CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP004403	Endosymbiont of Acanthamoeba sp. UWC8 chromosome, complete genome	1 crisprs	DEDDh	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP004403_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP004403_1

565789-565887

Orphan

Consensus_repeat	Method
GGTGGAAGAGGCTTGTTCGGTACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP004403_1

>merge|NZ_CP004403|1|565789-565887|CRISPRCasFinder
GGTGGAAGAGGCTTGTTCGGTACTATACGTTTTTGTTGATCAGCTTGCTGTTGTTGTGCTGCCTGCTCAGGCGTAGGCGGAAGAGGCTTGTTCGGTACT

>NZ_CP004403|1|1|565789-565887|CRISPRCasFinder
GGTGGAAGAGGCTTGTTCGGTACT	ATACGTTTTTGTTGATCAGCTTGCTGTTGTTGTGCTGCCTGCTCAGGCGTA
GGCGGAAGAGGCTTGTTCGGTACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP004403.1\|WP_075260607.1\|571713_572268_-\|HK97-family-phage-prohead-protease	unknown	unknown	gnl\|CDD\|273682
NZ_CP004403.1\|WP_038538739.1\|572297_572621_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_075260580.1\|557683_558154_-\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP004403.1\|WP_038538724.1\|568947_569349_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_038538736.1\|570382_571573_-\|phage-major-capsid-protein	unknown	unknown	gnl\|CDD\|273690
NZ_CP004403.1\|WP_038538702.1\|562883_563717_-\|DUF2163-domain-containing-protein	unknown	unknown	gnl\|CDD\|378314
NZ_CP004403.1\|WP_158499256.1\|558646_559474_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225844
NZ_CP004403.1\|WP_038538686.1\|555553_557677_-\|protein-kinase-family-protein	unknown	unknown	gnl\|CDD\|270622
NZ_CP004403.1\|WP_038538717.1\|568540_568729_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368785
NZ_CP004403.1\|WP_038538699.1\|561081_562437_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP004403.1\|WP_038538705.1\|564305_564674_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_038538714.1\|568298_568526_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_038541162.1\|563722_564319_-\|DUF2460-domain-containing-protein	unknown	unknown	gnl\|CDD\|378152
NZ_CP004403.1\|WP_038538696.1\|559974_561051_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_038538733.1\|569677_570205_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274035
NZ_CP004403.1\|WP_038538711.1\|567553_568249_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_038538721.1\|568736_568943_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_158499255.1\|558207_558366_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP004403.1\|WP_038538728.1\|569350_569671_-\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|227901
NZ_CP004403.1\|WP_038538693.1\|559476_559893_-\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|367833

Protein	Function_ID	Function_description	E-value
NZ_CP004403.1\|WP_075260607.1\|571713_572268_-\|HK97-family-phage-prohead-protease	gnl\|CDD\|273682	TIGR01543, Putative_prohead_protease, phage prohead protease, HK97 family. This model describes the prohead protease of HK97 and related phage. It is generally encoded next to the gene for the capsid protein that it processes, and in some cases may be fused to it. This family does not show similarity to the prohead protease of phage T4 (see pfam03420). [Mobile and extrachromosomal element functions, Prophage functions, Protein fate, Other].	1.53483e-31
NZ_CP004403.1\|WP_038538702.1\|562883_563717_-\|DUF2163-domain-containing-protein	gnl\|CDD\|378314	pfam09931, DUF2163, Uncharacterized conserved protein (DUF2163). This domain, found in various hypothetical prokaryotic proteins, has no known function.	2.70986e-66
NZ_CP004403.1\|WP_038538736.1\|570382_571573_-\|phage-major-capsid-protein	gnl\|CDD\|273690	TIGR01554, prophage_Lp3_protein_18, phage major capsid protein, HK97 family. This model family represents the major capsid protein component of the heads (capsids) of bacteriophage HK97, phi-105, P27, and related phage. This model represents one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease. [Mobile and extrachromosomal element functions, Prophage functions].	7.09578e-98
NZ_CP004403.1\|WP_158499256.1\|558646_559474_+\|hypothetical-protein	gnl\|CDD\|225844	COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane].	1.36797e-08
NZ_CP004403.1\|WP_038538699.1\|561081_562437_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	2.65163e-06
NZ_CP004403.1\|WP_038538717.1\|568540_568729_-\|hypothetical-protein	gnl\|CDD\|368785	pfam06199, Phage_tail_2, Phage tail tube protein. characterized members are major tail tube proteins from various phages, including lactococcal temperate bacteriophage TP901-1.	0.000105461
NZ_CP004403.1\|WP_038538686.1\|555553_557677_-\|protein-kinase-family-protein	gnl\|CDD\|270622	cd00180, PKc, Catalytic domain of Protein Kinases. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. PKs make up a large family of serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and more than 500 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase.	8.61602e-08
NZ_CP004403.1\|WP_075260580.1\|557683_558154_-\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	3.85442e-77
NZ_CP004403.1\|WP_038541162.1\|563722_564319_-\|DUF2460-domain-containing-protein	gnl\|CDD\|378152	pfam09343, DUF2460, Conserved hypothetical protein 2217 (DUF2460). This model represents a family of conserved hypothetical proteins. It is usually (but not always) found in apparent phage-derived regions of bacterial chromosomes.	3.37654e-86
NZ_CP004403.1\|WP_038538733.1\|569677_570205_-\|hypothetical-protein	gnl\|CDD\|274035	TIGR02215, conserved_hypothetical_protein, phage conserved hypothetical protein, phiE125 gp8 family. This model describes a family of proteins found exclusively in phage or in prophage regions of bacterial genomes, including the phage-like Rhodobacter capsulatus gene transfer agent, which packages DNA. Members of this family show some similarity to members of pfam05135, a putative DNA packaging protein family. [Mobile and extrachromosomal element functions, Prophage functions].	4.62367e-18
NZ_CP004403.1\|WP_038538728.1\|569350_569671_-\|phage-head-closure-protein	gnl\|CDD\|227901	COG5614, COG5614, Bacteriophage head-tail adaptor [General function prediction only].	1.77322e-15
NZ_CP004403.1\|WP_038538693.1\|559476_559893_-\|DUF393-domain-containing-protein	gnl\|CDD\|367833	pfam04134, DUF393, Protein of unknown function, DUF393. Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown.	2.10513e-08

>NZ_CP004403.1|WP_038538705.1|564305_564674_-|hypothetical-protein
MNQEQLTKLLSAQKLTASTIRSISDEVMNIIELALIGDEEALEKLKLYNSKEHDLLTTFFKVSSLIIKIFPMEHRIIGTELVKSLEDVPKEEEPSENLITDADINVMKNYIERYEREKNKVH
>NZ_CP004403.1|WP_038541162.1|563722_564319_-|DUF2460-domain-containing-protein
MKFIEQRFPEDISYGSSGGPCYSTDVITMTSGYEQRNINWQQSRNQYNVAYGIKTEEHIKELIAFFRICKGKAIGFRFKDWNDYTAKNQLIAIGDGKKKSFQLVKTYKTAAVKEQRIISKPVPGKVKIFLDDNEYKEVDVDYTAGIITFKTPPAADVKITASFKFDVPVRFDTDSLLTSIEAYQTHSLNNIPLVEIRV
>NZ_CP004403.1|WP_038538702.1|562883_563717_-|DUF2163-domain-containing-protein
MNTITPKLAELLEQETTTFATCWLLKLKSGEELGFTDFDQDLNINNITYHSASGFTGTAIQSNSGLAVDNLEIEGMLDNELILKQDLIAGKYDHAEIEIFLFNYENLSAGKLHLKRGWFGEVSIKDNMFIAEVKGLTHALNKNIGDLYSHRCRAKFGDEKCKTDLSKYTFSGSITEAQSNNIIIDINRAEESDFFQYGSIKFLTGVNQGVAKEIQSYKKGGRIVLANPLPYKPSIGDNYEIIAGCNKSFTTCYKQFNNAINFRGEPHIPGISKLLKV
>NZ_CP004403.1|WP_038538699.1|561081_562437_-|tetratricopeptide-repeat-protein
MFKLMILAVILNLSFPLSASAEVLRFSQVTKIHDTSGNIKDSETFAIVSLSPDKFSVREADREIIYDFSNNYQYTINHEKQTYHSVPIYYIINFRGKEKRNREFLNELFKQLEKGDKITLPKKREIISDKTRQFDLEMAFSIGRDSAVTSKTVQKTKTQNTSFFFNGKKAAEFETGSFVIPAAFKNMYFKYILYTQNLHPFIIEDYLSREKLFEKLNYTFKPGLEGEYQVNVTTARDGIIFQEGDLGIPGNYLETCGINKDICRLYSLVKGGSLKISEQRFIDEIDEHLRRNDQLTAFLTANEYMLQYGIKQTGLFKKIISDNNDEQLTEVMSAINQQPSKEEAEKAIAVLEEAAAQNTKKGYVLYIFMANHYYSLGKFDEGYHYMLKALQKNPFIVGAYVDLSKVFFEAYDTEKAWFILDLAYKINPEHYMNKGAEVLKDKLRERHPEYF
>NZ_CP004403.1|WP_038538696.1|559974_561051_-|hypothetical-protein
MIEFIIFVISFVGAIYTYKFYSSWYLLRLQEGYSNSKLDQIINLFVFKYRFARNNNIIFHINSSSEYNFTLKRETRLDKFFKLIKVSRELQIGNKEFDKKIYIVSNDLTLYQLLLKNAVFQTQVLELFSTGINFIHCRNKKLWAIGRENDLGTKDDKNTIMLKLKELDKSMERAMLPNFKADNKYNSMVNLFHINFVCFFICYALVILAMIESKEDCSSLLEDSLGHSLKLFSVYLIAIVFYFFRTSQAHIVYIHALMVSLHVFMLGIYSVTDFINIHLDKSSKQIYYAKVVEKKITGKKDKYYYISIPHWNKNKDLYTTSVSAAEFERVKEGSAIELTLRSGYLGYEWIENKEVIIK
>NZ_CP004403.1|WP_038538693.1|559476_559893_-|DUF393-domain-containing-protein
MTDTPTKQAEKGIWLIYDYECPLCDMYCRAIRIKKDIGNLTLVDARQPSSVMDEITKLGWDIDNGMVLKVDDSLYYGSEAIHILTLLSTRTGLFNKINYFVFKSHLMSKVLYPFFRSIRNIVLFKLMGRAKISNLEKK
>NZ_CP004403.1|WP_158499256.1|558646_559474_+|hypothetical-protein
MESIFNGMIITNINHYLLNKTIYFDPSYLNRGMTFIAIAVWVAIIPLIQNNRKISSYCLLLLSFVIIFIYTSESAKLGIIGGIVTYILAKIFKHNFVAIFQVGIGGVYIFIPIAICCLIYNPRAQTLFQHIPWSFEHRIYIWQNVLDLISLRPLTGYGFNAARIISELNLSSMMIGSTSISLLPLHPHNGVIQILLELGLIGLVLNLTVWLSIIRSIALTSSIGENFKPFIYALLATYITISQSSFNIFMSWWLCLIFIIVFNFLILSKVEDNKE
>NZ_CP004403.1|WP_158499255.1|558207_558366_-|hypothetical-protein
MNTAEHERAARLAKIGVIKIKNLINNVYTLNSSRNFKNTFIENAINVKKIFA
>NZ_CP004403.1|WP_075260580.1|557683_558154_-|thioredoxin-dependent-thiol-peroxidase
MAIGLKEGDKAIDFTLPISENESVSLRDFKGKNVILYFYPKDNTPGCTTQAKNFRDHMLKFKELNTEIIGVSKDDLKSHSKFSGEHCLPFRIASDYESDVCEQYGVWEQKSFMGRKYMGITRSTFLIDKEGVIRKIWPEVSVKTHIDEVLKEIKKL
>NZ_CP004403.1|WP_038538686.1|555553_557677_-|protein-kinase-family-protein
MTLFISKLISEATNITEVSLNGILGKIRSELKDINCETIGISEAVDLVADKYLIDISGGKIESLSTPNADAYSAKDIVSTSSQNYYCLVFKKNIPTRLAEIIALKAITIHNLIRPLEIGITPIGEQGERFLCVICEKPNGKSLKELIKEGREFSHQFILKKIVAPLNKIIKDMHNIEIVHGNINPSTIFLDEKDEIIISECISSLNGLCQGDAYETVNRAQCHKWGKGEGDKSVDYYALGMTISSIISKIFFEDIKHINILESKLQNGTFSFLNQHFHFGGTIGDMLKGLVTDDKDIRWGFKDIENILMDGSYSLPAVLEKPALPRPVIFKEKEYFHKAPLAYDLARNWEDAKAFIKQSLLVKWLDISASEQLTIEALESLQEIAKKRFSSYSLFSKEDEHLIKVIIALDPNGPVRYKNLTFYKESLGPLLIYSINNEENEITQFIANSLFVDLFSYYEQIAIWFKNKNYATGLKELKQATNNIRKAGFGFGIERCCYDLNVSLPSQSHVIRGEICYGIKDILTYLDKQSIEIDELLLKKNLLCFVASRIGLAEELRVTKLISFYMLEKDKTFISLMILGIAQEKTGVKELINLSELYAEKIKTILDEVIKGEAIKKDIFAAINKVKSQGNLNLIKQSATDIYYLEQDIKGFTQATARVDFINKELERLKDKYTIEREAKEWGLKIAVKVSYIIVLFSIILAISGGL
>NZ_CP004403.1|WP_038538711.1|567553_568249_-|hypothetical-protein
MVNSKEEFYTFFKKHEEFKENNEDYLSEIKDALKNGYQPLPNAKLSESQSALLNELSHFIEKKVSLLADKELLIDIKISNGISDIGKATAALEQYKSGLLNRNRSFKDMVIGGAENMAEVSLLESATTFLEPHELHGAVREDLPASSVMGKIEDSKKFKEDRQFSMQHQEKVMEMQKTQAAQNKSIQADIASLGQEFGVLDSMSKSMKFSDNIKSPDASPDVSQKTPGISF
>NZ_CP004403.1|WP_038538714.1|568298_568526_-|hypothetical-protein
MQNVQENYFRNIINKKKAFKGDKEIEHNMQEVALRIEIKIAHLRSELLKWFIGVSLIQTSTFIATIGAALQFFLK
>NZ_CP004403.1|WP_038538717.1|568540_568729_-|hypothetical-protein
MQNLLKSLAFSNTELECRIYLDSGLISGKFLITKYEVTAKFDSFIEFELGLISSGLIKHIIN
>NZ_CP004403.1|WP_038538721.1|568736_568943_-|hypothetical-protein
MTAQDFDNSAFYFDIKNKSYRIKGVKIYNFSLQNEFLNENSILDTNWKTKIPVSSTNSLTVSMGGRIS
>NZ_CP004403.1|WP_038538724.1|568947_569349_-|hypothetical-protein
MTSIISFKKELIGALNNCQKLSGKISGVYSGLIEEVSLPVVKFSNLIVEDWSSVSSNGRVFNVSLEVMTRDISSKSCIEIIDLIEDYLPTLNNISQDFVVSRIKILGSKINFIKAERLWCGEIKVKFWIETIH
>NZ_CP004403.1|WP_038538728.1|569350_569671_-|phage-head-closure-protein
MNPKFTQLNKRITFQIYKLARDDMGGSIYTWHDGISVWAAVTPQKGNVKHRAHVDLKEGHYSIVIRYNENITENMRIKFNRQIFKIEKIINHNQADIFQIIYCREE
>NZ_CP004403.1|WP_038538733.1|569677_570205_-|hypothetical-protein
MKKFKVMRRLNKEHGLALDMTQVKNFLKIEHNDDDNLIKTMINAAAEMCENYTGLALINQEWLIQFSDIATYKIELPIRPIESIKQVEIRYHDGSKMKYGLEHYSLDQNCLLLHVTPIAAQIDIICKCGYGSAFAAIPAHLGSILLEHVAHLYESRGTKVSFDMKRYDPFKKLKI
>NZ_CP004403.1|WP_038538736.1|570382_571573_-|phage-major-capsid-protein
MNIGEITQKVDTLAHNWEQFKAINDRKLSEVNKHGTADPLTEMHLKRLNDSIDHYQKSINKIETALSRPAAEVKAEYNNIDEQNHGKAFCNYLRKGMEHDLINIEQKHAKLSDRNSGYLITNKMAVKIAQALKELSPIRKLASIAEISSSSLEIIEDRAEANAGWTQEADNIDKSTQLNLSKKVIMVHELYAQPKLTQKLIDDTSIDLESWLANKLIDIFERKENEAFLSGDGEGKPKGMLTYGAGKEWGKIEQIHSSVNGKITAESIVKLFFSLKNAYTNNAKFLMSRDAMQSIRTLKDPVSGIYLWQPGLEHKVPNTLLGAEVVESADMPSMKDGSLSIIFGDFKHAYQIADRQDIRILRDPFTNKPFVKFYTTKRVGGDVINFEALKIMKLSA
>NZ_CP004403.1|WP_075260607.1|571713_572268_-|HK97-family-phage-prohead-protease
MNYHYTAHNSLLQKSINEEGFFKGYASVFNVKDSHNDLIMPGAFTDSLKMNLNIKLLWQHDQKEPIGIINKMTQDEKGLLVEGRLLLDLNRAREAYSLITNQIIKGLSIGYTIVDYFIEKQTRYLTKLNLIEISLVTFPANKYAEINYIKSEDDYLRLKQSLERANRILVGDTGIEPVTSTMST
>NZ_CP004403.1|WP_038538739.1|572297_572621_+|hypothetical-protein
MRFFIIFLLFPILGFAKVYQEITDPKMLAFLSVAGPEPANEIILQDDSRMWVHGCAAGSRVTINDVPAKAGEYRIKDSDHIIKVDEKGKLVESIKNIKNITCIGTPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

107036 : 113396

Indivirus(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038537684.1\|107036_107732_-	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	3.9e-17	33.8
WP_038537687.1\|107825_108368_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	7.2e-11	28.7
WP_038537690.1\|108373_109186_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_038537693.1\|109196_109661_-	hypothetical protein	NA	NA	NA	NA
WP_052646265.1\|110055_111120_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.0e-53	38.1
WP_038537695.1\|111128_111737_+	riboflavin synthase	A0A1V0SE20	Indivirus	6.8e-18	32.8
WP_038537700.1\|111739_112942_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.0e-89	44.1
WP_038537702.1\|112949_113396_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.8e-21	39.7

DBSCAN-SWA_2

381270 : 433781

Leptospira_phage(14.29%)

tRNA,integrase,transposase

attL 420517:420576|attR 434724:435389

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038538303.1\|381270_382008_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_052646311.1\|382141_383944_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.0e-57	29.0
WP_038538306.1\|383936_384938_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_038538309.1\|385247_387686_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_038538312.1\|387705_388914_-	5-aminolevulinate synthase	D2TEZ5	Emiliania_huxleyi_virus	2.8e-31	27.2
WP_038538315.1\|388988_389276_-	hypothetical protein	NA	NA	NA	NA
WP_038538318.1\|389442_390693_+\|tRNA	histidine--tRNA ligase	A0A1V0SLE3	Klosneuvirus	2.9e-23	28.0
WP_038538321.1\|390703_391522_+	AAA family ATPase	NA	NA	NA	NA
WP_038538323.1\|391665_392190_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	2.7e-31	43.2
WP_052646312.1\|392285_393212_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_038538325.1\|393562_394825_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	6.0e-85	43.4
WP_084173755.1\|394830_395355_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A218MND2	uncultured_virus	5.5e-16	36.9
WP_038538327.1\|395521_397414_+	hypothetical protein	NA	NA	NA	NA
WP_038538330.1\|397514_398054_+	DUF1640 domain-containing protein	NA	NA	NA	NA
WP_038538335.1\|398252_399494_-	cell division protein FtsA	NA	NA	NA	NA
WP_038538337.1\|399509_400295_-	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_038538340.1\|400298_401234_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_038538343.1\|401230_402106_-	hypothetical protein	NA	NA	NA	NA
WP_038538346.1\|402109_402430_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	8.0e-18	43.6
WP_038538349.1\|402561_402807_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_038538352.1\|402806_403397_+	septum formation protein Maf	NA	NA	NA	NA
WP_038538355.1\|403574_403775_-	hypothetical protein	NA	NA	NA	NA
WP_038538358.1\|404142_405324_+	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_038538362.1\|405339_406218_+	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	2.3e-22	29.8
WP_038538365.1\|406364_406946_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_052646313.1\|407412_408318_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A221SAN4	Ralstonia_phage	1.6e-26	32.7
WP_095666394.1\|408318_409436_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-41	37.9
WP_038538372.1\|409921_413236_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_038538378.1\|413773_414691_+	hypothetical protein	NA	NA	NA	NA
WP_038541069.1\|414749_415082_+	hypothetical protein	NA	NA	NA	NA
WP_052646315.1\|415099_415402_+	DUF3630 family protein	NA	NA	NA	NA
WP_158499247.1\|415489_415648_+	hypothetical protein	NA	NA	NA	NA
WP_148299461.1\|415714_416257_+	hypothetical protein	NA	NA	NA	NA
WP_038538384.1\|416284_418276_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_148299462.1\|418296_419016_+	hypothetical protein	NA	NA	NA	NA
WP_038538390.1\|419049_419307_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_095666394.1\|419307_420425_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-41	37.9
WP_075260576.1\|420467_420740_-\|transposase	IS3 family transposase	NA	NA	NA	NA
420517:420576	attL	NA	NA	NA	NA
WP_158499248.1\|420814_421033_-	hypothetical protein	NA	NA	NA	NA
WP_075260577.1\|420965_421370_+	hypothetical protein	NA	NA	NA	NA
WP_084173757.1\|421615_421825_-	hypothetical protein	NA	NA	NA	NA
WP_052646316.1\|421828_422245_-	hypothetical protein	NA	NA	NA	NA
WP_084173758.1\|422368_422692_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_038538398.1\|423087_423432_+	hypothetical protein	NA	NA	NA	NA
WP_052646318.1\|423500_423719_+	hypothetical protein	NA	NA	NA	NA
WP_038541081.1\|423695_423965_-	hypothetical protein	NA	NA	NA	NA
WP_038538399.1\|424317_425475_-	hypothetical protein	NA	NA	NA	NA
WP_038538401.1\|425630_425822_-	hypothetical protein	NA	NA	NA	NA
WP_038538406.1\|425839_426148_-	hypothetical protein	NA	NA	NA	NA
WP_038538409.1\|426159_427386_-	hypothetical protein	A0A2H4ZK81	Cryptophlebia_leucotreta_granulosis_virus	1.5e-08	29.2
WP_038538412.1\|427408_428260_-	DUF2608 domain-containing protein	NA	NA	NA	NA
WP_158499249.1\|428552_429191_-	EamA family transporter	NA	NA	NA	NA
WP_148299463.1\|429975_430248_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	8.5e-13	43.2
WP_038538418.1\|430554_431634_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_038538421.1\|431736_432732_-	hypothetical protein	NA	NA	NA	NA
WP_148299464.1\|432875_433781_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.2e-56	41.5
434724:435389	attR	NA	NA	NA	NA

DBSCAN-SWA_3

517225 : 572268

Bacillus_phage(27.27%)

tRNA,head,capsid,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052646335.1\|517225_518383_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_038538596.1\|518413_519280_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_038538599.1\|519291_519486_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_148299470.1\|519464_519761_+	hypothetical protein	NA	NA	NA	NA
WP_038538604.1\|520244_520868_-	oxidase	NA	NA	NA	NA
WP_052646336.1\|520878_521307_-	group III truncated hemoglobin	NA	NA	NA	NA
WP_038538606.1\|521404_521833_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_038538609.1\|522149_523109_-	hypothetical protein	NA	NA	NA	NA
WP_084173771.1\|523197_523881_-	hypothetical protein	NA	NA	NA	NA
WP_052646337.1\|523849_524488_-	heme ABC exporter ATP-binding protein CcmA	G3M9Y6	Bacillus_virus	9.7e-07	23.4
WP_084173829.1\|524487_526143_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.1e-67	33.7
WP_052646339.1\|526272_528369_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_038541150.1\|528574_529192_-	ribonuclease D	K7XYU9	uncultured_Mediterranean_phage	1.6e-11	34.4
WP_038538616.1\|529321_529909_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_038538619.1\|529908_531003_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_038538622.1\|531059_531728_+	hypothetical protein	NA	NA	NA	NA
WP_148299471.1\|531835_533329_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_038538630.1\|533427_534825_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_052646341.1\|535121_536306_+	UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase	NA	NA	NA	NA
WP_038538633.1\|536305_536563_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_038538636.1\|536566_538000_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	4.6e-57	32.1
WP_038538639.1\|538207_539302_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_148299519.1\|539622_539739_+	hypothetical protein	NA	NA	NA	NA
WP_038538642.1\|539831_541265_-	hypothetical protein	NA	NA	NA	NA
WP_038538644.1\|541895_542198_-	STAS domain-containing protein	NA	NA	NA	NA
WP_038538648.1\|542244_543624_-	PleD family two-component system response regulator	A0A127AWB9	Bacillus_phage	2.7e-22	41.4
WP_038538650.1\|543627_543990_-	response regulator	NA	NA	NA	NA
WP_038538653.1\|544287_545601_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_158499254.1\|545724_547032_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_038538660.1\|547038_547689_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_038541156.1\|547811_548750_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_038538663.1\|548804_549230_+	hypothetical protein	NA	NA	NA	NA
WP_038538666.1\|549502_550291_-	hypothetical protein	NA	NA	NA	NA
WP_038538669.1\|550526_551966_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_038538671.1\|552037_553126_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_038538674.1\|553118_553580_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_038538677.1\|553584_553959_-	hypothetical protein	NA	NA	NA	NA
WP_038538680.1\|553976_554954_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	3.5e-08	28.2
WP_038538683.1\|555158_555548_-	hypothetical protein	NA	NA	NA	NA
WP_038538686.1\|555553_557677_-	protein kinase family protein	NA	NA	NA	NA
WP_075260580.1\|557683_558154_-	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_158499255.1\|558207_558366_-	hypothetical protein	NA	NA	NA	NA
WP_158499256.1\|558646_559474_+	hypothetical protein	NA	NA	NA	NA
WP_038538693.1\|559476_559893_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_038538696.1\|559974_561051_-	hypothetical protein	NA	NA	NA	NA
WP_038538699.1\|561081_562437_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_038538702.1\|562883_563717_-	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	7.1e-42	33.7
WP_038541162.1\|563722_564319_-	DUF2460 domain-containing protein	A0A1B0V7D8	Roseobacter_phage	1.2e-38	43.3
WP_038538705.1\|564305_564674_-	hypothetical protein	NA	NA	NA	NA
WP_038538708.1\|564704_567488_-	hypothetical protein	NA	NA	NA	NA
WP_038538711.1\|567553_568249_-	hypothetical protein	NA	NA	NA	NA
WP_038538714.1\|568298_568526_-	hypothetical protein	NA	NA	NA	NA
WP_038538717.1\|568540_568729_-	hypothetical protein	NA	NA	NA	NA
WP_038538721.1\|568736_568943_-	hypothetical protein	NA	NA	NA	NA
WP_038538724.1\|568947_569349_-	hypothetical protein	NA	NA	NA	NA
WP_038538728.1\|569350_569671_-\|head	phage head closure protein	A0A2I7SC03	Paenibacillus_phage	1.2e-08	34.3
WP_038538733.1\|569677_570205_-	hypothetical protein	NA	NA	NA	NA
WP_038538736.1\|570382_571573_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	9.1e-67	43.5
WP_075260607.1\|571713_572268_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	4.4e-24	39.9

DBSCAN-SWA_4

862118 : 918750

Paracoccus_phage(12.5%)

capsid,terminase,head,portal,transposase,integrase

attL 861910:861928|attR 894283:894301

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
861910:861928	attL	NA	NA	NA	NA
WP_038539247.1\|862118_863288_+\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	7.4e-45	35.3
WP_038539250.1\|863543_863882_+	hypothetical protein	NA	NA	NA	NA
WP_038539253.1\|864180_866817_+	hypothetical protein	NA	NA	NA	NA
WP_038539256.1\|867255_867495_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_038539259.1\|867482_868100_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_038539261.1\|868829_870053_+	hypothetical protein	NA	NA	NA	NA
WP_052646414.1\|870216_870897_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_038539264.1\|871188_871383_+	hypothetical protein	NA	NA	NA	NA
WP_038539268.1\|871532_874277_+	hypothetical protein	NA	NA	NA	NA
WP_038539270.1\|874734_875850_+	hypothetical protein	NA	NA	NA	NA
WP_038539273.1\|876016_877522_+	hypothetical protein	NA	NA	NA	NA
WP_052646416.1\|877541_879005_+	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	3.3e-58	29.7
WP_038539276.1\|879001_879439_-	lysozyme	A0A2I7RLY1	Vibrio_phage	5.6e-22	46.3
WP_038539279.1\|879435_879888_-	hypothetical protein	NA	NA	NA	NA
WP_038539282.1\|879906_880146_-	hypothetical protein	NA	NA	NA	NA
WP_052646418.1\|880130_880841_-	DUF2793 domain-containing protein	A0A0B5A0F6	Paracoccus_phage	5.3e-14	40.2
WP_038539285.1\|880860_884589_-	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	1.9e-147	33.3
WP_038539287.1\|884576_885020_-	hypothetical protein	A0A1V0DYB6	Dinoroseobacter_phage	1.1e-12	32.9
WP_038539290.1\|885061_885691_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_038539292.1\|885816_886662_-	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	8.0e-41	36.2
WP_038539295.1\|886658_887261_-	DUF2460 domain-containing protein	A0A1W6DWM9	Sphingobium_phage	2.9e-45	45.2
WP_038539298.1\|887263_889774_-	hypothetical protein	A0A1C9LVY1	Vibrio_phage	4.8e-49	41.5
WP_038539301.1\|890480_891455_-	hypothetical protein	G8DH51	Emiliania_huxleyi_virus	5.0e-63	43.0
WP_038539305.1\|891475_891907_-	hypothetical protein	NA	NA	NA	NA
WP_148299485.1\|892012_893527_-	hypothetical protein	NA	NA	NA	NA
WP_038539309.1\|893712_894345_-	hypothetical protein	NA	NA	NA	NA
894283:894301	attR	NA	NA	NA	NA
WP_038539312.1\|894316_894652_-	hypothetical protein	NA	NA	NA	NA
WP_038539314.1\|894635_894833_-	hypothetical protein	NA	NA	NA	NA
WP_038539317.1\|894847_895879_-\|capsid	major capsid protein	V5Q8G6	Xylella_phage	1.8e-66	39.7
WP_052646573.1\|895879_896173_-\|head	head decoration protein	A0A0C5AN05	Bacteriophage	1.3e-11	49.4
WP_052646420.1\|896271_897423_-	S49 family peptidase	A0A219YB02	Aeromonas_phage	7.5e-50	38.6
WP_038539323.1\|897434_898895_-\|portal	phage portal protein	A0A067ZJA4	Vibrio_phage	4.4e-87	38.3
WP_038539325.1\|898900_899128_-	hypothetical protein	NA	NA	NA	NA
WP_084173786.1\|899139_901110_-\|terminase	phage terminase large subunit family protein	A0A1B2LRQ2	Wolbachia_phage	3.7e-182	51.6
WP_038539328.1\|901060_901555_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	1.3e-38	53.3
WP_095666401.1\|901559_902780_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	6.6e-137	60.1
WP_038539334.1\|903069_903453_-	hypothetical protein	NA	NA	NA	NA
WP_038539336.1\|903454_903913_-	phage related protein	E9P621	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.8e-45	63.4
WP_038541400.1\|904246_906292_-	AAA family ATPase	A0A1B2LRQ1	Wolbachia_phage	3.2e-112	37.0
WP_038539339.1\|906336_907071_-	hypothetical protein	K4HZA0	Acidithiobacillus_phage	2.7e-61	46.6
WP_052646422.1\|907074_907608_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	5.7e-53	57.7
WP_052646424.1\|907631_908459_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	1.7e-96	63.3
WP_038539342.1\|908455_908932_-	hypothetical protein	NA	NA	NA	NA
WP_038539345.1\|908928_909162_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038539348.1\|909423_910332_-	hypothetical protein	NA	NA	NA	NA
WP_052646426.1\|910315_911518_-	hypothetical protein	NA	NA	NA	NA
WP_052646428.1\|911875_912829_-	ankyrin repeat domain-containing protein	A0A068EHA6	Pigeonpox_virus	1.2e-08	29.0
WP_038539352.1\|913287_914178_-	hypothetical protein	NA	NA	NA	NA
WP_038539356.1\|915162_916227_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_148299465.1\|917796_918750_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.6e-24	33.3

DBSCAN-SWA_5

1545453 : 1553762

Acidithiobacillus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084173820.1\|1545453_1545786_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A2P0ZKX3	Lactobacillus_phage	8.0e-05	28.4
WP_148299514.1\|1545788_1546037_-	hypothetical protein	NA	NA	NA	NA
WP_038540723.1\|1546302_1546536_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038540726.1\|1546532_1547009_+	hypothetical protein	NA	NA	NA	NA
WP_084173821.1\|1547005_1547857_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	4.9e-99	64.0
WP_052646555.1\|1547856_1548390_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	6.1e-55	59.5
WP_038540729.1\|1548393_1549146_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	9.5e-62	47.0
WP_052646556.1\|1549123_1550197_+	hypothetical protein	NA	NA	NA	NA
WP_084173822.1\|1550160_1551303_+	AAA family ATPase	A0A1B2LRS1	Wolbachia_phage	1.9e-69	53.0
WP_038541790.1\|1551611_1552064_+	phage related protein	E9P621	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	4.8e-45	63.6
WP_038540732.1\|1552065_1552449_+	hypothetical protein	NA	NA	NA	NA
WP_038540734.1\|1552737_1552944_+	ParB N-terminal domain-containing protein	A0A2H4JGF1	uncultured_Caudovirales_phage	3.5e-11	66.7
WP_038540738.1\|1552940_1553762_-	ankyrin repeat domain-containing protein	A0A2H4X2R4	Flamingopox_virus	2.5e-07	34.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage