDAPLDAYLAQLDAHRVSHGVLVQPSFLGSDCRYLLRALAQQPRRLRGVAVIDAGCEPHVLDTLDRAGVVGIRLNLIGMPDPALDGPAWRATLERIAALRWHVELHAQAQRLGRLIAPLLAHRVNVVVDHFGRPNPACGIADAGFRDLLRTAATRRVWVKVSGVYRNWPLAPGEANARAQEAFDALAAEFGAERLVWGSDWPHTQFERTETFGRAFALARQWMRDDAMRRAIFVETPARLFRFGELHGA
>NZ_CP004384.1|WP_011401142.1|1376225_1377704_+|ser/threonine-protein-phosphatase
MPRPILRRAAALLPTLASAALLQACTSSIDNQPDAASASANIQAAWVEIGDANQAIARVITSYAPPAAAPGEAAPAVCPQLNADGKIARMTLRAAAGTAAQRPTASDPADSKPSGFPVSVCEATVPANAKGVTVAGRALPLPKAEPQRVAIIADTGCRMKKADNAFQACSDATVWPFATIAASVAKLNPDLVLHVGDYHYRENACPPDIAGCKNSPWGYGWDAWRADLFEPAAPLLAKAPWVVVRGNHEECARAGQGWFRFLDPRPYSDARSCNDPANDGNANYSEPYAVPLGTGSQVIVFDTAKVGRAALKTTDVQFQIYQKQFQTVAALANKPGMSTTIFTNHHPILAFAPIPGSTPAPGNLALQSVMSSLYAQAYYPPGVQIALHGHVHDFQAINFASGHPATIVSGNGGDNLDVALPDPFPANLTPAPGVVIDKLSHNNSFGFLIMERRAAPARGWTFKAYTAAGKLLASCDQAGTTLTCDKTGFVAP
>NZ_CP004384.1|WP_009907537.1|1377700_1379332_+|cytochrome-c-methylamine-utilization-protein
MTGRRRSSAARRAVPAAALTARASVTAFALGPAALGTTRTRRTVLTLSTIVRAACGALAACASAIALASGPAAPDATHSTHAARPASAASSTSPMNPTSTPGASGPAHAKAALDAARAKAAPPSPPTTVLLPGAPPERVVDTIGRGTPQVASKVDPTAAVFRPDPTLAALGKRVFFDPALSEPRGMSCASCHDPGRAFAPTLSPAALAGPRVPQGSRPGHFSRRNAPSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASAAALMRKIGRTGLGAALAGRFGPSVRRDPERMVRVLGEAMQAYLQSDEMAPFSSRYDAYVTKRAPLTPQEMRGLALFRNPDKGNCMSCHTLSDTASRPERSLFTDFGYDAIAVPRNRALPANRDPRHFDNGLCDTAAKLRWPEPTQWCAYLRTPGLRNVAIKESFMHNGVFDTLRDAVAFYNTRSTDPARWYHGRDTFDDVPRAYRGNVNVNSTPMNRRPGTPPAMTDADVDDLVAFLRTLTDARYVGLMPAAPDGKAARP
>NZ_CP004384.1|WP_009896587.1|1379494_1380355_+|class-I-SAM-dependent-methyltransferase
MSNQSIAAPDSTAVRVALWRALHVEIDAPPHVLDDGIGLELAAPDDDWRSRPDMAPQATRGYRASIVGRARFVEDLIGEQAERGVAQYVVLGAGLDTFAQRRAKLASHLRVFEIDQPGTQAWKRQRLIALGYGVPEWLRLVPVDFEASGAWRAQLSAAGFDDSRPAVVSSTGVSMYLTRDAIAGTLRRIATLAPGSTLAMTFLLPLELIDDPAERAQHAAVYERARAAGTPFVSFFSPAEMLALAREAGFREVRHVSTDDLVRRYFEGRPDGLRPSSGEAFLVAST
>NZ_CP004384.1|WP_009896586.1|1380668_1380941_+|hypothetical-protein
MEHLVRIVNDTDRQILAWLRNQVGDERVERAAQHMGRVRKPYLSAVCRYLGVWPPISLRYQTRRAEVDHAVGDRYLTLIRQHLATHAASR
>NZ_CP004384.1|WP_011401139.1|1381245_1381458_+|DUF3079-domain-containing-protein
MAKKFPLHPKHPERNCWGCDRYCSVDALSCGNGSDRTQHPVELLGDDWYEWEQENEAAQKQMQQTQAAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1560493 : 1566559

Burkholderia_virus(28.57%)

integrase

attL 1555353:1555368|attR 1575714:1575729

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1555353:1555368	attL	NA	NA	NA	NA
WP_009893915.1\|1560493_1561066_+\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	1.7e-55	65.9
WP_011401460.1\|1561684_1562182_+	hypothetical protein	NA	NA	NA	NA
WP_011401461.1\|1562610_1563027_-	type II toxin-antitoxin system HicB family antitoxin	A0A0A8JBA5	Ralstonia_phage	1.2e-26	58.9
WP_009893919.1\|1563070_1563250_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	1.2e-18	74.6
WP_011401462.1\|1563529_1564057_+	hypothetical protein	A4JWV5	Burkholderia_virus	6.2e-60	66.1
WP_011401463.1\|1564053_1564788_+	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	3.0e-52	50.9
WP_009893924.1\|1564797_1565913_+	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	8.6e-176	80.4
WP_009893925.1\|1565983_1566559_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	2.3e-23	39.0
1575714:1575729	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2119218 : 2197133

Ralstonia_phage(42.86%)

transposase,plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009894648.1\|2119218_2121414_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_009894655.1\|2123128_2124145_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_009894657.1\|2124163_2124616_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009894659.1\|2125151_2125997_+	ABC transporter permease	NA	NA	NA	NA
WP_009907076.1\|2125983_2126838_+	ABC transporter permease	NA	NA	NA	NA
WP_009894662.1\|2126834_2127866_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_009894663.1\|2128414_2129485_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.6e-62	43.4
WP_009894664.1\|2129644_2129950_+	H-NS histone family protein	NA	NA	NA	NA
WP_011400785.1\|2130271_2133052_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.8e-89	34.2
WP_025370043.1\|2133065_2135306_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	4.0e-23	28.9
WP_011400791.1\|2135444_2136980_+	DUF2875 family protein	NA	NA	NA	NA
WP_025370045.1\|2136989_2137253_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_080713257.1\|2138088_2139579_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.0e-06	28.4
WP_025370050.1\|2139717_2141256_+	DUF2875 family protein	NA	NA	NA	NA
WP_009894681.1\|2141265_2141529_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_004523721.1\|2141943_2142363_-	YjbQ family protein	NA	NA	NA	NA
WP_009894689.1\|2142382_2142709_-	thioredoxin family protein	NA	NA	NA	NA
WP_004523719.1\|2143181_2143874_+	hypothetical protein	NA	NA	NA	NA
WP_009894695.1\|2144683_2145040_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_041223675.1\|2145514_2146657_-	porin	NA	NA	NA	NA
WP_009907082.1\|2147288_2148212_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009894700.1\|2148773_2149097_-	hypothetical protein	NA	NA	NA	NA
WP_127446348.1\|2149285_2149597_-	hypothetical protein	NA	NA	NA	NA
WP_009894702.1\|2149724_2149970_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_009894703.1\|2150102_2151302_-	transcriptional regulator CynR	NA	NA	NA	NA
WP_025370053.1\|2151301_2152726_-	TolC family protein	NA	NA	NA	NA
WP_009894706.1\|2152719_2153619_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_009894707.1\|2153620_2153845_-	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_041223677.1\|2153841_2155908_-	FUSC family protein	NA	NA	NA	NA
WP_025370055.1\|2156917_2158459_-	membrane protein	NA	NA	NA	NA
WP_154660021.1\|2158806_2159163_-	hypothetical protein	NA	NA	NA	NA
WP_025370056.1\|2160007_2162491_+	hypothetical protein	K4F7R4	Cronobacter_phage	9.0e-08	46.1
WP_025370057.1\|2162566_2164018_-	PhoPQ-regulated protein	NA	NA	NA	NA
WP_009907087.1\|2164268_2164667_-	hypothetical protein	NA	NA	NA	NA
WP_011400800.1\|2165448_2166003_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_011400801.1\|2166084_2166810_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_162465482.1\|2166858_2167017_-	hypothetical protein	NA	NA	NA	NA
WP_009894721.1\|2166969_2169666_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_009894722.1\|2169685_2170231_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_009907089.1\|2170261_2170951_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_009894727.1\|2170953_2172630_+	OmpA family protein	NA	NA	NA	NA
WP_009894728.1\|2172973_2173513_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009894729.1\|2173546_2175046_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009894730.1\|2175246_2175729_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_011400803.1\|2175856_2176399_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_009894732.1\|2176404_2177754_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_009894733.1\|2177750_2179052_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_009894736.1\|2179066_2182975_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_009894738.1\|2183144_2183714_+	hypothetical protein	NA	NA	NA	NA
WP_041223680.1\|2183814_2186421_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.8e-35	26.0
WP_004523693.1\|2186495_2186765_+	PAAR motif protein	NA	NA	NA	NA
WP_025370061.1\|2186777_2190230_+	RHS repeat protein	NA	NA	NA	NA
WP_038707671.1\|2190122_2191481_-	hypothetical protein	A0A292GJ55	Xanthomonas_phage	2.6e-110	49.7
WP_009894750.1\|2191513_2192542_-	fimbrial protein	NA	NA	NA	NA
WP_009894751.1\|2192597_2193668_-	type VI secretion protein ImpA	NA	NA	NA	NA
WP_025370062.1\|2193686_2194736_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_009894755.1\|2194732_2196613_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009894757.1\|2196614_2197133_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP004383

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP004383_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004383_1

2235987-2236085

Orphan

Consensus_repeat	Method
GCGAAGTGCGTGCGCGGCGGCGCGCATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP004383_1

>merge|NZ_CP004383|1|2235987-2236085|CRISPRCasFinder
GCGAAGTGCGTGCGCGGCGGCGCGCATGCGGCGGTCAATGCGGTGGCGAAGCGGGGGGGCGATGCGGAGGAGCGAAGCGCGTGCGCGGCGGCGCGCATG

>NZ_CP004383|1|1|2235987-2236085|CRISPRCasFinder
GCGAAGTGCGTGCGCGGCGGCGCGCATG	CGGCGGTCAATGCGGTGGCGAAGCGGGGGGGCGATGCGGAGGA
GCGAAGCGCGTGCGCGGCGGCGCGCATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004383.1\|WP_009890520.1\|2236384_2237797_+\|8-oxoguanine-deaminase	unknown	unknown	gnl\|CDD\|236184
NZ_CP004383.1\|WP_009890521.1\|2237986_2238916_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176152
NZ_CP004383.1\|WP_009890502.1\|2226609_2227305_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP004383.1\|WP_011402249.1\|2227460_2228951_+\|NCS1-family-nucleobase:cation-symporter-1	unknown	unknown	gnl\|CDD\|271404
NZ_CP004383.1\|WP_038712604.1\|2229970_2230924_+\|allantoinase-PuuE	unknown	unknown	gnl\|CDD\|211797
NZ_CP004383.1\|WP_162465428.1\|2244481_2244682_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004383.1\|WP_009890543.1\|2242483_2243689_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP004383.1\|WP_038707963.1\|2230923_2231445_+\|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase	unknown	unknown	gnl\|CDD\|225736
NZ_CP004383.1\|WP_011402254.1\|2241054_2241543_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004383.1\|WP_009890510.1\|2232694_2233207_+\|ureidoglycolate-lyase	unknown	unknown	gnl\|CDD\|179606
NZ_CP004383.1\|WP_127462262.1\|2238971_2239613_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004383.1\|WP_009890518.1\|2235399_2235753_-\|hydroxyisourate-hydrolase	unknown	unknown	gnl\|CDD\|225226
NZ_CP004383.1\|WP_009909169.1\|2231684_2232698_+\|allantoicase	unknown	unknown	gnl\|CDD\|237319
NZ_CP004383.1\|WP_009890522.1\|2239667_2239877_-\|dodecin-domain-containing-protein	unknown	unknown	gnl\|CDD\|377810
NZ_CP004383.1\|WP_038712601.1\|2228961_2229825_+\|aspartate/glutamate-racemase-family-protein	unknown	unknown	gnl\|CDD\|226611
NZ_CP004383.1\|WP_009890516.1\|2234147_2235350_-\|membrane-protein	unknown	unknown	gnl\|CDD\|368779
NZ_CP004383.1\|WP_004192898.1\|2241868_2242300_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|237569
NZ_CP004383.1\|WP_004521233.1\|2243802_2244483_-\|PspA/IM30-family-protein	unknown	unknown	gnl\|CDD\|224755
NZ_CP004383.1\|WP_009890512.1\|2233593_2233932_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004383.1\|WP_038712608.1\|2239965_2240904_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995

Protein	Function_ID	Function_description	E-value
NZ_CP004383.1\|WP_009890520.1\|2236384_2237797_+\|8-oxoguanine-deaminase	gnl\|CDD\|236184	PRK08203, PRK08203, hydroxydechloroatrazine ethylaminohydrolase; Reviewed.	0
NZ_CP004383.1\|WP_009890521.1\|2237986_2238916_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176152	cd08463, PBP2_DntR_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.40332e-127
NZ_CP004383.1\|WP_009890502.1\|2226609_2227305_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.67953e-47
NZ_CP004383.1\|WP_011402249.1\|2227460_2228951_+\|NCS1-family-nucleobase:cation-symporter-1	gnl\|CDD\|271404	cd11555, SLC-NCS1sbd_u1, uncharacterized nucleobase-cation-symport-1 (NCS1) transporter subfamily; solute-binding domain. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and solute carrier 6 family neurotransmitter transporters (SLC6s).	0
NZ_CP004383.1\|WP_038712604.1\|2229970_2230924_+\|allantoinase-PuuE	gnl\|CDD\|211797	TIGR03212, uraD_N-term-dom, putative urate catabolism protein. This model represents a protein that is predominantly found just upstream of the UraD protein (OHCU decarboxylase) and in a number of instances as a N-terminal fusion with it. UraD itself catalyzes the last step in the catabolism of urate to allantoate. The function of this protein is presently unknown. It shows homology with the pfam01522 polysaccharide deacetylase domain family.	0
NZ_CP004383.1\|WP_009890543.1\|2242483_2243689_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	1.23436e-06
NZ_CP004383.1\|WP_038707963.1\|2230923_2231445_+\|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase	gnl\|CDD\|225736	COG3195, COG3195, Uncharacterized protein conserved in bacteria [Function unknown].	3.08249e-76
NZ_CP004383.1\|WP_009890510.1\|2232694_2233207_+\|ureidoglycolate-lyase	gnl\|CDD\|179606	PRK03606, PRK03606, ureidoglycolate lyase.	4.0966e-102
NZ_CP004383.1\|WP_009890518.1\|2235399_2235753_-\|hydroxyisourate-hydrolase	gnl\|CDD\|225226	COG2351, COG2351, Transthyretin-like protein [General function prediction only].	3.76465e-65
NZ_CP004383.1\|WP_009909169.1\|2231684_2232698_+\|allantoicase	gnl\|CDD\|237319	PRK13257, PRK13257, allantoicase; Provisional.	0
NZ_CP004383.1\|WP_038712601.1\|2228961_2229825_+\|aspartate/glutamate-racemase-family-protein	gnl\|CDD\|226611	COG4126, COG4126, Hydantoin racemase [Amino acid transport and metabolism].	4.13185e-80
NZ_CP004383.1\|WP_009890516.1\|2234147_2235350_-\|membrane-protein	gnl\|CDD\|368779	pfam06181, Urate_ox_N, Urate oxidase N-terminal. Cytochrome c urate oxidase (Uox) PuuD is involved in purine degradation. In contrast with soluble Uox it is a membrane protein with an 8-helix transmembrane N-terminal domain and a C-terminal cytochrome c.	0
NZ_CP004383.1\|WP_004192898.1\|2241868_2242300_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|237569	PRK13952, mscL, large conductance mechanosensitive channel protein MscL.	2.50619e-80
NZ_CP004383.1\|WP_004521233.1\|2243802_2244483_-\|PspA/IM30-family-protein	gnl\|CDD\|224755	COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms].	5.00746e-22
NZ_CP004383.1\|WP_009890522.1\|2239667_2239877_-\|dodecin-domain-containing-protein	gnl\|CDD\|377810	pfam07311, Dodecin, Dodecin. Dodecin is a flavin-binding protein,found in several bacteria and few archaea and represents a stand-alone version of the SHS2 domain. It most closely resembles the SHS2 domains of FtsA and Rpb7p, and represents a single domain small-molecule binding form.	1.01699e-32
NZ_CP004383.1\|WP_038712608.1\|2239965_2240904_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	4.30917e-79

>NZ_CP004383.1|WP_009890518.1|2235399_2235753_-|hydroxyisourate-hydrolase
MGKLTTHVLDTAHGRPGAAIKIELHAISGGGSRLLKTALTNDDGRCDAPLLEGDALAAGTYELVFHAGDYFAAQGVALPEPRFVDLVVLRFGVADPAAHYHVPLLVSPWSYSTYRGS
>NZ_CP004383.1|WP_009890516.1|2234147_2235350_-|membrane-protein
MEGFIIDWLNLAIRWLHVVAAIAWIGESFYFVALDNSLKPPKDAQLKSRGVFGELWHVHGGGFYNMQKYLVAPPEMPEDLHWSKWPSYTTWMSGFGLFFVLYLLAPNTYLIDRNVLDMGPVVAVASALGFLLAGWIVYDCACRMLGGRDKLLGVFVGLYVIAAAYIACHVFSGRAAYLIVGAMLATIMTANVFFVIIPGQRKMVDKLLKGETPDPIYGKRGKQRSVHNTYFTLPVVFAMLSNHYAMTYTNQYNWIVLVVIMLAGALIRQFFVMRHRGQQLWYLPLGGVALMLLALVTTMPKPIAPEAQAANAPNVPKLAIKDVAPILQQRCVACHSAKPTLVGSAPAGVMFDTSDEIARNAPRIYQQAVQLKAMPIGNLTHMTDDERTKIAAWFESGATK
>NZ_CP004383.1|WP_009890512.1|2233593_2233932_+|hypothetical-protein
MVIVGCIYLLVFAPLVYVLFLLHGMTIRLGGACLGIAAWVALSIAAIGIVRGWAWSRHWLIGGLIGLWIVSSNAGANGGDVAARGLDYICVALPLFTRRSTAFFRSRRDIEA
>NZ_CP004383.1|WP_009890510.1|2232694_2233207_+|ureidoglycolate-lyase
MNTLAIEPLTRAAFAPFGDVIETAGAKQIPINLGTTVRFHDLARIDVADEGGRPLVNLFRGQPRTLPFEVTMLERHPLGSQAFIPLTDRPYIVVVAPAGVLDPPKIRAFVTSGWQGVNYAKGVWHHPLIALGGVSDFIVVDRGGGGGNLDEQDLAGSLWLTEDALLAVSA
>NZ_CP004383.1|WP_009909169.1|2231684_2232698_+|allantoicase
MALPLSDPNAPEFTRRYVNLADPRLGAQALEASDDFFAPKERMLSPEPAVFIPGKYDDHGKWMDGWETRRKRTTGYDWCIVKLARPGVIKGFDIDTSHFTGNFPPAASIEAAHVPDGVPNEATKWVEVVPSTTLQGNSHHYVEARDANAYTHLRVNIYPDGGIARLRVYGQPQLDWAGASRSELFDLAAMDNGGYVVAANNQHFGLASNMLLPGRGVNMGDGWETRRRREPGNDWAIVALAQPGVIRKIEVDTAHFKGNFPDRCSVQAAYVTGGTDSSLVTQAMFWPVLLGEQKLQMDKQHVFEAELAALGPVTHVRLNIIPDGGVSRLRVWGTLDK
>NZ_CP004383.1|WP_038707963.1|2230923_2231445_+|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase
MKAMRYTLEQLNAMSTEAFVAALSGIFEHSPWVAEAAAAARPFSSIDALHRTMRDAVDAAGDARQLALINAHPELAGKAAVRGELTAESTREQSGAGLDRCTQEEFDKLQRLNRAYREKFGFPFILAVRGYDRHGIIENFEARIDHTQDEELRASLGQIYRIARFRLDDLIDA
>NZ_CP004383.1|WP_038712604.1|2229970_2230924_+|allantoinase-PuuE
MAFDPNYPRDLVGYGRHPVQANWPGRARVAVQFVLNYEEGGENCVLHGDPASEQFLSEIVGAAAYPARHMSMESIYEYGSRAGVWRILREFDKRGLPLTVFGVGMAIERHPELARAFVEFGHEIACHGWRWIHYQDMTPECEAEHMKLGMEAIERVTGVRPLGWYTGRDSPNTHRLVAEYGGFLYDSDHYGDDLPFWMDVEVPGGARAPQLIVPYTLDANDMRFATPQGFNTADHFFHYLRDAFDVLYEEGDEAPKMMSIGMHCRLLGRPGRFRALQRFLDHIERHDRVWVARRVDIARHWREHHPYRPHARREGDA
>NZ_CP004383.1|WP_038712601.1|2228961_2229825_+|aspartate/glutamate-racemase-family-protein
MKIKLINPNTTQRMTDAMGRCAREVAAAGTAIVAVSPAMGPPSIEGHYDEALATPGLLAEVAAGERDGFDGYVIACFGDPGLYAARELARGPVIGIAEAAMHAASVLAPGFSVVTTLARTCGMAWHLAERYGMKRFCRNVRATDVAVLDLDRPGSAARRVIVDECRRALDEDGTDAIVLGCAGMAEFAHEIEAAIGAPVVEGVTAAVKWAEALIALKLATAKRGDFARPLAKRYDGEFARFSPDGAFARGAEAAAGAAVGPDAAAPGAAIQDARSPDAFAQPHIHSV
>NZ_CP004383.1|WP_011402249.1|2227460_2228951_+|NCS1-family-nucleobase:cation-symporter-1
MAQFSVAQQSASYRPNEGRPGDPDGGAAMPAGYSKRLYNEDLAPLANQNWGAYNIFAFWMSDVHSVGGYVFAGSLFALGLTSWQVLAALIVGISIVNVLCNLIAKPSQQLGVPYPVACRATFGVLGANVPAVIRGLIAIAWYGIQTYLASSALVIVVLKFFPQWMPYADVHRYGFLGLSALGWAGFMLLWVLQAFVFWNGMETIKKFIDFAGPAVYVVMFVLAGYMVWRAGWRNIGLDLGGVKYHGAEVLPVMVTAISLVVSYFSGPMLNFGDFSRYCRSYGSVKRGNFWGLPVNFLAFSLVTVITTAATLPVFGQLITDPVETVGRIDHPTAVILGALTFTIATIGINIVANFVSPAFDFSNVAPRLISWRAGGMLAAVASVFITPWNLFNNPAVIHYTLDVLGSFIGPLYGVLIVDFYLVKRGALRRDDLYTTSADGAYWYRDGVNRRAVAALLPAAAIAVACVMVPAPSGLANFSWFIGAALGGAFYRALAKA
>NZ_CP004383.1|WP_009890502.1|2226609_2227305_+|GntR-family-transcriptional-regulator
MTKKDSALTGASPESIAERIRTAILEHRLAPGTKLTEAQLCEVFGVKRGTIRQALALLATDRLVDLEPNRGAFVASPTLQDVHEVFEMRRIVELAVMERLATGPGAKRLKGVAATIDKERHAFERRDFPAWIRLSGEFHTELAALTGNTVLRDCLGGLVARSTLMSALYESHGRSPCSFDDHAQILAALEAGDAKRAAQLMAHHLQHVELRMLDRPAQGAVDLREVFGHSG
>NZ_CP004383.1|WP_009890520.1|2236384_2237797_+|8-oxoguanine-deaminase
MERYSSARAGAQSQSPNRPRTLVVKHADVLVTMDGARRELRDAGLYVEDNRIVAVGPSAELPAQADEVLDLRGHLVIPGLVNTHHHMYQSLTRAIPAAQNAELFGWLTNLYRIWAHLTPEMIEVSALTAMAELLLSGCTTSSDHLYIYPNGSRLDDSVAAAQRIGMRFHASRGSMSVGQRDGGLPPDSVVEREPDILRDTQRVIETYHDEGRYAMLRVVVAPCSPFSVSRGLMRDAAALAREHRVSLHTHLAENANDVAYSRETFGMTPAEYAEDLGWVGRDVWHAHCVQLDESGIALFARTGTGVAHCPCSNMRLASGIAPVARMRVAGVPVGLGVDGSASNDGAQMVAEVRQALLLQRVGFGPDAMTARDALEIATLGGARVLNRDDIGALAPGMAADFVAFDLRTPQFAGALHDPVAALVFCAPSQAAYSVVNGRVVVREGRLTAFEIEPLVERHNALAKALCEAAR
>NZ_CP004383.1|WP_009890521.1|2237986_2238916_-|LysR-family-transcriptional-regulator
MSQQREAIDTYLLRVLHTLLMERSVTRAAVKLNQSQPAISAALRRLRDITGDPLLVRGKSGMVPTEYGLRLLEPVQNALREIERIKFQQHNFDPATSIRCYRIGCPDYLNVLFVPTVVERFRQAAPNATLEFHSLGPAFDYELALEDGKLDIVVGNWPEPPEQLHLSNLFVDEIVCLMSNAHPFAKRGGLTLDQYLNAPHLAPTPYSVGQRGAIDVHLARERLKRHVVVTLPYFNLAPYVLVKSDLIFTTTRLFADHYAKFLPLSVVPAPLDFPPMQYYQLWHERCHYSDEVRWLRGLVAEATRTLIDA
>NZ_CP004383.1|WP_127462262.1|2238971_2239613_-|hypothetical-protein
MERSFAREATVAPRHTRNACRILPLPRCGIRRNRHASRRTSRVSGERSSCPHDDLRRTARRRSFTAFRTAGPLAEIDAESATPSRATHNDNIAPTRIDTRDAPVRRADVRGRRVTGLASFARRRIDLFSSLVSPSSLAIHFLPPFLPPLFRTPFRIPFCAPFRHPFRDPHRRAFARLHRKLVTRRPRRSPVANRPRRARRLECAALDAPLCPY
>NZ_CP004383.1|WP_009890522.1|2239667_2239877_-|dodecin-domain-containing-protein
MNDHVYKLLELTGSSRQSSDDAIRNAISKAAKTMRNLHWFEVTDMRGHIEGDQVIHWQVTLKVGLRIED
>NZ_CP004383.1|WP_038712608.1|2239965_2240904_+|NAD(P)-dependent-oxidoreductase
MMGGNFNRYSNERKGEDVDVGFCGPGLMGAPMIRHLLSAGHRVHVWNRTRAKADALAAHGAQVVDTPAELAARAQTVMLCVLDAQAVGDVVFGASGVLAGDAAVRCVTRIVDHSSIPPAATRAYAARAAALGASWVDAPVSGGVPGAEAGTLAVMAGGAQADVDAVRGLIGAYASRVTHLGDAGAGQTAKLCNQAIVTASVTAIAEAVGLAQASGIDAARLAEALAGGWADSVLLQTFVPRMTSTGHPPIGALKTFQKDVDAIADAARDAGAVMPVAATVQQVLRLGAAMGLAQADFAAFIDIVRPQAKRGE
>NZ_CP004383.1|WP_011402254.1|2241054_2241543_-|hypothetical-protein
MRMPHFLQLFLRRVFMSFPKKRRRAQPDGQESFLAVLRHAKPFAQLDTKIARARAQDEPVLYAHVLPGLDVLLCSVRGAQPPYPAIVELRKRCIESIANALEQPLDGLENGGYWYEANGFGFLVFASRARARILPEFGAGVKAGLRSGIGQPNAGDTTPRSL
>NZ_CP004383.1|WP_004192898.1|2241868_2242300_-|large-conductance-mechanosensitive-channel-protein-MscL
MSIIKEFKEFAVKGNVMDLAIGVIIGGAFSKIVDSVVKDLIMPVIGVLTGGLDFSNKFVLLGQIPASFKGNPESFKDLQAAGVATFGYGSFITVLINFIILAFIIFLMVKFINKLRKPEEAAPAATPEDVLLLREIRDSLKQR
>NZ_CP004383.1|WP_009890543.1|2242483_2243689_-|tetratricopeptide-repeat-protein
MKKLLAAVGLSLILVSAAANAAVPSLQQIQQSIAQGNWQRADAQLSQVIDAYPDNARARYLYGQVLDREGRPAEALAQIERAKSLDPQLRFTDPSRFAQTEARVRADARRATSAQSSRSATSGGMLVAPQTQGQAQSQFAAAPAAPAHRGPSAGMWIGFAVLIGAIVLVLRRTLRRARSADDQRAGDERRAQLKRATDVLNDVRPLKLDARLSTAPGAGALNGEIEALEAQARELVETLSNGQNPVPPYRLDELEKQFASLKARVEGRPDPGAASAAANAPGQTGSVFAQEADRLTGAQGQPPYSPYPPQPQQQPPVVIQQGGGFGGGMGGLLTGVLLGQAMSNGRDRVIEREVIVDDEARRRAGADPGIDFGQGDSWDSGGSDGGGIDLGSSGDDWSNNG
>NZ_CP004383.1|WP_004521233.1|2243802_2244483_-|PspA/IM30-family-protein
MSLFDSISRTIKGLLNDAADSVQDPSRDARQIVRELDDSIGRAENSLIEIEAQVATQRSKRDTADERAKKYEDGAKRALQSGDEALAREALAAQANAEAERDALARELDTLEPSVDKLKGQIADMRARRNDLNARSNILQAKQEIAQAKDVAATALGGIGGKNLSEDFQKLEDKVALSNARSDARLNSADTNSGRALDDKLAALNKGPSVEDRLEALKKQLNTPAQ
>NZ_CP004383.1|WP_162465428.1|2244481_2244682_+|hypothetical-protein
MDSSVSDERCAYRGRRFAAARARCVGGYYTTGSLKHRLNAARTPARAGRRALAAATENMAAGGHFQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

462076 : 519443

Vibrio_phage(23.08%)

integrase,tRNA,transposase,protease

attL 472155:472173|attR 520122:520140

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009893562.1\|462076_462613_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_009902157.1\|462622_463966_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	1.0e-37	28.2
WP_009893567.1\|464371_464914_-	response regulator transcription factor	NA	NA	NA	NA
WP_009893568.1\|464933_466214_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_025369664.1\|466231_466489_-	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_009893574.1\|466814_467714_+	acetylglutamate kinase	NA	NA	NA	NA
WP_009893575.1\|467710_468514_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_009893577.1\|468480_469173_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_009893578.1\|469478_470624_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_009893580.1\|470620_471235_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_009893581.1\|471246_472560_+	AmpG family muropeptide MFS transporter	NA	NA	NA	NA
472155:472173	attL	NA	NA	NA	NA
WP_009893583.1\|472549_473590_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_009893585.1\|473817_474762_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_009893586.1\|474980_476045_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.5e-81	46.7
WP_009893587.1\|476185_476956_-	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	2.4e-28	32.7
WP_009893588.1\|476987_477827_-	polyphosphate kinase	NA	NA	NA	NA
WP_009893589.1\|477953_479426_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_009893590.1\|479428_480919_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_009893592.1\|481045_481345_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_004189550.1\|481710_482754_+	rod shape-determining protein	NA	NA	NA	NA
WP_009908314.1\|482873_483953_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_009893619.1\|483949_484462_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_009893621.1\|484625_487034_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_009893622.1\|487045_488194_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_025369666.1\|488311_489079_-	sel1 repeat family protein	NA	NA	NA	NA
WP_009893625.1\|489075_489861_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_009893627.1\|490206_490659_-	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	1.3e-13	30.1
WP_009893629.1\|490678_491311_-	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	1.9e-07	34.7
WP_009893630.1\|491408_492143_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.1e-50	42.5
WP_009893632.1\|492603_493290_-	response regulator	NA	NA	NA	NA
WP_009893633.1\|493290_495699_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_009893635.1\|495700_496291_-	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_009893636.1\|496287_497700_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_038712271.1\|497938_499207_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.8e-43	42.7
WP_025369668.1\|499868_500444_+	recombinase family protein	A0A219Y912	Aeromonas_phage	5.4e-25	41.5
WP_144241895.1\|500490_501543_-	hypothetical protein	NA	NA	NA	NA
WP_009908294.1\|502990_503215_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_009908295.1\|503628_504789_+	DUF4382 domain-containing protein	NA	NA	NA	NA
WP_009902052.1\|504853_505009_+	lipoprotein	NA	NA	NA	NA
WP_011400919.1\|505139_506360_+\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	3.0e-238	99.0
WP_025369669.1\|506995_507556_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_009902065.1\|508042_508390_+	hypothetical protein	NA	NA	NA	NA
WP_009908298.1\|508610_509165_+	YaeQ family protein	NA	NA	NA	NA
WP_009908299.1\|509292_509709_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_025369670.1\|510111_511206_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	2.2e-19	37.4
WP_009908301.1\|511202_512144_+	3-methyladenine DNA glycosylase 2	NA	NA	NA	NA
WP_009908302.1\|512293_513907_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_009908303.1\|513922_515374_-	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	3.4e-31	34.4
WP_009908304.1\|515616_516165_-	hypothetical protein	NA	NA	NA	NA
WP_025369671.1\|516840_518109_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.8e-43	42.7
WP_025369672.1\|518213_519443_-\|integrase	tyrosine-type recombinase/integrase	G9L697	Escherichia_phage	8.0e-66	36.8
520122:520140	attR	NA	NA	NA	NA

DBSCAN-SWA_2

685994 : 693031

Pseudomonas_phage(33.33%)

integrase

attL 687166:687216|attR 697222:697272

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009910245.1\|685994_687023_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	1.2e-46	41.3
687166:687216	attL	NA	NA	NA	NA
WP_080556798.1\|687358_687664_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_009910243.1\|687863_688181_-	transcriptional regulator	A0A088CD40	Shigella_phage	2.1e-15	59.2
WP_009910242.1\|688188_688521_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	9.8e-19	51.9
WP_038708106.1\|688562_689150_-\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	2.0e-43	48.9
WP_038712299.1\|689497_690274_-	hypothetical protein	A0A1W5LU59	Ralstonia_phage	4.3e-33	40.9
WP_038712304.1\|690740_692129_-	type II secretory pathway protein	NA	NA	NA	NA
WP_009910232.1\|692125_693031_-	hypothetical protein	Q6UAZ2	Ralstonia_phage	4.9e-28	36.1
697222:697272	attR	NA	NA	NA	NA

DBSCAN-SWA_3

765304 : 827934

uncultured_Caudovirales_phage(10.0%)

integrase,transposase,holin

attL 815596:815611|attR 827947:827962

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009892020.1\|765304_766510_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_009906597.1\|766848_767457_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_009910123.1\|767607_768498_+	ATPase	NA	NA	NA	NA
WP_009910122.1\|768623_769445_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_009910121.1\|769624_770329_-	aquaporin Z	NA	NA	NA	NA
WP_009906591.1\|770634_770931_+	H-NS histone family protein	NA	NA	NA	NA
WP_009910119.1\|771033_772098_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_080511675.1\|772620_773013_+	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_009906585.1\|773106_773658_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_009906583.1\|773859_774720_+	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_009906582.1\|774736_775771_+	flagellar motor protein MotB	NA	NA	NA	NA
WP_009906581.1\|775801_776182_+	response regulator	NA	NA	NA	NA
WP_025369713.1\|776213_778445_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_009906577.1\|778475_779003_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_025369714.1\|779043_781026_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-12	41.5
WP_009906572.1\|781029_781977_+	chemotaxis protein CheR	NA	NA	NA	NA
WP_011402604.1\|781973_782678_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_009906568.1\|782674_783778_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_004185006.1\|783863_784259_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	2.7e-07	32.8
WP_011402603.1\|784260_784989_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_009910093.1\|785189_785693_+	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_009910092.1\|785715_787029_+	DUF3443 domain-containing protein	NA	NA	NA	NA
WP_038712325.1\|787208_787709_+	VOC family protein	NA	NA	NA	NA
WP_038712327.1\|787809_789276_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_009910087.1\|789656_790862_+	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_009906552.1\|790858_792961_+	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_009910086.1\|792957_794691_+	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_009910085.1\|794683_795496_+	flagellar biosynthesis protein FlhG	NA	NA	NA	NA
WP_009906542.1\|795520_796252_+	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_009906539.1\|796604_798026_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	9.9e-44	29.9
WP_009906537.1\|798188_798542_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_009906536.1\|798559_799390_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_038712329.1\|799471_800692_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	6.2e-236	98.5
WP_038712334.1\|800878_802369_-	6-aminohexanoate hydrolase	NA	NA	NA	NA
WP_025369718.1\|802457_803150_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_009906533.1\|803448_804549_+	nitronate monooxygenase	NA	NA	NA	NA
WP_009906532.1\|805003_806146_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025369719.1\|806304_807513_-	MFS transporter	NA	NA	NA	NA
WP_025369720.1\|807812_808502_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_004195767.1\|808886_809180_+	H-NS histone family protein	NA	NA	NA	NA
WP_009906524.1\|809419_810610_+	cation transporter	NA	NA	NA	NA
WP_004195771.1\|810775_811234_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_009906521.1\|811324_811981_-	exonuclease	A0A2L0UZL4	Agrobacterium_phage	1.5e-31	37.1
WP_009910074.1\|811977_812622_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_009906517.1\|813222_813858_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.9e-23	65.5
WP_009906515.1\|813952_814840_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_009910065.1\|814886_815321_+	YraN family protein	NA	NA	NA	NA
WP_009910064.1\|815443_816022_+	SIS domain-containing protein	NA	NA	NA	NA
815596:815611	attL	NA	NA	NA	NA
WP_009906511.1\|816040_816841_+	BON domain-containing protein	NA	NA	NA	NA
WP_025369721.1\|816837_817200_+	c-type cytochrome	NA	NA	NA	NA
WP_038712338.1\|817456_818548_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	6.2e-54	40.5
WP_025369723.1\|818689_819337_+	hypothetical protein	NA	NA	NA	NA
WP_025369724.1\|819333_820542_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	3.3e-32	27.9
WP_144241896.1\|820689_821073_-	hypothetical protein	NA	NA	NA	NA
WP_025369726.1\|821842_822160_+	hypothetical protein	NA	NA	NA	NA
WP_025369727.1\|822159_822729_+	hypothetical protein	NA	NA	NA	NA
WP_025369671.1\|824574_825843_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.8e-43	42.7
WP_009889500.1\|826362_827934_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	6.7e-150	53.8
827947:827962	attR	NA	NA	NA	NA

DBSCAN-SWA_4

988372 : 1013736

Pseudomonas_phage(40.0%)

integrase,transposase,protease,plate

attL 980912:980928|attR 1007145:1007161

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
980912:980928	attL	NA	NA	NA	NA
WP_009909975.1\|988372_988885_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.1e-21	52.5
WP_038712365.1\|989155_990373_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	8.7e-89	43.0
WP_038712368.1\|990993_993855_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	2.5e-70	35.4
WP_038712371.1\|993980_994307_-	hypothetical protein	NA	NA	NA	NA
WP_009908645.1\|994316_994664_-	hypothetical protein	NA	NA	NA	NA
WP_038712374.1\|994656_994869_-	hypothetical protein	NA	NA	NA	NA
WP_038712997.1\|994861_995164_-	hypothetical protein	NA	NA	NA	NA
WP_038713001.1\|995697_995976_-	hypothetical protein	NA	NA	NA	NA
WP_038712376.1\|995990_996200_-	AlpA family phage regulatory protein	E5E3Y1	Burkholderia_phage	1.7e-08	52.5
WP_155719076.1\|996425_996902_+	hypothetical protein	NA	NA	NA	NA
WP_080713178.1\|997488_999189_+	AAA family ATPase	NA	NA	NA	NA
WP_080713179.1\|999200_1000286_+	hypothetical protein	NA	NA	NA	NA
WP_038712385.1\|1000646_1001234_+	recombinase family protein	G8I4U3	Mycobacterium_phage	4.2e-25	42.8
WP_011883089.1\|1001320_1001806_-	hypothetical protein	NA	NA	NA	NA
WP_038712389.1\|1001817_1002951_-	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_158338514.1\|1003962_1004091_-\|transposase	transposase	NA	NA	NA	NA
WP_009888580.1\|1004724_1005510_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_009888581.1\|1005506_1006853_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_025404121.1\|1006961_1007576_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
1007145:1007161	attR	NA	NA	NA	NA
WP_043036367.1\|1007949_1008639_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009888592.1\|1008675_1009194_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009888594.1\|1009210_1010701_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009906860.1\|1010773_1011277_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_009888597.1\|1011334_1011817_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_009888599.1\|1011897_1013736_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_5

1315787 : 1325018

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009889255.1\|1315787_1317740_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.2e-148	49.5
WP_009889258.1\|1318003_1319134_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.8e-24	38.0
WP_038712436.1\|1319165_1321175_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	1.7e-52	35.2
WP_009904054.1\|1321350_1322166_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.3e-36	32.9
WP_009889263.1\|1322230_1322914_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	3.3e-05	26.0
WP_009889265.1\|1322910_1323438_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_009889266.1\|1323473_1325018_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.3e-24	31.2

DBSCAN-SWA_6

1572649 : 1581591

Staphylococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009889661.1\|1572649_1573786_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.7e-49	36.0
WP_155295660.1\|1574483_1575266_-	hypothetical protein	NA	NA	NA	NA
WP_107645277.1\|1575193_1575823_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.5e-31	69.6
WP_009888727.1\|1575819_1576227_-\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	3.1e-14	38.2
WP_038712274.1\|1576503_1577763_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.5e-43	44.4
WP_080713227.1\|1578793_1579021_-	helicase	NA	NA	NA	NA
WP_009889671.1\|1579159_1579387_+	transcriptional regulator	NA	NA	NA	NA
WP_009889673.1\|1579383_1579767_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	9.9e-07	43.6
WP_009889675.1\|1579810_1580440_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.4e-26	36.2
WP_011402095.1\|1580454_1581591_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.3e-42	32.9

DBSCAN-SWA_7

1706106 : 1714823

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009908912.1\|1706106_1707507_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.1e-79	38.7
WP_009889854.1\|1707475_1708462_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	6.7e-15	27.9
WP_009889856.1\|1708519_1709512_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_009889858.1\|1709583_1709901_+	competence protein ComE	NA	NA	NA	NA
WP_009904404.1\|1710235_1711138_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.3e-53	39.9
WP_009889862.1\|1711232_1712474_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_009889864.1\|1712652_1713576_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.2e-43	36.2
WP_009908916.1\|1713911_1714823_-	alpha/beta hydrolase	A7K906	Acanthocystis_turfacea_chlorella_virus	4.2e-11	24.6

DBSCAN-SWA_8

1984361 : 2079353

104

uncultured_Caudovirales_phage(23.91%)

protease,terminase,head,capsid,portal,tRNA,tail,plate,integrase

attL 2003823:2003842|attR 2087484:2087503

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009890173.1\|1984361_1985888_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	7.3e-85	36.2
WP_080554852.1\|1985960_1986989_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.0e-06	37.1
WP_009909025.1\|1987292_1988987_-	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	1.4e-28	27.5
WP_025369276.1\|1989002_1990088_-	hypothetical protein	NA	NA	NA	NA
WP_009890181.1\|1990441_1991695_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_011402197.1\|1991687_1992437_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.9e-34	38.4
WP_009890183.1\|1992441_1993230_+	TatD family hydrolase	NA	NA	NA	NA
WP_009909028.1\|1993283_1995821_+	ComEC/Rec2 family competence protein	NA	NA	NA	NA
WP_009890187.1\|1995857_1996685_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_009890189.1\|1996927_1998589_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.4e-150	52.0
WP_009890191.1\|1998585_1999440_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.0e-48	41.3
WP_009890193.1\|1999544_2000828_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	9.3e-150	62.1
WP_009890195.1\|2000919_2001351_+	cell division protein FtsB	NA	NA	NA	NA
WP_009904688.1\|2001512_2001857_-	hypothetical protein	NA	NA	NA	NA
WP_009904690.1\|2001945_2002896_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_009890200.1\|2002934_2003459_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_009890202.1\|2003637_2004456_+	ferritin-like domain-containing protein	NA	NA	NA	NA
2003823:2003842	attL	NA	NA	NA	NA
WP_009909029.1\|2004742_2005633_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_009904694.1\|2005843_2006674_+	PHP domain-containing protein	NA	NA	NA	NA
WP_009890207.1\|2006737_2007367_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_009890209.1\|2007465_2008131_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_009890211.1\|2008139_2009342_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_025369277.1\|2009338_2009956_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_025369278.1\|2010000_2010903_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_009890216.1\|2011013_2012156_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_009890218.1\|2012162_2012939_+	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	1.9e-09	26.6
WP_009890221.1\|2013605_2014793_-	cupin	NA	NA	NA	NA
WP_009890223.1\|2014861_2015407_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_009890224.1\|2015386_2016685_-	hypothetical protein	NA	NA	NA	NA
WP_009890225.1\|2016671_2019353_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.2e-28	24.0
WP_024430959.1\|2019512_2020814_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	2.6e-147	58.7
WP_009890227.1\|2020764_2021007_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	9.3e-19	59.2
WP_009909036.1\|2021015_2021489_-	hypothetical protein	B5TA88	Burkholderia_phage	2.3e-05	71.4
WP_004555250.1\|2021497_2021827_-	hypothetical protein	NA	NA	NA	NA
WP_009909037.1\|2021940_2023257_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_004538495.1\|2023256_2023706_-	hypothetical protein	NA	NA	NA	NA
WP_038712541.1\|2023702_2024308_-	hypothetical protein	NA	NA	NA	NA
WP_004534202.1\|2024304_2024640_-	hypothetical protein	NA	NA	NA	NA
WP_128972336.1\|2024691_2024880_-	NlpBDapX lipoprotein	NA	NA	NA	NA
WP_004555253.1\|2025014_2025503_-	hypothetical protein	NA	NA	NA	NA
WP_004555254.1\|2025456_2025957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024430958.1\|2026073_2026283_+	hypothetical protein	NA	NA	NA	NA
WP_009944042.1\|2026369_2026900_+	hypothetical protein	C7BGG0	Burkholderia_phage	4.4e-29	46.8
WP_004555255.1\|2026913_2027246_+	hypothetical protein	NA	NA	NA	NA
WP_143293908.1\|2027273_2027789_-	hypothetical protein	NA	NA	NA	NA
WP_004555256.1\|2027847_2028411_+	hypothetical protein	NA	NA	NA	NA
WP_009909046.1\|2028784_2029255_+	hypothetical protein	NA	NA	NA	NA
WP_025369284.1\|2029376_2031869_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	3.6e-97	41.8
WP_025369285.1\|2032086_2032674_+	hypothetical protein	NA	NA	NA	NA
WP_004538506.1\|2033054_2033903_+	DUF4747 family protein	NA	NA	NA	NA
WP_144241902.1\|2034071_2034503_+	hypothetical protein	NA	NA	NA	NA
WP_004547883.1\|2034654_2035224_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_025369286.1\|2035186_2037172_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	2.7e-180	53.4
WP_004533700.1\|2037182_2037389_+	hypothetical protein	NA	NA	NA	NA
WP_025369287.1\|2037385_2038879_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	7.5e-135	51.2
WP_004547849.1\|2038875_2039970_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	2.3e-48	36.2
WP_004533707.1\|2039996_2040341_+\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	3.0e-15	49.5
WP_004550216.1\|2040375_2041401_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.7e-109	59.1
WP_004539695.1\|2041404_2041695_+	hypothetical protein	NA	NA	NA	NA
WP_014917510.1\|2041696_2042227_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	9.2e-11	28.0
WP_004533675.1\|2042216_2042750_+	hypothetical protein	Q9JML9	Wolbachia_phage	6.2e-23	39.5
WP_004533661.1\|2042752_2043433_+\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	1.2e-18	34.4
WP_025369288.1\|2043497_2043704_+	hypothetical protein	NA	NA	NA	NA
WP_004533690.1\|2043700_2044045_+	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.4e-23	50.9
WP_009964528.1\|2044041_2044935_+\|plate	baseplate J protein	A0A1J0I2M3	Salmonella_phage	8.4e-49	40.1
WP_025369289.1\|2044927_2045503_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	6.0e-32	43.2
WP_038712562.1\|2045490_2046954_+	hypothetical protein	A4JWL8	Burkholderia_virus	8.0e-214	78.0
WP_025369292.1\|2046969_2047422_+\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	7.0e-44	76.8
WP_025369293.1\|2047487_2048657_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	3.7e-161	73.2
WP_009964536.1\|2048667_2049171_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.2e-41	50.0
WP_004552769.1\|2049240_2049543_+\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.5e-05	37.2
WP_025369294.1\|2049630_2052042_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.2e-62	35.5
WP_025369295.1\|2052050_2052932_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-30	37.4
WP_004540041.1\|2052906_2053113_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	4.0e-15	61.2
WP_025369296.1\|2053122_2054175_+	phage late control D protein	A0A2H4JBF6	uncultured_Caudovirales_phage	7.0e-79	44.8
WP_004533694.1\|2054250_2054445_+	hypothetical protein	NA	NA	NA	NA
WP_025369297.1\|2054437_2054980_+	lysozyme	A4JX20	Burkholderia_virus	9.8e-85	90.6
WP_038712566.1\|2054979_2055525_+	lysozyme	Q8W6S5	Burkholderia_virus	1.0e-81	95.0
WP_025369299.1\|2055668_2056457_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.8e-151	96.9
WP_004539736.1\|2056497_2057208_-	hypothetical protein	A4PE26	Ralstonia_virus	1.4e-38	41.5
WP_038732294.1\|2057219_2057735_-	hypothetical protein	NA	NA	NA	NA
WP_025369300.1\|2057706_2058180_-	hypothetical protein	NA	NA	NA	NA
WP_025369301.1\|2058172_2058679_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	1.5e-18	39.4
WP_025369302.1\|2058675_2059101_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	2.4e-14	46.0
WP_025369303.1\|2059162_2059444_-	hypothetical protein	NA	NA	NA	NA
WP_009890265.1\|2059443_2059908_-	hypothetical protein	C7BGE3	Burkholderia_phage	9.7e-49	60.4
WP_024430645.1\|2059989_2060559_+	DUF159 family protein	A4JX27	Burkholderia_virus	2.0e-88	82.3
WP_144399193.1\|2060856_2061327_+	hypothetical protein	NA	NA	NA	NA
WP_025369304.1\|2061679_2062141_+	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	8.4e-45	62.1
WP_143292436.1\|2063123_2063426_+	hypothetical protein	NA	NA	NA	NA
WP_024430642.1\|2063904_2065044_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038712576.1\|2065040_2065874_+	hypothetical protein	NA	NA	NA	NA
WP_009910405.1\|2067497_2067770_+	hypothetical protein	NA	NA	NA	NA
WP_009890278.1\|2068034_2068838_-	inositol monophosphatase	NA	NA	NA	NA
WP_025404099.1\|2069149_2070061_+	RNA methyltransferase	NA	NA	NA	NA
WP_009890280.1\|2070262_2071045_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_009890284.1\|2071387_2072188_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_009890286.1\|2072211_2072703_-	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	8.2e-06	29.8
WP_009890287.1\|2072783_2073359_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	2.4e-12	40.0
WP_025369305.1\|2073414_2074137_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009890291.1\|2074367_2075765_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.4e-42	33.8
WP_009890293.1\|2075812_2076751_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_009890295.1\|2076853_2077825_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_011402215.1\|2077868_2079353_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
2087484:2087503	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2887470 : 2960533

Stx2-converting_phage(23.08%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009891643.1\|2887470_2890338_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	6.7e-148	39.3
WP_009891646.1\|2890424_2891309_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-69	48.3
WP_009891648.1\|2891385_2891991_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_009891650.1\|2892080_2894474_-	CHASE2 domain-containing protein	NA	NA	NA	NA
WP_009891653.1\|2894484_2895849_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_004193573.1\|2895845_2896550_-	response regulator transcription factor	NA	NA	NA	NA
WP_009891660.1\|2896840_2897227_-	hypothetical protein	NA	NA	NA	NA
WP_004193727.1\|2897485_2897716_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_009891663.1\|2897875_2898913_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_025369419.1\|2898925_2899945_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_009891665.1\|2899937_2900819_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_009891666.1\|2901064_2902114_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009891668.1\|2902214_2903360_+	ABC transporter permease	NA	NA	NA	NA
WP_009891669.1\|2903372_2904173_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-14	29.4
WP_011402440.1\|2904186_2906187_+	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_043037268.1\|2906197_2908201_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_009891675.1\|2908197_2909118_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_025369421.1\|2909117_2909921_+	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_009891678.1\|2909985_2910690_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-09	31.8
WP_009891679.1\|2910686_2912912_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FFL6	Cedratvirus	1.6e-08	27.9
WP_009891680.1\|2912904_2913840_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_009909721.1\|2913844_2914294_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_009891683.1\|2914517_2915666_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_009891685.1\|2915855_2916191_+	YbjQ family protein	NA	NA	NA	NA
WP_009891687.1\|2916283_2916838_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_011402443.1\|2917300_2918809_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-10	25.2
WP_080713200.1\|2919360_2920887_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_009891696.1\|2920971_2921937_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009891699.1\|2922375_2925000_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-80	39.2
WP_009891700.1\|2925441_2926662_+	CoA transferase	NA	NA	NA	NA
WP_009909736.1\|2926751_2927558_+	hypothetical protein	NA	NA	NA	NA
WP_038709125.1\|2928088_2928298_-	ornithine acetyltransferase	NA	NA	NA	NA
WP_009891706.1\|2928578_2930288_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.8e-186	56.9
WP_009891707.1\|2930582_2931059_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	2.0e-20	41.3
WP_009891709.1\|2931077_2931464_-	hypothetical protein	NA	NA	NA	NA
WP_025369423.1\|2931750_2933850_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_009905872.1\|2933775_2933955_+	hypothetical protein	NA	NA	NA	NA
WP_009891712.1\|2933951_2934812_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_009891714.1\|2934857_2936249_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_025369424.1\|2936482_2938066_+	acid phosphatase	NA	NA	NA	NA
WP_009891718.1\|2938290_2939484_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_025369425.1\|2939501_2940344_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_154660009.1\|2940588_2940831_+	hypothetical protein	NA	NA	NA	NA
WP_009891722.1\|2941041_2941674_-	response regulator transcription factor	NA	NA	NA	NA
WP_025369426.1\|2941674_2943747_-	response regulator	A0A1V0SGR3	Hokovirus	5.0e-12	25.9
WP_009891727.1\|2944157_2945123_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_025369427.1\|2945138_2947550_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_009909750.1\|2947594_2948434_-	molecular chaperone	NA	NA	NA	NA
WP_009891731.1\|2948451_2948976_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009891732.1\|2949058_2949619_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_025369429.1\|2949671_2950217_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009891734.1\|2951019_2951913_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011402450.1\|2952328_2953618_+	MFS transporter	NA	NA	NA	NA
WP_009891736.1\|2953662_2954589_+	amidohydrolase family protein	NA	NA	NA	NA
WP_009891740.1\|2955074_2955356_+	H-NS histone family protein	NA	NA	NA	NA
WP_009891742.1\|2955555_2955819_-	hypothetical protein	NA	NA	NA	NA
WP_009891744.1\|2956568_2957882_-	divalent metal cation transporter	NA	NA	NA	NA
WP_038712718.1\|2958180_2959752_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.3e-149	53.6
WP_009889515.1\|2959781_2960129_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.1e-40	72.0
WP_009888727.1\|2960125_2960533_-\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	3.1e-14	38.2

DBSCAN-SWA_10

2990316 : 3092740

100

Burkholderia_virus(86.76%)

holin,capsid,head,terminase,portal,transposase,tail,plate,integrase

attL 3038106:3038156|attR 3092870:3092920

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009910382.1\|2990316_2992167_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009910381.1\|2993659_2993878_+	hypothetical protein	NA	NA	NA	NA
WP_025369440.1\|2994638_2996117_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_009891799.1\|2996420_2996756_-	H-NS histone family protein	NA	NA	NA	NA
WP_009891801.1\|2997072_2998359_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.3e-172	71.8
WP_025369441.1\|2998491_2999397_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.7e-129	75.1
WP_043036943.1\|3000457_3001849_+\|integrase	integrase family protein	NA	NA	NA	NA
WP_025369442.1\|3002472_3004530_-	AAA family ATPase	NA	NA	NA	NA
WP_025369443.1\|3004532_3004973_-	hypothetical protein	NA	NA	NA	NA
WP_144241904.1\|3004969_3005905_-	hypothetical protein	NA	NA	NA	NA
WP_080713203.1\|3006124_3006547_-	hypothetical protein	NA	NA	NA	NA
WP_038712728.1\|3007048_3007639_-	hypothetical protein	NA	NA	NA	NA
WP_025369446.1\|3007793_3009530_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_080713204.1\|3009554_3009779_-	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_038712731.1\|3009807_3010617_-	immunity 49 family protein	NA	NA	NA	NA
WP_025369447.1\|3010626_3020046_-	contact-dependent inhibition toxin BcpA	A0A0R6PJK4	Moraxella_phage	4.4e-31	30.9
WP_025369449.1\|3020973_3021201_+	hypothetical protein	NA	NA	NA	NA
WP_025369450.1\|3021300_3022269_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	6.3e-58	42.3
WP_038712736.1\|3022532_3024104_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	7.4e-149	53.6
WP_038712740.1\|3024133_3024481_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.3e-39	71.0
WP_009888727.1\|3024477_3024885_-\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	3.1e-14	38.2
WP_144241905.1\|3024934_3026053_-	hypothetical protein	NA	NA	NA	NA
WP_122813072.1\|3026053_3026326_-	hypothetical protein	NA	NA	NA	NA
WP_127462247.1\|3026513_3027494_-	hypothetical protein	NA	NA	NA	NA
WP_009905986.1\|3028195_3029026_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_009891863.1\|3029608_3030517_+	aldose 1-epimerase	NA	NA	NA	NA
WP_009891864.1\|3030736_3031438_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	3.8e-12	45.8
WP_009891866.1\|3031786_3033412_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	5.6e-67	34.6
WP_009891867.1\|3033677_3033995_+	DUF2288 domain-containing protein	NA	NA	NA	NA
WP_009910378.1\|3034002_3035394_+	MATE family efflux transporter	NA	NA	NA	NA
WP_038712744.1\|3035618_3035807_-	hypothetical protein	NA	NA	NA	NA
WP_009891874.1\|3036484_3037303_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009891880.1\|3037454_3037913_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
3038106:3038156	attL	NA	NA	NA	NA
WP_038713122.1\|3038351_3039023_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	1.2e-135	99.6
WP_011325405.1\|3039108_3039750_+	hypothetical protein	Q8W6R9	Burkholderia_virus	1.2e-118	100.0
WP_004526688.1\|3039882_3040974_-	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	1.5e-212	100.0
WP_004552924.1\|3041001_3041736_-	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	3.6e-138	100.0
WP_004552925.1\|3041732_3042293_-	PAAR domain-containing protein	Q8W6S2	Burkholderia_virus	7.5e-104	100.0
WP_004526687.1\|3042474_3043209_-	hypothetical protein	Q8W6S3	Burkholderia_virus	1.6e-130	100.0
WP_009896543.1\|3043461_3044250_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.5e-155	99.6
WP_038712746.1\|3044393_3044939_-	lysozyme	Q8W6S5	Burkholderia_virus	2.4e-78	91.7
WP_004552928.1\|3044938_3045430_-	lysozyme	Q6JIK8	Burkholderia_virus	7.8e-89	100.0
WP_004552929.1\|3045422_3045635_-\|holin	class II holin gp23	Q8W6S7	Burkholderia_virus	6.6e-29	100.0
WP_004552930.1\|3045677_3046412_-	hypothetical protein	Q8W6S8	Burkholderia_virus	1.2e-146	100.0
WP_004552931.1\|3046411_3046678_-	hypothetical protein	Q8W6S9	Burkholderia_virus	2.5e-49	100.0
WP_015967365.1\|3046722_3050028_-\|tail	phage tail protein	Q8W6T0	Burkholderia_virus	0.0e+00	100.0
WP_038712749.1\|3050024_3050609_-\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	6.2e-101	99.0
WP_038712752.1\|3050605_3051358_-	C40 family peptidase	Q8W6T2	Burkholderia_virus	6.0e-149	100.0
WP_015967362.1\|3051407_3052091_-\|tail	phage minor tail protein L	Q8W6T3	Burkholderia_virus	8.5e-134	100.0
WP_038712756.1\|3052087_3053476_-\|tail	tail fiber domain-containing protein	Q8W6T4	Burkholderia_virus	7.9e-272	99.8
WP_004548805.1\|3053484_3053823_-\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	8.0e-61	100.0
WP_038712760.1\|3053822_3057884_-\|tail	phage tail tape measure protein	Q8W6T6	Burkholderia_virus	0.0e+00	98.6
WP_009910356.1\|3057897_3058182_-	DUF4035 domain-containing protein	Q8W6T7	Burkholderia_virus	2.6e-44	100.0
WP_038712764.1\|3058181_3058646_-\|tail	tail assembly protein	Q6JIM0	Burkholderia_virus	4.3e-81	96.1
WP_015967358.1\|3058673_3059132_-	hypothetical protein	Q8W6T9	Burkholderia_virus	2.2e-77	100.0
WP_004526671.1\|3059193_3059541_-	DUF3168 domain-containing protein	Q6JIM2	Burkholderia_virus	4.5e-59	100.0
WP_038712769.1\|3059537_3059960_-	HK97 gp10 family phage protein	A4JX05	Burkholderia_virus	5.0e-68	98.6
WP_015967355.1\|3059952_3060279_-\|head	phage head closure protein	Q8W6U2	Burkholderia_virus	1.2e-56	100.0
WP_038712773.1\|3060278_3060845_-	hypothetical protein	Q8W6U3	Burkholderia_virus	5.4e-102	99.5
WP_038712775.1\|3060851_3061037_-	hypothetical protein	Q8W6U4	Burkholderia_virus	2.1e-23	93.4
WP_038712777.1\|3061096_3062404_-\|capsid	phage major capsid protein	Q8W6U5	Burkholderia_virus	1.1e-227	99.3
WP_009910345.1\|3062506_3063475_-	S49 family peptidase	A4JX00	Burkholderia_virus	8.0e-162	95.3
WP_051716428.1\|3063471_3064731_-\|portal	phage portal protein	Q8W6U7	Burkholderia_virus	4.7e-239	99.8
WP_009910343.1\|3064735_3064921_-	hypothetical protein	Q8W6U8	Burkholderia_virus	3.2e-19	93.4
WP_015967348.1\|3064917_3066630_-\|terminase	terminase large subunit	Q8W6U9	Burkholderia_virus	0.0e+00	100.0
WP_015967347.1\|3066639_3067125_-\|terminase	phage terminase small subunit P27 family	Q8W6V0	Burkholderia_virus	1.0e-88	100.0
WP_038712780.1\|3067273_3067630_-	HNH endonuclease	Q8W6N0	Burkholderia_virus	5.5e-60	92.4
WP_004549735.1\|3067690_3067948_+	type II toxin-antitoxin system RelE/ParE family toxin	Q8W6N1	Burkholderia_virus	2.4e-41	100.0
WP_004548635.1\|3067944_3068331_+	helix-turn-helix transcriptional regulator	Q8W6N2	Burkholderia_virus	1.4e-64	99.2
WP_144241906.1\|3068743_3069064_+	hypothetical protein	NA	NA	NA	NA
WP_144241907.1\|3069158_3069533_-	hypothetical protein	NA	NA	NA	NA
WP_038712789.1\|3069684_3071565_+	ATP-dependent endonuclease	E5E3R2	Burkholderia_phage	3.8e-269	76.8
WP_038712792.1\|3071567_3072770_+	DUF2130 domain-containing protein	NA	NA	NA	NA
WP_080713205.1\|3072838_3073129_+	hypothetical protein	NA	NA	NA	NA
WP_099005207.1\|3073427_3074184_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_038712796.1\|3074197_3074866_-	hypothetical protein	Q8W6N4	Burkholderia_virus	6.6e-107	95.7
WP_015967397.1\|3074874_3075135_-	hypothetical protein	Q8W6N5	Burkholderia_virus	4.7e-45	100.0
WP_011401114.1\|3075110_3075443_-	hypothetical protein	Q8W6N6	Burkholderia_virus	1.8e-60	100.0
WP_009896497.1\|3075882_3076239_-	hypothetical protein	Q8W6N8	Burkholderia_virus	2.1e-59	100.0
WP_038712804.1\|3076235_3076787_-	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	4.9e-92	94.5
WP_038712807.1\|3076783_3077776_-	hypothetical protein	Q6JIG0	Burkholderia_virus	9.0e-177	99.7
WP_038712809.1\|3077929_3078190_-	helix-turn-helix domain-containing protein	Q6JIG2	Burkholderia_virus	8.4e-26	69.8
WP_038712811.1\|3078186_3079008_-	hypothetical protein	Q8W6P2	Burkholderia_virus	1.1e-143	97.8
WP_038712813.1\|3079863_3080304_-	hypothetical protein	Q6JIG6	Burkholderia_virus	2.0e-67	87.7
WP_038712815.1\|3080518_3080737_+	hypothetical protein	Q6JIG7	Burkholderia_virus	8.6e-24	80.6
WP_038712819.1\|3080733_3081066_-	hypothetical protein	Q6JIG8	Burkholderia_virus	6.7e-52	90.9
WP_144241908.1\|3081327_3081783_+	hypothetical protein	NA	NA	NA	NA
WP_038713138.1\|3082687_3083077_+	type II toxin-antitoxin system death-on-curing family toxin	A0A222YZ88	Escherichia_phage	1.8e-16	39.8
WP_038712827.1\|3083110_3083311_-	hypothetical protein	NA	NA	NA	NA
WP_144241909.1\|3083459_3084092_+	hypothetical protein	NA	NA	NA	NA
WP_011401105.1\|3084580_3084856_+	hypothetical protein	Q8W6Q1	Burkholderia_virus	6.8e-42	93.4
WP_009896467.1\|3085594_3086407_+	prohibitin family protein	Q8W6Q7	Burkholderia_virus	2.7e-139	94.4
WP_009896465.1\|3086668_3087376_+	hypothetical protein	Q8W6Q8	Burkholderia_virus	2.9e-121	99.1
WP_015967379.1\|3087389_3088061_+	hypothetical protein	Q8W6Q9	Burkholderia_virus	1.4e-125	100.0
WP_038713142.1\|3088063_3088459_+	hypothetical protein	Q8W6R0	Burkholderia_virus	8.5e-70	99.2
WP_038712832.1\|3088458_3088737_+	hypothetical protein	Q6JII7	Burkholderia_virus	3.5e-38	85.9
WP_015967374.1\|3089800_3090793_+	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	5.4e-206	100.0
WP_015967373.1\|3090789_3091290_+	hypothetical protein	Q8W6R5	Burkholderia_virus	1.9e-90	100.0
WP_038712837.1\|3091415_3091640_+	DUF4224 domain-containing protein	Q8W6R6	Burkholderia_virus	1.0e-35	100.0
WP_015967371.1\|3091639_3092740_+\|integrase	tyrosine-type recombinase/integrase	Q8W6R7	Burkholderia_virus	1.9e-215	100.0
3092870:3092920	attR	NA	NA	NA	NA

DBSCAN-SWA_11

3613493 : 3624375

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009892610.1\|3613493_3615794_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	41.9
WP_009892611.1\|3615790_3616105_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	2.6e-13	44.6
WP_004196460.1\|3616635_3616839_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_009892613.1\|3616950_3618546_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_009892614.1\|3618707_3619967_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	6.8e-12	63.0
WP_009892615.1\|3620231_3620810_+	pseudouridine synthase	NA	NA	NA	NA
WP_080511442.1\|3621070_3621286_+	hypothetical protein	NA	NA	NA	NA
WP_011401863.1\|3621481_3621997_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	1.5e-13	41.2
WP_009892620.1\|3622260_3624375_+	elongation factor G	E4ZFJ7	Streptococcus_phage	1.2e-56	26.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP004384

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP004383

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection