CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP007162	Virgibacillus sp. SK37 plasmid pSK37042, complete sequence	0 crisprs	NA	0
NZ_CP007164	Virgibacillus sp. SK37 plasmid pSK37387, complete sequence	0 crisprs	NA	0
NZ_CP007163	Virgibacillus sp. SK37 plasmid pSK37064, complete sequence	0 crisprs	NA	0
NZ_CP007161	Virgibacillus sp. SK37, complete genome	2 crisprs	csa3,RT,DEDDh,cas14j,cas3,DinG,WYL	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007161_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007161_1

566091-566187

Orphan

Consensus_repeat	Method
GCAACCAAATTAATTCAACTAACTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007161_1

>merge|NZ_CP007161|1|566091-566187|CRISPRCasFinder
GCAACCAAATTAATTCAACTAACTACGTTGATTCACATCTATGCTAGTTGAATATAAGTAGTACTTTGGAGTGCAACCAAATTAATTCAACTAACTA

>NZ_CP007161|1|1|566091-566187|CRISPRCasFinder
GCAACCAAATTAATTCAACTAACTA	CGTTGATTCACATCTATGCTAGTTGAATATAAGTAGTACTTTGGAGT
GCAACCAAATTAATTCAACTAACTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007161.1\|WP_040954295.1\|573631_574141_+\|cyclic-pyranopterin-monophosphate-synthase-MoaC	unknown	unknown	gnl\|CDD\|236483
NZ_CP007161.1\|WP_040954293.1\|569133_570144_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP007161.1\|WP_040954289.1\|566516_567482_+\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|235583
NZ_CP007161.1\|WP_040954290.1\|567491_567947_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|376771
NZ_CP007161.1\|WP_040954282.1\|550469_550871_+\|anti-sigma-regulatory-factor	unknown	unknown	gnl\|CDD\|340411
NZ_CP007161.1\|WP_040954281.1\|550110_550467_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP007161.1\|WP_040956934.1\|558556_559015_+\|SprT-family-protein	unknown	unknown	gnl\|CDD\|235290
NZ_CP007161.1\|WP_040956935.1\|570361_571531_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP007161.1\|WP_040954284.1\|552104_552437_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP007161.1\|WP_040954286.1\|552884_553676_+\|RNA-polymerase-sigma-factor-SigB	unknown	unknown	gnl\|CDD\|236306
NZ_CP007161.1\|WP_084715601.1\|554514_556683_+\|RNA-binding-transcriptional-accessory-protein	unknown	unknown	gnl\|CDD\|225094
NZ_CP007161.1\|WP_040954283.1\|550986_552000_+\|PP2C-family-protein-serine/threonine-phosphatase	unknown	unknown	gnl\|CDD\|225118
NZ_CP007161.1\|WP_156958526.1\|574121_574775_+\|redox-sensing-transcriptional-repressor-Rex	unknown	unknown	gnl\|CDD\|235486
NZ_CP007161.1\|WP_040954294.1\|571546_573499_-\|ABC-F-type-ribosomal-protection-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP007161.1\|WP_040954285.1\|552436_552913_+\|anti-sigma-B-factor-RsbW	unknown	unknown	gnl\|CDD\|235217
NZ_CP007161.1\|WP_040954291.1\|567987_568695_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP007161.1\|WP_040954287.1\|553672_554263_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|214624
NZ_CP007161.1\|WP_040954288.1\|556735_558220_-\|catalase	unknown	unknown	gnl\|CDD\|163712
NZ_CP007161.1\|WP_040954297.1\|574823_575024_-\|YdiK-family-protein	unknown	unknown	gnl\|CDD\|316654
NZ_CP007161.1\|WP_040954292.1\|568687_569137_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701

Protein	Function_ID	Function_description	E-value
NZ_CP007161.1\|WP_040954295.1\|573631_574141_+\|cyclic-pyranopterin-monophosphate-synthase-MoaC	gnl\|CDD\|236483	PRK09364, moaC, cyclic pyranopterin monophosphate synthase MoaC.	1.8572e-98
NZ_CP007161.1\|WP_040954293.1\|569133_570144_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP007161.1\|WP_040954289.1\|566516_567482_+\|thiamine-phosphate-kinase	gnl\|CDD\|235583	PRK05731, PRK05731, thiamine monophosphate kinase; Provisional.	1.35837e-120
NZ_CP007161.1\|WP_040954290.1\|567491_567947_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|376771	pfam02367, TsaE, Threonylcarbamoyl adenosine biosynthesis protein TsaE. This family of proteins is involved in the synthesis of threonylcarbamoyl adenosine (t(6)A).	4.52359e-62
NZ_CP007161.1\|WP_040954282.1\|550469_550871_+\|anti-sigma-regulatory-factor	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	1.37815e-46
NZ_CP007161.1\|WP_040954281.1\|550110_550467_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	6.82009e-34
NZ_CP007161.1\|WP_040956934.1\|558556_559015_+\|SprT-family-protein	gnl\|CDD\|235290	PRK04351, PRK04351, SprT family protein.	4.28482e-74
NZ_CP007161.1\|WP_040956935.1\|570361_571531_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	9.83944e-94
NZ_CP007161.1\|WP_040954284.1\|552104_552437_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	2.64877e-32
NZ_CP007161.1\|WP_040954286.1\|552884_553676_+\|RNA-polymerase-sigma-factor-SigB	gnl\|CDD\|236306	PRK08583, PRK08583, RNA polymerase sigma factor SigB; Validated.	1.94784e-162
NZ_CP007161.1\|WP_084715601.1\|554514_556683_+\|RNA-binding-transcriptional-accessory-protein	gnl\|CDD\|225094	COG2183, Tex, Transcriptional accessory protein [Transcription].	0
NZ_CP007161.1\|WP_040954283.1\|550986_552000_+\|PP2C-family-protein-serine/threonine-phosphatase	gnl\|CDD\|225118	COG2208, RsbU, Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription].	7.82637e-73
NZ_CP007161.1\|WP_156958526.1\|574121_574775_+\|redox-sensing-transcriptional-repressor-Rex	gnl\|CDD\|235486	PRK05472, PRK05472, redox-sensing transcriptional repressor Rex; Provisional.	1.77819e-119
NZ_CP007161.1\|WP_040954294.1\|571546_573499_-\|ABC-F-type-ribosomal-protection-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP007161.1\|WP_040954285.1\|552436_552913_+\|anti-sigma-B-factor-RsbW	gnl\|CDD\|235217	PRK04069, PRK04069, serine-protein kinase RsbW; Provisional.	5.61669e-85
NZ_CP007161.1\|WP_040954291.1\|567987_568695_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	7.28869e-66
NZ_CP007161.1\|WP_040954287.1\|553672_554263_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|214624	smart00331, PP2C_SIG, Sigma factor PP2C-like phosphatases.	1.92904e-17
NZ_CP007161.1\|WP_040954288.1\|556735_558220_-\|catalase	gnl\|CDD\|163712	cd08156, catalase_clade_3, Clade 3 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes.	0
NZ_CP007161.1\|WP_040954297.1\|574823_575024_-\|YdiK-family-protein	gnl\|CDD\|316654	pfam14146, DUF4305, Domain of unknown function (DUF4305). This family includes the B. subtilis YdiK protein, which is functionally uncharacterized. This is not a homolog of E. coli YdiK, which belongs to pfam01594. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length.	6.60723e-07
NZ_CP007161.1\|WP_040954292.1\|568687_569137_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	1.70859e-42

>NZ_CP007161.1|WP_040956934.1|558556_559015_+|SprT-family-protein
MQLLNEKELFSLVNELSLTYFQKPFIDKVTFNHRLRTTGGRYIPNKRVVELNPKYFIEGDKGEFIGIIKHELCHYHLHIEGKGYKHGDKEFKDLLRATGSPRHCSPLPSHKIEHKHIYKCKKCGFIYNRRRRVNTQKYSCGKCRGRLKEVKE
>NZ_CP007161.1|WP_040954288.1|556735_558220_-|catalase
MSDKNNNNKLTTAAGAPVPDYQNSMTAGPRGPMLLQDVWFLEKLAHFDREVIPERRMHAKGSGAYGTFTVTNDITKYTNAKVFSEIGKKTDMFVRFSSVAGERGAADAERDIRGFAMRFYTEEGNWDLVGNNTPVFFFRDPLIFPDLNHAVKRDPRTNMRSANNNWDFWTNLPEALHQVTIVMSERGIPKSYRHMHGFGSHTFSMINDQNERVWVKFHMRSQQGIENLTDQEAQDLVGADRESHQRDLYENIENGNFPKWKMYIQVMTEEQANNMPYNPFDLTKVWYKKDFPLIEVGEWELNRNPDNYFAEVEQAAFTPANVVPGIGFSPDKMLQGRLFSYGDAQRYRLGVNHHQIPVNQPKCPFHSFHRDGAMRVDGNKGSQLHYAPNSYGEWKDQPEYKEPSLAINGDADRWDFREDDDNYFEQPGRLFNLMNPEQKQLLFENTARNMRGVDKHIKLRHINHCYKADPAYGEGVANALGISLSEVEAASEKE
>NZ_CP007161.1|WP_084715601.1|554514_556683_+|RNA-binding-transcriptional-accessory-protein
MDNELNMELLQWVSKETKVNTSIVHKVIDLLDEGNTVPFIARYRKEMTGGLDEVQIKSVQDKWAYAVNLSDRKQEVIRIIDEQGKLTEELEKEINEATQLQRVEDLYRPYKQKRRTKATIAKEKGLEPLAKQVWEQQQIDLTAEAKKYISEEHELQVVEDVLAGVNDIIAEWISDDPEYREYIREETFKRGSIISELKAAEKDEKSVYEMYYEFNEAIRSMVSHRILALNRGEKEEVLKVTVEPPAEKINDYLVKKLIKQDTSEQVVELLKEAINDSYKRLIQPSVEREIRNGLTEKAEQQAIEVFSKNLNNLLLQPPLKGKTILGVDPAFRTGCKLATVDETGKVLDVGVMYPTAPKHDTAGAEKIVMNFIRKHHVELIAIGNGTASRETEQFISDVIGKNKLDIPYIIVNEAGASVYSASKLAREEFPDLQVEERSAASIARRVQDPLAELVKIDPKSIGVGQYQHDVGQKALNESLTFVVETAVNQVGVNVNTASSSLLQYVSGLSKAVANNIVKQRNEEGKFTNRKQLKKIPRLGAKTYEQGIGFLRIIDGDHPLDRTPIHPESYKQTEQLLKLLDCELHDIGSEKLREKVNTVDKKELAKELEIGEPTLLDIIGALGRPERDPRDDFPQPLLKQNVLSLEDLKPGMEMQGTVRNVVDFGVFVDIGVKQDGLVHISKMSNSFVKHPMDIASVGDVVTVWVEQIDANKGRIALSMIKSE
>NZ_CP007161.1|WP_040954287.1|553672_554263_+|SpoIIE-family-protein-phosphatase
MSYNRVDVSVFQKAKKGNYYCGDSYFYTETENEFVCAIADGLGSGEFAKESSQIVIEIIKSNIHSSIEQLIKKCNQQLTGKRGVVVGILKLDFKTKTYSFSSIGNIGVMTIPKGKKKIRNIPNAGYLAGYHRPFKVIQEKLEPETNFIMFSDGVSDKDLSQKFLLNTDVEMITKVFDYTSGAVKEDDTTLIAIRYK
>NZ_CP007161.1|WP_040954286.1|552884_553676_+|RNA-polymerase-sigma-factor-SigB
MTTKSQPHNSGRDEVYQWIEYLQEEPTDEVVQEKIVLTYKDLVESIARKYSKNSAIHEDLVQVGMIGLLAAVRRYDASFGKSFESFAIPTIIGEIKRFIRDKTWSVHVPRRIKELGPKIKKAVDELTTANQVSPSIKEIADYLEVTEEDVLETMEMGKSYKALSVDRKIEADSDGSTVAILDLVGNDESGYNNVDQKMMLEKILPILSEREQQILQCTYFDNMSQKETGELLGISQMHVSRLQRRSLRKLREAIQAESTEVFD
>NZ_CP007161.1|WP_040954285.1|552436_552913_+|anti-sigma-B-factor-RsbW
MEKFDFVEMKVPAKAEYVGVIRLSISGIANRMGFSYEDIEDLKVAISEAITNTVTHAYNEKDEGEVTIGFGIYEDRLEIMVADHGGSFDLNKIKNDIGPYKNTESVENLREGGFGLFLINALMDKVEITNNYGVIVLMTKYLNEAEVGFDDDQISTTQ
>NZ_CP007161.1|WP_040954284.1|552104_552437_+|STAS-domain-containing-protein
MNLTVDITNEAEKSIVSLSGEIDAYTAPQLKDAVLPLTKTPEHTMEIDLENVNYMDSTGLGVFISALKSTKEHGSKMKLVNIQDRVLRLFKITGLDEIMDINSTIRGGSE
>NZ_CP007161.1|WP_040954283.1|550986_552000_+|PP2C-family-protein-serine/threonine-phosphatase
MDDVIKLDAANYKDLLKHYIDTQDEQSLYGVEQVSKSFIKNHILPEEIVNLHIQALAELYPEMSEKFQHSMNFLLEAMISYGLAHQEFQMLREKQFEIKSEISVAASMQNTLLGTTKPEIEGLDIGVISVPAHQMNGDYHHFVKGKNGSLGIAIADVIGKGIPAALCMSMIKYSMDSYPEDSMEPKSILKNLNRVVERNVDASMFITMLYAQYLPCEHKLHYASAGHEPGFYYDSEKGTFTEIETKGLVLGVSSDAEYEQYELKVNKGDMVILLTDGVTECRDGDRFIESEEILEVIKSYEDLPAQEMVNKVYKHFERLQDFELRDDFTLLILRREV
>NZ_CP007161.1|WP_040954282.1|550469_550871_+|anti-sigma-regulatory-factor
MIPQSCVTIQKEWDIVGARQLGRDIAKKMGFGTVDQARIATAISELARNIYLYTENGQICFEVVENMNQKGLVMLATDNGPGIEDISQVMEDGYSTSGGLGAGLPGVKRLMDEFDVQSEVGTGTRIKAIKWTR
>NZ_CP007161.1|WP_040954281.1|550110_550467_+|STAS-domain-containing-protein
MRIPILKLHNYLLISIQTEIDDNTAIQFQEDLLNKIHQSGSSGVVIDLTSVDIIDSFIAKVLGDVVTMSDLMGAKVVLTGIQPAVAMTLIDLGIHLKNVPTALDLEQGLIKLYQELGE
>NZ_CP007161.1|WP_040954289.1|566516_567482_+|thiamine-phosphate-kinase
MDEFSFIDSIKQRSYKQSSLLKGIGDDAAVFRQTSEDIVTAVDTFVEGIHFSRDTMQAFHIGYRALAANISDLAAMGATPAFYLTSLVKPESWHVQEVEGIFIGMKELANSYGMDLIGGDTVSGKQLTISITVIGYVPGGKARYRSVAQKDDIVFVTGTLGDSRAGLHLLTENNSYEHTEFFIQRHRTPTPRVEFAKSLSKLSRIALNDISDGIANEAAEIAEASNVGILLYDESIPISPFYTQFSLKQQQEWKYFGGEDFELMGTVSAQEWPFVVQAAENTHTKISEIGIVTERSENSNVFMMKNNKKQRLNKCGYTHFK
>NZ_CP007161.1|WP_040954290.1|567491_567947_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSTHIIKASTEEETKHIAEKLAVLLKPGDVITLEGDLGAGKTTFTKGLAEGLGVKRSVSSPTFTIIKEYEGELPLYHMDVYRLEYSDEDIGFDEYFNGNGISVVEWASFIEDYLPFERLEINISYIDEQSRELKFHAVGAHFEWVLNELRR
>NZ_CP007161.1|WP_040954291.1|567987_568695_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MSILAIDTSNQALGVAIINEEKIIGEITTNIAKNHSLRLMPAIEQLMKEVNVELQNLEKIIVAKGPGSYTGVRIGLATAKTMAWALGIPVVGVSSLKVLAYQGRFFQGYICPFFDARRGLVYSGLYEWKNGEIKQVWDEVNISITDLLSNLAKENKEILFLSPDIELHRENITSSIESRAVIPEMAYHISRASHVALAGLHENPQTTHALTPNYLRLAEAEAKWLKQQKEKEENG
>NZ_CP007161.1|WP_040954292.1|568687_569137_+|ribosomal-protein-S18-alanine-N-acetyltransferase
MAEIVIRKMHITDVDAVMEVESATFSTPWTTDIFYQELVDNDYAHYFVMEADKKIIGYAGVWLVVDDAQITNIAIMPDYRGNKLGEKLFGFTIQQILLLGGTRLSLEVRKSNIIAQRLYRKFGLVPGGIRKNYYTDNQEDAIVMWVNLL
>NZ_CP007161.1|WP_040954293.1|569133_570144_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MKKDTFILGIETSCDETAVAIVKNGKEIVSNVVASQIESHKRFGGVVPEIASRHHVEQITVVLEEAITQAELTWDSIDAIAVTEGPGLVGALLVGVNAAKALAFAKQKPLIGVHHIAGHIYANRLQKEFEFPLLALIVSGGHTELVLMKEHGKYELLGETRDDAAGEAYDKVARMLELPYPGGPQIDRLAKVGKVTIDFPRAWLEQGSYDFSFSGLKSSVINTIHNAKQRGETLSNEDIAASFQESVIDVLTTKTVNAAKEYHVKQVIVAGGVAANQGLRSALEEQFHQLSIPLLIPPLHLCTDNAAMIAAAGTIAYEQGRRSGLDLNANASLLMK
>NZ_CP007161.1|WP_040956935.1|570361_571531_+|rod-shape-determining-protein-RodA
MSKKQSYYIQNDLIFIFFLFVCVSLLSIYNAQQLEQYAGENFVLKQIVWFTIGVGIIAAIQFLDLDQLYKASIYIYGFGLLILAILLVSPDSIAREINGAKSWFTFPGLSLQPAEFTKMATILYLAATIDKHKTKYGMQTLKTDTLLLVKLLIIIALPVLLIMRQPDFGTAMVYLFIAGMIIILSGIDWKIIMTLILAGALSVTAALGFIIKFPNLAQQVGVEAYQIDRIMTWFDPSQQSSDATFHFDRAYMALGSGQLFGKGMDNLQVSFPEAHTDFIFAVIGESFGFIGSALVIFLYFLLLYKLVTLGLSVYKHSPFGSYLCFGFLSILLIHIFQNIGMSLGIMPITGIPLLLISYGGSSVLSTMIGLGVIYRVAVEHTIHNDYLFK
>NZ_CP007161.1|WP_040954294.1|571546_573499_-|ABC-F-type-ribosomal-protection-protein
MILMQLNGISKSFGAEEILSNIKMEVKDNERIAIVGRNGAGKSTLLKIMAGEFSHDGGELLKPKDLTMGYLSQHMTLESGKTIWDEMLEVFAHLLGLEKQIRSMEQQMEQAAKLSHGEYERVLQQYDELQQAFQRDGGYTYEADIKAVLNGLHFHDKDYETPISDLSGGQKTRLALGKLLLKKPKLLILDEPTNHLDIDTLSWLEGYLVSYPGAIVIVSHDRYFLDKTVSIVYEISRHKTKKYHGSYSKFLEQKAIDYEKELKEFEKQQTEIKKMEDFIQRNIVRASTTKRAQSRRKQLEKMEKIDRPLGDEASASFSFQIATRSGNDVLKADGLSFRYPDENQNLFTNVKLHVNRGERVALVGPNGIGKTTLLKIILGKHKQTNGTIQLGTNVQIGYYDQEQADLSSSKTVLMELWDEYPTVNEKDIRTVLGNFLFSGDDVLKVVSSLSGGEKARLALAKLMMQEANLLIFDEPTNHLDIDSKEVLEAALNDFPGTIIFVSHDRYFINKITDQVAEMQRDGITSYLGDYDYYLEKKEEQAELKRLQQTEETVNTTDQRKRTFKEDKQLQSEKRKMQRRINELEELIENQELEIEKLEEKMTQPEVYQDHEKALELTQQTSELKQQVDNWMEEWTALQEEVYMKKSPRLL
>NZ_CP007161.1|WP_040954295.1|573631_574141_+|cyclic-pyranopterin-monophosphate-synthase-MoaC
MSEFTHFNEQGRARMVDISEKKETERIAVARSSVQMSEEVYKKITQNEIKKGDVLAVAQVAGIMAAKKTSDWIPMCHPLQLKGVDISFEWLIGETSYDLQIEVFVKTKGSTGVEMEALTAASASALTIYDMCKAVDKGMIIGQTYLLEKKGGKSGDYSLDERRNNNGSK
>NZ_CP007161.1|WP_156958526.1|574121_574775_+|redox-sensing-transcriptional-repressor-Rex
MTMDQNKIPQATAKRLPLYYRFLNNLNQQGKKRVSSKELSEAVKVDSATIRRDFSYFGALGKKGYGYNVEYLLGFFRKTLDQDETTEVALIGVGNLGTAFLHYNFMKNNNIQIQMAFDADPEKVGTDIGGVPIYHIDDLEKSLNGIKVAILTIPANETDRVTDRLVEQGIDGILNFTPARITVPNHIRVHHIDLAVELQALVYFLKHYPLQVDQTDN
>NZ_CP007161.1|WP_040954297.1|574823_575024_-|YdiK-family-protein
MKISPRTMAIIYFAMGIFFTYIAIISAGDTIWNVTTMVLALFATLEIGVGIRLFRLHYQMKNKKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007161_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007161_2

3280633-3280798

Orphan

Consensus_repeat	Method
CTCATATAAATGCTGTCTCTCTCA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP007161_2

>merge|NZ_CP007161|2|3280633-3280798|CRISPRCasFinder
CTCATTTGGATGCTGCGTCTCTCATATAAATGCTGTCTCTCTCAATTGGGCGCTGCGTCTCTCATATAAATGCTTCCTCTCTCATTTAGGCACCTGCGCCCCTCATATAAATGCTTTCTCTCTCATTCAGACCGCCATGTCTCTCATATGACCGCTTTCTCTCTCA

>NZ_CP007161|2|2|3280633-3280798|CRISPRCasFinder
CTCATTTGGATGCTGCGTCTCTCA	TATAAATGCTGTCTCTCTCAATTGGGCGCTGCGTCT
CTCATATAAATGCTTCCTCTCTCA	TTTAGGCACCTGCGCCC
CTCATATAAATGCTTTCTCTCTCA	TTCAGACCGCCATGTCT
CTCATATGACCGCTTTCTCTCTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007161.1\|WP_040956506.1\|3289321_3290332_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|378117
NZ_CP007161.1\|WP_040956497.1\|3271780_3272179_+\|glycerol-3-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|173922
NZ_CP007161.1\|WP_040956498.1\|3272171_3273353_+\|teichoic-acid-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|367953
NZ_CP007161.1\|WP_040956495.1\|3268270_3269296_-\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176199
NZ_CP007161.1\|WP_040956496.1\|3269292_3270006_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|234670
NZ_CP007161.1\|WP_052350182.1\|3270171_3271704_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP007161.1\|WP_040956511.1\|3294645_3295050_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007161.1\|WP_040956509.1\|3291395_3292121_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP007161.1\|WP_040956500.1\|3274589_3274988_+\|glycerol-3-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|173922
NZ_CP007161.1\|WP_052350183.1\|3292569_3294042_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368677
NZ_CP007161.1\|WP_040956499.1\|3273436_3274519_+\|acyltransferase	unknown	unknown	gnl\|CDD\|376607
NZ_CP007161.1\|WP_040956505.1\|3287189_3288266_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP007161.1\|WP_040956508.1\|3290631_3291396_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NZ_CP007161.1\|WP_084715730.1\|3276157_3278068_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP007161.1\|WP_040956503.1\|3278783_3280244_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP007161.1\|WP_040956504.1\|3285719_3287132_-\|NADP-dependent-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236453
NZ_CP007161.1\|WP_040956512.1\|3295101_3295416_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP007161.1\|WP_084715731.1\|3280849_3284632_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173801
NZ_CP007161.1\|WP_040956507.1\|3290344_3290635_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376658
NZ_CP007161.1\|WP_040956501.1\|3274980_3276123_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367953

Protein	Function_ID	Function_description	E-value
NZ_CP007161.1\|WP_040956506.1\|3289321_3290332_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|378117	pfam09084, NMT1, NMT1/THI5 like. This family contains the NMT1 and THI5 proteins. These proteins are proposed to be required for the biosynthesis of the pyrimidine moiety of thiamine. They are regulated by thiamine. The protein adopts a fold related to the periplasmic binding protein (PBP) family. Both pyridoxal-5'-phosphate (PLP) and an iron atom are bound to the protein suggesting numerous residues of the active site necessary for HMP-P biosynthesis. The yeast protein is a dimer and, although exceptionally using PLP as a substrate, has notable similarities with enzymes dependent on this molecule as a cofactor.	7.35297e-79
NZ_CP007161.1\|WP_040956497.1\|3271780_3272179_+\|glycerol-3-phosphate-cytidylyltransferase	gnl\|CDD\|173922	cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase,(CDP-glycerol pyrophosphorylase). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most, but not all, species encoding proteins in this family are Gram-positive bacteria. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase.	9.91157e-76
NZ_CP007161.1\|WP_040956498.1\|3272171_3273353_+\|teichoic-acid-biosynthesis-protein-B	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	1.71602e-71
NZ_CP007161.1\|WP_040956495.1\|3268270_3269296_-\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176199	cd08237, ribitol-5-phosphate_DH, ribitol-5-phosphate dehydrogenase. NAD-linked ribitol-5-phosphate dehydrogenase, a member of the MDR/zinc-dependent alcohol dehydrogenase-like family, oxidizes the phosphate ester of ribitol-5-phosphate to xylulose-5-phosphate of the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability.	0
NZ_CP007161.1\|WP_040956496.1\|3269292_3270006_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	1.83428e-88
NZ_CP007161.1\|WP_052350182.1\|3270171_3271704_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	4.08879e-72
NZ_CP007161.1\|WP_040956509.1\|3291395_3292121_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.23384e-104
NZ_CP007161.1\|WP_040956500.1\|3274589_3274988_+\|glycerol-3-phosphate-cytidylyltransferase	gnl\|CDD\|173922	cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase,(CDP-glycerol pyrophosphorylase). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most, but not all, species encoding proteins in this family are Gram-positive bacteria. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase.	5.55636e-72
NZ_CP007161.1\|WP_052350183.1\|3292569_3294042_+\|hypothetical-protein	gnl\|CDD\|368677	pfam05935, Arylsulfotrans, Arylsulfotransferase (ASST). This family consists of several bacterial Arylsulfotransferase proteins. Arylsulfotransferase (ASST) transfers a sulfate group from phenolic sulfate esters to a phenolic acceptor substrate.	2.98411e-78
NZ_CP007161.1\|WP_040956499.1\|3273436_3274519_+\|acyltransferase	gnl\|CDD\|376607	pfam01757, Acyl_transf_3, Acyltransferase family. This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.	1.22858e-19
NZ_CP007161.1\|WP_040956505.1\|3287189_3288266_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	3.27926e-85
NZ_CP007161.1\|WP_040956508.1\|3290631_3291396_+\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	1.71436e-62
NZ_CP007161.1\|WP_084715730.1\|3276157_3278068_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	1.2671e-91
NZ_CP007161.1\|WP_040956503.1\|3278783_3280244_-\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	5.32257e-41
NZ_CP007161.1\|WP_040956504.1\|3285719_3287132_-\|NADP-dependent-phosphogluconate-dehydrogenase	gnl\|CDD\|236453	PRK09287, PRK09287, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_CP007161.1\|WP_040956512.1\|3295101_3295416_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	1.2362e-25
NZ_CP007161.1\|WP_084715731.1\|3280849_3284632_-\|S8-family-serine-peptidase	gnl\|CDD\|173801	cd07475, Peptidases_S8_C5a_Peptidase, Peptidase S8 family domain in Streptococcal C5a peptidases. Streptococcal C5a peptidase (SCP), is a highly specific protease and adhesin/invasin. The subtilisin-like protease domain is located at the N-terminus and contains a protease-associated domain inserted into a loop. There are three fibronectin type III (Fn) domains at the C-terminus. SCP binds to integrins with the help of Arg-Gly-Asp motifs which are thought to stabilize conformational changes required for substrate binding. Peptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	1.34869e-88
NZ_CP007161.1\|WP_040956507.1\|3290344_3290635_+\|hypothetical-protein	gnl\|CDD\|376658	pfam01910, Thiamine_BP, Thiamine-binding protein. The crystal structure of two of these members shows that this domain has a ferredoxin like fold and is likely to exists as at least homodimers. Sulphate ions are are located at the dimer interfaces, which are thought to confer additional stability. Although the function of this domain remains to be identified, its structure suggests a role in protein-protein interactions possibly regulated by the binding of small-molecule ligands. Solution of the structure of the hyperthermophilic anaerobic Thermotoga maritima sequence, UniProtKB:Q9WYV6, shows that this has a beta-alpha-beta-beta-alpha-beta ferredoxin-like fold and assembles as a homotetramer. It was possible to identify a pocket in each monmer that bound an unidentified ligand. It was also found that it bound charged thiamine though not hydroxymethyl pyrimidine. It is proposed that it is transporting charged thiamine around the cytoplasm. Under oxidative conditions this bacterium is under stress, and the transcriiptional unit within which this protein is expressed is up-regulated in these conditions, suggesting that the chelation of cytoplasmic thaimine is part of the response mechanism to such oxidatvie stress, which is mediated by this family.	1.7887e-17
NZ_CP007161.1\|WP_040956501.1\|3274980_3276123_+\|hypothetical-protein	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	5.13444e-66

>NZ_CP007161.1|WP_040956503.1|3278783_3280244_-|APC-family-permease
MEERTTLKKSLKPHWVWAIALGSSIGWGAFVQPTNWMADAGPLGVIIGFGIGALLMMLIAVSYGFLIKSFPVSGGEFAYAFISLGRKHAFISGWFLTLGYICIVALNASAFALMFKFVFPAVIEQIPLYQIAGWDVYGMEVIIASAALGIFGYFNIRGTGLSGQMQFVFCTIMIISIVVITFMVGGHPGAGLENVQPYFPKDTTAFAAIISIVAIAPWAFVGFDNVPQAAEEFHFSSKKAFTLIILAISIAAVLYSMMIIATAMTQPWQQTVGEGQVWGTAATIQETIGTIGLVLLVTALTMGVFTGLNGFIISSSRLLFAMSRAKILPEAFSKLHPKYKTPHVGIIFTVVVSMFAPWFGREALLWVVDMSSVGVTIAYLYTCYTAFSLFKMKKGEDFNPSKHVVSPMKKSIAAAGMVASVAFLALLLIPGSPAFLGIQSRIALIAWIGLGVIFYMAKRKEFNKIPKEELNYLILGSKKIIAKNRS
>NZ_CP007161.1|WP_084715730.1|3276157_3278068_-|LTA-synthase-family-protein
MVTKIINGGEHMHEKTSFTHSYFFFFLVAFSLKFYVFRLLQFEDFNPLNTIWYELCFIVILFAIVELFIKKWKLTVYIVLDVLFTGVLFAMAVYGRYFHNIPTYHALAQVNQVGSVSGSIWLLLSFKDLYLLVDFILLFIFYKIQNKRYFPRNRTFTKKNLIALGVVGLIISILNFSLHRDEVIRDQALFSKKYGITNAQFIKANEDVLGTSNTKITTVTQEDIIKLKGNKPIPFEEHTYFGTVPDKNLLIIQIESLQDFVVNLKVNGQEITPNLNKLTKESMYFKNVFQQIGSGNTADSEFIMNSSIYPVGEVPTSQKIEGKKVEHSLPRLLKKNGYFTSTFHADKVTYWNRDALYPALGFDAYFDTEYIGEKDIIGFGPSDKHFYNRTMKKLKEFQNTGKEPFYAHVLSLTSHSPFKMPKEKQMLDLPERFTDTLTGNYLQSVHYADQALGEFIRSLKKSGIWDDSIIALYGDHSGVHGGLMEEEDNKLLKEILGEKYTMEDRFNIPFLIHVPGNKDKFIKEVDTVGGQLDMMPTILNIMGIKPKSLYFGQDLLQYKNNLIGMRYYLPTGAFINNEHFFIPETSKEPVRVYDLKGKRLDLENPKKKFKEDYQNMLQLYDWSDAYFEELPTKKKK
>NZ_CP007161.1|WP_040956501.1|3274980_3276123_+|hypothetical-protein
MARELIISIYLFAFRNVFCFFKLWPQQRKTTFIVSFGQNVLFTVNELEKRTDEQIVILKTANCSMPFREKKSRKVLCFKAYAILDWFRSVYHLATSRYVFADNYFGVLSVSSFKKNVRCVQLWHAAGAIKKFGLKDRAIQARSLKAYRRFQKVYKRFDHVVVGSEKMADIFKESFGITEKEIVRTGIPRTDLFFYHAIVDYCRKGFIRDIPAIINKKVVFYAPTYRDDMSALLHLDVDQLYKQFSNDYILFIKLHPSLREGFINKYPDFMFDVAKYNTNELLLVTDVLITDYSSIPFEFSLLERPMIFYAFDLEEYEQQRGFWEDYETLVPGPIAKNTNEIIQLIRKNSFNLNEVRRFAEEWNTYSQGHSSKNIIDFLYF
>NZ_CP007161.1|WP_040956500.1|3274589_3274988_+|glycerol-3-phosphate-cytidylyltransferase
MKKVITYGTFDIIHTGHINLLRRAKEYGDHLIVALSSDNFNAMKGKKSYYTYEQRSAILEAVRYVDQVIPENSWEQKIEDVQKYAIDIFVMGDDWKGKFDFLAPYCEVVYLPRTIGISTTKIKTDLNQSNDG
>NZ_CP007161.1|WP_040956499.1|3273436_3274519_+|acyltransferase
MNREKKYYYELSFIRAIACLCVIMVHVTAGYYYENGKNFDWLTQFFNQISRYGTPAFAIISGFLLYNQAINRSFNLKFFWKSRLTKVVIPFFIWSILYLFLKWSYGQFSPSSISTIQERNDFIYFFFTGESYYHLYFIAIVVQFYLVFPLLQLFKSQKNLLIFTLISFFINYFFVENTISIGEGILNKFINERVFIFHWVYYFFLGGLLVYWWPQLMRWVKDNALYSTLLGLVVVIGGIFEYQFNEWIESNRPMNMINLPILFIALSGIYTLLSNKSKIKSSLINIGNLSMGIYLVHPLILFFMRKYSFFDHFYENTLYLPLLFGFTLLTSILLIKFILKLPFGSYIVTVASTTNKSKQK
>NZ_CP007161.1|WP_040956498.1|3272171_3273353_+|teichoic-acid-biosynthesis-protein-B
MARELGITLYLFVFRVFFNLFKRLPQKKKTVCVASFGDNIFYAVRELQKRSNEEIIILKDKSCRFDFDALHVKSISFAIKHPFAFLLSIYHLATSTTIMIDTYYGFLDVTRFRKNARCIQLWHAAGALKQFGLQDPSIAERSQRAKNRFQNVYSRFDYTVVGSDEMAATFKRCFGLTEDRIVRTGVPRTDIFFDDHEKQRILYDLKQDLQAIGDRKIILYAPTFRKGELDHFQLALDIHMMYQSLANEYVLFIKPHPAVSYSIEDSYKDFVFDVSKYSDTNHLLLITDILITDYSSIPFEYALLEKPMIFFAYDLEKYKLSNGLIDDYENQMPGPVVSTTEEIVDAIHHNKFDYNKIHEFSEQWNTYSNGESSKQLAAFLTDTEKKPKEKVLV
>NZ_CP007161.1|WP_040956497.1|3271780_3272179_+|glycerol-3-phosphate-cytidylyltransferase
MKVIITYGTFDLIHTGHINLLRRAKKLGDHLIVGLSTDQFNSLKGKKAYYSFEQRKSVLEAIRYVDEVIPENTWEQKIQDVQKHNVDVFVMGDDWEGKFDFLQDHCEIVYLPRTVGISTTKIKTDLNQANNG
>NZ_CP007161.1|WP_052350182.1|3270171_3271704_+|glycosyltransferase
MKQKLFMLVWDMDINKGGINRVMMNRSALLNDKYDCTLLTLDFKKNYNDIKEKLKKSGRLHPKVNILNVHDYYRDYFSQSKPSKDQMNYYHTQKELYEEGFQVQDDEYSNNNCARYFKNGVYIKYKKWDKKQNLLHVDFFNPQRQRLSREAFSEEGLMYKKTFFEPQSNNPIQDLFYTIDGKCFLTKWYNPTTKKISNVFLINPLDNTIKKFASNQSFNSYWLETLCSDQPKKPIIICDGPGSTSVMLNVDSKLCYKVSAIHSNHFSDPHTYGSPIKKNHIDILNNIKKEDALIVLTETQKKDIIKQFDHSNNIHVIPHSIEPFKNKNLAKDEKLVTMIARYHPEKRIDLAILAFKNVIKKVPDAKLEIYGDGPAKESLKQLIKENHLENNVFLKGYVNNVTEVFSSSLVSLLTSKYEGFSLVIIESMMSETPVISFDIPYGPSDIIIDGENSILVENSNVEKFSEQITFLLKNPQTAIKMGEAAKKYATKNYSTKDHTKKWLKVLENLK
>NZ_CP007161.1|WP_040956496.1|3269292_3270006_-|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase
MIYAGILAGGKGTRMGNVPMPKQFLTLNNKPIIVHTVEKFILNNNFEKIIIATPKEWINHTNDILKKYNIDLPKVEVIPGGNDRNGTIMSVIDFIESKYNLSDNDILVTHDAVRPFLTHRIIQENIEEGLKHSAVDTVISAVDTIVESRDGSTISSIPRRDFMYQGQTPQTFNVNKLKELYNQLTEEEKEILTDACKIFSIKGEDVKLVEGEIFNIKVTTPYDLNVANAIIQGSLDK
>NZ_CP007161.1|WP_040956495.1|3268270_3269296_-|alcohol-dehydrogenase-catalytic-domain-containing-protein
MINQVYRLVSPRQFEITYKDKSIISNQVVVRPTHLSICAADQRYYTGTRGKEAMKKKLPMALIHEGVGEVVFDPTGELKIGTKVVMVPNTPTEEDPYIAENYLRTSKFRSSGYDGFMQDYVFLNHDRIVKLPEDINMDVAAFTELVTIAVHSISRFEKKAHFRKDTFGVWGDGNLGYITCLFLKKLYPDSKVIIFGKTDYKLNHFSFVDDTVKIDDIPKNLKIDHAIECAGGKGSQYAIDQIIDLINPEGTICLLGVSEYPVEINTRMVLEKGLTLIGSSRSGTVDFQRVIDIYTEYPEIVEYLSTIIGEVHDVKKINDATKAFESDLSNSWGKTVMRWLI
>NZ_CP007161.1|WP_084715731.1|3280849_3284632_-|S8-family-serine-peptidase
MLKRLTIALLAVLLVFSNFTYASALTGEKLPNQAKKAEKQTTENIGETVDPNKEVRVIVEADETPSIEVATQKGITFKKMKESEKKQLDKKAKANQKVIKDKMKGKKVKAEYHEEFTTVVNGFSAEVKQGDIDEIKDIPEVKNVHIVNEYKRPIEKPDMKYSKELVEAQQAWRDYGFKGEGMVVGIIDTGIDPSHRDMVLSENKSAELTQKEVNETVAEEDLPGEFYTEKVPYGYNYMDENDEIREIHAGANYHGMHVAGTVGANGDEENGGILGIAPEAQLLALKVFGNDPEFQSTYGDIYVKAIDDAIKLGADVLNMSLGSTAGFVDEDSPESKAVSRAVENGVLMSISAGNSALLADGFYYPLSSMPDYGVVGSPGVSHDSLQVASFENTFMTVSGLEYTVDGEAGAAPFLSAGNTEPPKDGSTFELAYAGLGKPADFEGKDFSGKYALVQRGELAFTDKALNAQAGGAEGVIIYNNTDGVVSMATDPSIKIPQLFMLKSDGDKLAAALKNEQQVAITFNGDSSTIQNPDAGKMSDFTSWGLTPSLDFKPEITAPGGQILSTLNDNKYGLMSGTSMAAPHVSGGAALVLERVDEEFGYEEADRVEFAKTLMMNTSKKVTFENAFVSPRRQGAGLMQLHAALSTPVTVVESETEEPKVALKEVSKNKVTFKLTAENHSDKAVKYDVAANVQTDQPVQNGEDVVVAPNVIGGMDITDQAIVKINNKETKTIKVPANGEREFKVTIDVSALDADLKASFENGYWLEGFVTLTDPTDTNPELTVPYVGFKGDWDASPIFDQPMWDANSFYGMTGVVTSAEEEGSYNFLGEDLASGNIDPEKIAFSPDGDGVQDDALMMLSFLRNAKEMKFNVLNEDKKVVRTIKLETDVRKNYYDGGSVPEYSLSGDRAWDGKINGKQAEEGQYYLQATGVIDFDDAEWQSLELPVILDTTAPEVDASYNEDKLLTVDVKDDPNGSGIKYWDVLVDGKSVLENPYVNGETEHQLKDIAEGQEVTVVVQDNAGNTTETEAELAEEKDTTVPDLHVTSPEQTGVASEKEVEFSGYVTDASGIKSVTVDGQEADLQYDEEKDQYNFSLKVKHKKDDFYFRHIKAVDNAGNETEIGRRYFVDSEKAKVKVKADKKTDENNVTAKVKVKDTFDDINVYVNGNHVYKHDLTQPYEKKNFNEEIEVELNLEDGKNEFEVKVVDLGGHETVKNFTVKKVKEDNEDDDNDNDGDNEEEEENNNFFGFIWNIIGKFWGFFG
>NZ_CP007161.1|WP_040956504.1|3285719_3287132_-|NADP-dependent-phosphogluconate-dehydrogenase
MAKQQIGVIGLAVMGKNLAMNMESRGYSVAVYNRSVEKTEDFMANEAKGKNFVGATSIEEFIESLEKPRKIMLMVKAGDATDATIATLKPYLEKGDILIDGGNTLYEDTIRRNKELEKTGIHFIGTGVSGGEEGALKGPSMMPGGQKEAYDLVAPIFEAIAAKVDDAPCTTYIGPDGAGHFVKMVHNGIEYGDMQLISEAYFILKHVLGLDTDELHDVFADWNKGELDSYLIEITADIFKKKDEDTGKPLIDVILDTAGQKGTGKWTSKNALDLGVPLPLITESVFARFISAMKDERVKASKVLSGPAPEAFTGDKGELIEAVRKALYMSKICSYAQGFAQMRAQSEEYGWDLKYGDIAMIWRGGCIIRAHFLQKIKEAYDRDPALANLMLDPYFKEIVEGYQSALREVVSVAVKHGIAVPTFSSAIAYYDSYRSEDLPANLLQAQRDYFGAHTYQRKDKEGTFHTNWFN
>NZ_CP007161.1|WP_040956505.1|3287189_3288266_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MFTYTELVLAGLIALVTTLVLTYPVKWLSIKLGAVDFPSHRKIHTKVTPRLGGIAIFLGALAGAIYLQPSHPHLPEIFLGAIVILITGILDDRFSIRPVAKLTGQLLAASFLVSSGLIIEKLTLPFIGTVELGFISVFVTVLWIVGVTNAINLIDGLDGLATGVTTIALISIFAMAIIDSQILVAYLCISIIGANVGFLFHNFYPAKIYMGDTGSNFLGYMIACVSMLGLFKNIALFSFIIPVIVLAVPIFDTLFAIVRRAYNKENIMMADNKHIHYQLLRAGYSHRTTVLIIYGFSALFGLMAILLSNASIVINLVVTLFLLALFQLFAEMIGIVIGGKQPLLGALRKLVNRGSRNR
>NZ_CP007161.1|WP_040956506.1|3289321_3290332_+|ABC-transporter-substrate-binding-protein
MRKFFYGLVVVLLLIVITGCNEENGKSGEAKGKDGELTPIKFALDWTPNTNHTGLYVAKEKGYFEEQGLDVELMLPGEAGANQLMAAGKADFGVSFQEELTQARAEDLPIVSIAAVIQHNTAAYASPVGKNITEPADFEGKVYGGYGTEMEKAVLGTIMKQLGADVDKVDFLNIGSSDYFTAVKRDIDFANIFYGWTGIEAENRGEELNAIYLKDFAEELDYYTPVLATSETMIEENPETVKAFIAAAAKGYEFAIEQPEKAADILLKHAPDLDEDLVKNSQEWLSPRYQDDAEQWGIQEKERWQTFTDWMIENEIINKDIDAEKAFTNEFLPTKE
>NZ_CP007161.1|WP_040956507.1|3290344_3290635_+|hypothetical-protein
MANSLVSIQIIPKADNVKDVYGMVDEAIGVIEDAGVTYQVSPLETTMEGELSELLHIVEKMNARMVEIGAENVISQIKILHQPAGITMDTLTEKYR
>NZ_CP007161.1|WP_040956508.1|3290631_3291396_+|ABC-transporter-permease
MKQIFTKGWRPLGAILLFIIIWQVATRVFTIEEWLLPSPTDIIKEANQTWGEFLFHFMATVKLTIVGFIIGISVGLAVAILLHMLPKVRETFYPFLILSQNIPIIVLAPLLVIWFGFGSLPKLIIITLSCFFPIAVSALGGFQQTSRELVHYMKMMGATKGQLFWKLEFPHALPSVFSGLKIAATYSVMAAVISEWLGAQEGIGVFMTLATSSFRTSRVFVAIIVVMVLSLTFFGLIVLLEKLVLKWNKKGGNA
>NZ_CP007161.1|WP_040956509.1|3291395_3292121_+|ABC-transporter-ATP-binding-protein
MLSIKQVSKHFDDKKVLEDISLDIAEGEFVSLIGPSGSGKTTLFNLIGGLLMPDGGEIWKDEMNITNTTGHISYMPQQASLFPWRTILQNVLIGQELQGRKEEGLAKEMLRKAGLGEVIHSYPHELSGGMKQRASFIRALLSPQSFLCLDEPFSALDEFTRLDMQKWLLDIWEDSHQSILFITHSIDEALFLSDKIVVLSAGPAKVKRVFEVPFARPRDEQILLSEEFLKWKRVVLEEVQR
>NZ_CP007161.1|WP_052350183.1|3292569_3294042_+|hypothetical-protein
MTTSRRKTPQMHRQQQIIKRLERRFNHRTHTLTNPLVQLNPYHNAPLTALVLFTTSKPAHVSVTIEGENPITKTYPGYHTIHRLPIIGLYPNTKNRITVTATFHSGAYETNTILLKTKPLPKDFLNIKLDHSLPEKMEDGLTFMAPSANYLFAIDNQAKVRWYSTISVRQLFKPLSNGNFLVYTRSPKTKHNLVLEIDLLGRIYYYYPIYAKSEIPSTAINTDVMELSNGNLLVTTHEQTEKSLEDRLVELNRRTGKIVNRLDYAELFPKAFQEDYVGTGSNAGDWLHNNSIWVDTQSDAVVMTARHQDLVMKHSFPDGNIDWILAFPEGWPDSYKDVLLTPKSEKFKYPAGPHAVMALPDQDEDPETTDILLFDNNNRITRGDETVSQQFSRAVQYRINEKDKTVEEVWAYGEERGQAFFSPIVGDADLLPQTNNRLITSGFIKKGNGRASKIVEVSGDDHKEEVFEVTISGFAPDSKQHIYRAARMEI
>NZ_CP007161.1|WP_040956511.1|3294645_3295050_+|hypothetical-protein
MVPYIFVAAAVLAVIPILILYKIHSSKLKEDPSLRDKVQTKFMIGIAISEAIPILLIVYGFIKLEPVQTLSALYIPFLIVLFLMAYAVFFILVNKRIDVTPEAEETVNAFAMVSLPLSMSMPLIALVSLFLMMP
>NZ_CP007161.1|WP_040956512.1|3295101_3295416_-|multidrug-efflux-SMR-transporter
MAWLFLVLAGLFEMTGVLMISKLHKDRNWQSLLLLILGFGASFLFLSLAMEALPMGIAYAVWTGIGASGGAIVGMFLYGESKNWKRVVFIAMIIGATIGLKLVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

295716 : 332284

Streptococcus_phage(20.0%)

integrase,transposase

attL 291343:291360|attR 331975:331992

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
291343:291360	attL	NA	NA	NA	NA
WP_031538021.1\|295716_296850_+\|integrase	tyrosine-type recombinase/integrase	A0A0S2MYI6	Enterococcus_phage	2.1e-12	26.3
WP_031538020.1\|296924_299063_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_031538019.1\|299055_299451_+	hypothetical protein	NA	NA	NA	NA
WP_031538017.1\|299657_300023_+	winged helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	5.9e-25	50.0
WP_035416501.1\|300015_302430_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.0e-247	63.2
WP_031538015.1\|302508_303126_+	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_031538014.1\|303295_304339_+	SidA/IucD/PvdA family monooxygenase	A0A2H4J2Q2	uncultured_Caudovirales_phage	2.9e-16	25.0
WP_040954082.1\|305598_305988_-	hypothetical protein	NA	NA	NA	NA
WP_084715585.1\|306495_306795_+	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	3.1e-08	36.9
WP_040954084.1\|307505_308054_+	hypothetical protein	NA	NA	NA	NA
WP_040954085.1\|308055_310257_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_084715753.1\|310514_312815_+	DEAD/DEAH box helicase	A0A2I5ARD8	Synechococcus_phage	2.7e-06	26.7
WP_156958431.1\|312906_313308_+	hypothetical protein	NA	NA	NA	NA
WP_040954088.1\|313304_314744_+	type I restriction-modification system subunit M	A0A142K7G3	Mycobacterium_phage	3.6e-09	21.1
WP_040954089.1\|314756_316235_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.6e-28	37.6
WP_040954090.1\|316426_316705_-	hypothetical protein	NA	NA	NA	NA
WP_040954091.1\|316697_317669_-	ParM/StbA family protein	NA	NA	NA	NA
WP_040954092.1\|318103_318586_+	hypothetical protein	NA	NA	NA	NA
WP_040954093.1\|318740_318959_+	hypothetical protein	NA	NA	NA	NA
WP_052350013.1\|319058_319466_+	four helix bundle protein	NA	NA	NA	NA
WP_040954094.1\|319468_319825_+	hypothetical protein	NA	NA	NA	NA
WP_040954095.1\|320087_321083_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052350014.1\|321553_323098_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_040954097.1\|323090_323858_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	8.0e-32	30.5
WP_040954098.1\|324015_324714_-	hypothetical protein	NA	NA	NA	NA
WP_040956911.1\|325183_325795_+	recombinase family protein	M9Q1K0	Clostridium_phage	6.4e-40	47.3
WP_040954099.1\|325887_326733_+\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_040954100.1\|326716_328846_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_040956912.1\|328832_330443_+	AAA family ATPase	NA	NA	NA	NA
WP_040954101.1\|330439_332284_+\|transposase	transposase	NA	NA	NA	NA
331975:331992	attR	NA	NA	NA	NA

DBSCAN-SWA_2

640824 : 650520

Synechococcus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040954342.1\|640824_642129_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.3e-17	23.7
WP_040954343.1\|642130_642844_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SEW9	Cyanophage	3.1e-38	40.3
WP_019378788.1\|642840_643092_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_040954344.1\|643088_643772_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_040954345.1\|643755_645987_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	40.8
WP_040954346.1\|645962_647372_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.4e-50	30.5
WP_040954347.1\|647397_648417_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-70	44.5
WP_040954348.1\|648409_648988_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	38.3
WP_040954349.1\|648984_650520_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.1e-76	47.9

DBSCAN-SWA_3

1807659 : 1846258

Bacillus_phage(44.44%)

terminase,capsid,transposase,protease,integrase,portal

attL 1826522:1826536|attR 1841928:1841942

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040955314.1\|1807659_1809204_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_040955315.1\|1809337_1810198_-	hypothetical protein	NA	NA	NA	NA
WP_040955316.1\|1810329_1811787_+	spore germination protein	NA	NA	NA	NA
WP_040955317.1\|1811866_1812088_+	DUF910 family protein	NA	NA	NA	NA
WP_040955318.1\|1812084_1813056_+	ROK family glucokinase	NA	NA	NA	NA
WP_084715661.1\|1813154_1813325_-	DUF2759 family protein	NA	NA	NA	NA
WP_040955319.1\|1813491_1814115_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	3.1e-34	39.9
WP_019377943.1\|1814281_1814524_-	DUF2626 domain-containing protein	NA	NA	NA	NA
WP_040957064.1\|1814606_1815296_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_040955320.1\|1815388_1815778_-	hypothetical protein	NA	NA	NA	NA
WP_040955321.1\|1815746_1816199_-	ComGF family competence protein	NA	NA	NA	NA
WP_084715662.1\|1816146_1816506_-	hypothetical protein	NA	NA	NA	NA
WP_040955323.1\|1816471_1816906_-	type II secretion system protein	NA	NA	NA	NA
WP_052350100.1\|1817116_1817995_+	hypothetical protein	NA	NA	NA	NA
WP_040954247.1\|1818029_1819226_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_040955324.1\|1819385_1819628_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_156958472.1\|1819777_1819936_+	hypothetical protein	NA	NA	NA	NA
WP_040955325.1\|1819952_1820150_+	hypothetical protein	NA	NA	NA	NA
WP_156958473.1\|1820276_1820384_+	DNA-binding anti-repressor SinI	NA	NA	NA	NA
WP_040955327.1\|1820376_1820664_+	hypothetical protein	NA	NA	NA	NA
WP_040955328.1\|1820908_1821328_+	hypothetical protein	NA	NA	NA	NA
WP_040955329.1\|1821455_1821971_+	hypothetical protein	NA	NA	NA	NA
WP_040955330.1\|1822750_1822972_+	hypothetical protein	NA	NA	NA	NA
WP_040955331.1\|1822975_1824760_+	hypothetical protein	NA	NA	NA	NA
WP_040955332.1\|1825148_1826816_+	hypothetical protein	NA	NA	NA	NA
1826522:1826536	attL	NA	NA	NA	NA
WP_040955333.1\|1827050_1827263_+	hypothetical protein	NA	NA	NA	NA
WP_040955334.1\|1827667_1827958_+	hypothetical protein	NA	NA	NA	NA
WP_040955335.1\|1827954_1828170_+	hypothetical protein	NA	NA	NA	NA
WP_040955336.1\|1828166_1828601_+	hypothetical protein	NA	NA	NA	NA
WP_040955337.1\|1828597_1828795_+	hypothetical protein	NA	NA	NA	NA
WP_040955338.1\|1828787_1829039_+	hypothetical protein	NA	NA	NA	NA
WP_040955339.1\|1829022_1829205_+	hypothetical protein	NA	NA	NA	NA
WP_040955340.1\|1829365_1830313_+	N-6 DNA methylase	Q332L5	Clostridium_botulinum_C_phage	1.2e-74	48.5
WP_040955341.1\|1830309_1831035_+	hypothetical protein	Q332L5	Clostridium_botulinum_C_phage	4.1e-38	37.8
WP_156958474.1\|1830997_1831786_+	hypothetical protein	NA	NA	NA	NA
WP_040955342.1\|1831801_1834603_+	hypothetical protein	A0A218KC90	Bacillus_phage	2.4e-81	30.6
WP_040955343.1\|1834681_1834951_+	hypothetical protein	NA	NA	NA	NA
WP_040955344.1\|1835019_1835268_+	hypothetical protein	NA	NA	NA	NA
WP_040955345.1\|1835324_1836155_+	hypothetical protein	A0A0A0RNC0	Bacillus_phage	3.9e-08	43.7
WP_040955346.1\|1836176_1836440_+	hypothetical protein	NA	NA	NA	NA
WP_040955347.1\|1836452_1837061_+	hypothetical protein	Q37970	Bacillusphage	8.1e-11	42.4
WP_156958475.1\|1837057_1837201_+	hypothetical protein	NA	NA	NA	NA
WP_040955348.1\|1837276_1837633_-	hypothetical protein	NA	NA	NA	NA
WP_040955349.1\|1837718_1838228_+	hypothetical protein	NA	NA	NA	NA
WP_040955350.1\|1838494_1839166_-	hypothetical protein	NA	NA	NA	NA
WP_040955351.1\|1839343_1839763_+	hypothetical protein	NA	NA	NA	NA
WP_040955352.1\|1839938_1840508_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	3.8e-31	36.8
WP_052350102.1\|1840803_1842405_+\|terminase	phage terminase large subunit	A0A0N7AEF1	Bacillus_phage	6.5e-76	33.0
1841928:1841942	attR	NA	NA	NA	NA
WP_040955353.1\|1842423_1843803_+\|portal	phage portal protein	NA	NA	NA	NA
WP_084715665.1\|1843783_1844701_+	hypothetical protein	NA	NA	NA	NA
WP_040955355.1\|1844762_1845365_+	hypothetical protein	NA	NA	NA	NA
WP_040955356.1\|1845460_1846258_+\|capsid	N4-gp56 family major capsid protein	A0A2H4PQL1	Staphylococcus_phage	2.7e-75	56.7

DBSCAN-SWA_4

2025128 : 2031926

uncultured_Caudovirales_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040955528.1\|2025128_2025806_-	queuosine precursor transporter	A0A2H4J2N7	uncultured_Caudovirales_phage	1.8e-11	24.5
WP_019378425.1\|2026424_2026625_-	cold-shock protein	Q9AZD3	Lactococcus_phage	5.9e-19	64.6
WP_040955529.1\|2026943_2028614_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_040955530.1\|2028613_2029201_+	HD domain-containing protein	S4W232	Pandoravirus	3.0e-10	28.4
WP_040955531.1\|2029243_2030323_-	cell wall lytic activity	A0A1V0DZX6	Clostridioides_phage	1.6e-17	38.5
WP_040955532.1\|2030454_2031411_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.6e-130	70.1
WP_040955533.1\|2031440_2031926_+	dihydrofolate reductase	G3MBI7	Bacillus_virus	5.2e-37	46.6

DBSCAN-SWA_5

2575439 : 2583218

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040956008.1\|2575439_2576198_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.0e-23	33.5
WP_040956009.1\|2576326_2576851_+	shikimate kinase	NA	NA	NA	NA
WP_040956010.1\|2577519_2578110_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.4e-54	54.9
WP_040956011.1\|2578152_2578407_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_040956012.1\|2578573_2579524_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.2e-50	39.1
WP_019377717.1\|2579553_2580513_-	YvcK family protein	A1IMD5	Streptococcus_phage	7.1e-54	35.3
WP_040956013.1\|2580514_2581399_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	7.9e-07	30.4
WP_040956014.1\|2581427_2581892_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_040956015.1\|2582264_2583218_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	6.3e-87	51.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007161

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection