CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP008944	Corynebacterium atypicum strain R2070 chromosome, complete genome	1 crisprs	cas5,cas8e,cas6e,cas3,csa3,cas4,WYL,DEDDh,DinG	0	0	4	0
NZ_CP008945	Corynebacterium atypicum strain R2070 plasmid phiCATYP2070I, complete sequence	0 crisprs	NA	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP008944_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP008944_1

64357-64452

Orphan

Consensus_repeat	Method
GGTTGGCGCAAAGCCGGGGGCGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP008944_1

>merge|NZ_CP008944|1|64357-64452|CRISPRCasFinder
GGTTGGCGCAAAGCCGGGGGCGGGGCAGGGACTCTGGCCGGGGCGGAAGCCATGGAGGCGGCAGGAACTGAGGTTGGCGCAAAGCCGGGGCGGGGT

>NZ_CP008944|1|1|64357-64452|CRISPRCasFinder
GGTTGGCGCAAAGCCGGGGGCGGGG	CAGGGACTCTGGCCGGGGCGGAAGCCATGGAGGCGGCAGGAACTGA
GGTTGGCGCAAAGCCGGGGCGGGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP008944.1\|WP_144239933.1\|65352_65904_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319790
NZ_CP008944.1\|WP_051866651.1\|66862_68908_-\|DUF222-domain-containing-protein	unknown	unknown	gnl\|CDD\|238038
NZ_CP008944.1\|WP_084168075.1\|78987_79653_-\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP008944.1\|WP_038603986.1\|74628_77166_-\|ATP-dependent-helicase-HrpB	unknown	unknown	gnl\|CDD\|224557
NZ_CP008944.1\|WP_051866653.1\|71569_73246_+\|DUF885-domain-containing-protein	unknown	unknown	gnl\|CDD\|377577
NZ_CP008944.1\|WP_051866647.1\|53861_54212_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008944.1\|WP_038603960.1\|56105_56750_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008944.1\|WP_038603957.1\|55758_55953_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP008944.1\|WP_144239824.1\|57707_59183_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226951
NZ_CP008944.1\|WP_084168451.1\|69151_70438_-\|ROK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224851
NZ_CP008944.1\|WP_084168450.1\|66056_66683_+\|gamma-carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|100051
NZ_CP008944.1\|WP_038607263.1\|59416_60571_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP008944.1\|WP_084168449.1\|56868_57462_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP008944.1\|WP_038603990.1\|77293_78739_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008944.1\|WP_038603982.1\|70623_71424_-\|NAD-dependent-deacylase	unknown	unknown	gnl\|CDD\|234777
NZ_CP008944.1\|WP_084168448.1\|52030_53662_-\|peptide-MFS-transporter	unknown	unknown	gnl\|CDD\|225646
NZ_CP008944.1\|WP_084168073.1\|60637_61369_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP008944.1\|WP_051866649.1\|61606_63970_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008944.1\|WP_038603977.1\|64612_65026_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|224861
NZ_CP008944.1\|WP_051866648.1\|54287_55715_+\|AMP-nucleosidase	unknown	unknown	gnl\|CDD\|236222

Protein	Function_ID	Function_description	E-value
NZ_CP008944.1\|WP_144239933.1\|65352_65904_+\|HAD-IA-family-hydrolase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.33515e-28
NZ_CP008944.1\|WP_084168451.1\|69151_70438_-\|ROK-family-transcriptional-regulator	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.39054e-06
NZ_CP008944.1\|WP_038603986.1\|74628_77166_-\|ATP-dependent-helicase-HrpB	gnl\|CDD\|224557	COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair].	2.21003e-173
NZ_CP008944.1\|WP_051866653.1\|71569_73246_+\|DUF885-domain-containing-protein	gnl\|CDD\|377577	pfam05960, DUF885, Bacterial protein of unknown function (DUF885). This family consists of several hypothetical bacterial proteins several of which are putative membrane proteins.	1.64905e-150
NZ_CP008944.1\|WP_051866651.1\|66862_68908_-\|DUF222-domain-containing-protein	gnl\|CDD\|238038	cd00085, HNHc, HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.	2.24998e-07
NZ_CP008944.1\|WP_038607263.1\|59416_60571_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.75874e-14
NZ_CP008944.1\|WP_144239824.1\|57707_59183_-\|hypothetical-protein	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	5.26599e-35
NZ_CP008944.1\|WP_084168075.1\|78987_79653_-\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.2502e-72
NZ_CP008944.1\|WP_038603957.1\|55758_55953_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	1.68952e-21
NZ_CP008944.1\|WP_084168450.1\|66056_66683_+\|gamma-carbonic-anhydrase-family-protein	gnl\|CDD\|100051	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.	1.15939e-76
NZ_CP008944.1\|WP_084168449.1\|56868_57462_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.81352e-50
NZ_CP008944.1\|WP_038603982.1\|70623_71424_-\|NAD-dependent-deacylase	gnl\|CDD\|234777	PRK00481, PRK00481, NAD-dependent deacetylase; Provisional.	1.0207e-107
NZ_CP008944.1\|WP_084168448.1\|52030_53662_-\|peptide-MFS-transporter	gnl\|CDD\|225646	COG3104, PTR2, Dipeptide/tripeptide permease [Amino acid transport and metabolism].	4.47638e-149
NZ_CP008944.1\|WP_084168073.1\|60637_61369_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	6.72514e-84
NZ_CP008944.1\|WP_038603977.1\|64612_65026_-\|phage-holin-family-protein	gnl\|CDD\|224861	COG1950, COG1950, Predicted membrane protein [Function unknown].	2.81139e-16
NZ_CP008944.1\|WP_051866648.1\|54287_55715_+\|AMP-nucleosidase	gnl\|CDD\|236222	PRK08292, PRK08292, AMP nucleosidase; Provisional.	0

>NZ_CP008944.1|WP_051866649.1|61606_63970_-|hypothetical-protein
MTMAATTASASELALLAVLSLLALVIPGATVTFAFTRRPGLSLAASVPTTIGILGLFSWVYGAQEIPVTVASLTAGCVVTLIVALALGSVAARASNATGNFRRGPANEAARDADAPRPGREAENSPAAASGSSSPVSSSRVPPGHLQAPAGLSMPWLAPLASAASVAAITIWATIYCCQIMIRLGDRGLRSIPQGWDMHWHASLVHWVHTAGIISPTHTGELRYAEDHMLVYYPTGWHTACDFATSIAWRLTGREWDDVEAINLFMALSITLAAAGSAAALTWVVSRRAVRHTGVAAGALRWAAVTTAALAGALLPAWQIIFFDGSWPVGFGLGLGGIAAAVTIQAVTSQRRAWVASIAAALSILGAVQTHASTATLLAAALGLWFIQQLVRPTPGTTRMRIVFHLTLAAVLTAAPFYPQFRVGLGNVSEVAETVGQETDTLSGAWSRAIFMQTKFFDFYEDRTFWYALVVLGLVGLLVACARGGAWLAGLAVVAIVGTAHSLHRFDGVFGQLVGAFTSLNYNAPHRIALIAAMAVASGVGLLALYLVFIPLARGAGRLAAATINDAPTTRSTAAHDEALTREPRPSAQRPRATDARPHRRVGAAAGASVIAASVVLSALWAPPTVRAEKPALEILLAADKTGRMVSAADMGALDWLRDRMLESNAPFSILSVPEAGMSWGYITHDLPMVYTHYLADRYQDQLDTNTVLYEADQISGDPNARVDAAACRTGIRYLIDSKAMFWGLPPYPSFENLQNAPGLTEVYSDGEEVRIFEVDSWDPYRCTSVR
>NZ_CP008944.1|WP_084168073.1|60637_61369_+|ABC-transporter-ATP-binding-protein
MYARTPQNVCLHEAEAGHAVLRFDEVTVTYPDGDQTVTALDRVSFEVPRGNIAAIIGESGSGKSTLLSVAAGLSVPDSGTVTIDTGTEVVELARATETERARVRRNFLGVVFQRPNLLPALTVSEQLVIADDLSGRRHGVKKAAELLDFVGLNGMENRRVHQLSGGQQQRVNIARALMGNPRVLLADEPTSALDHKLSQEIMGLLRKVTDRFGLATVLVTHDGSLLNKTDQVHEMRDGKLSKQ
>NZ_CP008944.1|WP_038607263.1|59416_60571_+|ABC-transporter-permease
MYLSIRDIRFARGRFALIGSVIALITLLIVMLTGLTHGLGKQNTSALDSLAPDRVVFAGGAPGEKPSIDFAESQIDASTAREWRHISGVQRVTALGAAQTRAELGGQATAVAVFGLPVGSQTPDGLTIKAGEAIIPEEIVEAEAVHAGSDAEASGGASRTKDAQASSTASEVANDRGNLIDLGGTKVPAGEETSTKYYSHLPVVWVDMDTWKTVSHLDKPTVLLVDGTPEKSAAAEVARRTGSQALPLTKAYQGLSAYQSERGSLLTMQGLLYGISALVIVAFLSVWTIQRTRDIAVLRALGASKRYVLTDALTQASIVVLAGAIGGGAVGAGLGAWVSGVVPFTLSWRTIAVPIIGVVALGIVAAVAATRKVAQIEPQIALGG
>NZ_CP008944.1|WP_144239824.1|57707_59183_-|hypothetical-protein
MYTSRLTGILSSLRVGLHVLFALLLAIGSVRAWQASPHGWTLTLSAALGVWYLLGTTWDHRFAMGRTARDPGGLAYLWLAITCGLWAALLVASESFLWLLFPLVFVVLHVLGDGFLGISAVLGALLLGIGLPLLAAAHFRSLSSSANESTITGLGDATSDVAGNGTGVSVAVIVGPTIGVAFAVACRRTYRALSIEAANQKALAESLRHTVSELRRTQSRALAAENRAGRLAERERLAREIHDTLAQGFNSIVLFSRVARKAVASKDATAATERLEVISEVAQKNLAIARGLVAQAPGDALLAPNALLAPDALLAPDAPEAQKAPACGTAPGAPAEPSAPAASGAPPAPTHRDTNLPATLRALGAELTRQYGLPVAVHCPALAVPAGTALVLERVVRESLTNASRHSGASQARVTVTAWPGELSVDVHDDGRGFDPDHVPPGHYGLAGIRSRLDEVGGALSIDSSPAGTVVAARVPLPLPASDAEETAGSA
>NZ_CP008944.1|WP_084168449.1|56868_57462_-|response-regulator-transcription-factor
MSSRPGSAPGASSIPGGEAATASHWDGGSIDRSRPVSWPGPVDVVVMDLQMPGIGGVEATRRLRAAGGPPVLVLTTYDTQADILAAISAGALGYLLKDAPEDELHRAVIATARGDRTLSPEVATALAERVSAPFEALSAREIEILAALETGASNKQIAQQLFISLATVKTHLVHIYQKLGVDNRTAAISAARARKLI
>NZ_CP008944.1|WP_038603960.1|56105_56750_+|hypothetical-protein
MNASFVPVPAPAKTAAAAFAIAGTVVLAGCAGPGSGENGAAPAVAPVGGQEGAGQAGAGDAAKDAAGQNKASQNEKTGAGQSSGRAGQRVGSEVLLARLGATDVSCEFSNSQAGGLCRADKPMWADERGAKRNAVFFTFGGGNGEARVMIKDAPAPAVPPDARRVGEGQSTRIFDFFWLKSRPGRIEIGHSSPEAGRASGQEAIEITESNARVR
>NZ_CP008944.1|WP_038603957.1|55758_55953_-|PspC-domain-containing-protein
MAGFASSPLHRSSVDRWIGGVCGGIAETYDWDPTLVRLITVLLLYFAGTPIIIYLILWVIMPLD
>NZ_CP008944.1|WP_051866648.1|54287_55715_+|AMP-nucleosidase
MAQSSAELVELPDARQAVTRLIELYEASVATAREAISSGDYARYADVVYPKLVVDVQSWRPIDRSEPFGYVDASGRYVAEIARPRVMERYLVEQLEALCTNYPCRILVGPSATRIPPEYIAGIGDVSEARRAGDLGDAVPRPTLDEVHDAIIDQHWEAFHGTEKPLFHFGPQRFDLACARIAHYTGISVDSLQKYILFTNYAMHTTEFVRFGLREIADPNSRYTELLLPDGTRLTAGDQVELEELDLGSKNQMPRFDLVTAAGDGLTMINIGVGPSNAKTITDCLAVLRPEAWIMIGHCAGLDGRMRIGDLILGNAYQREDSILDSRIDADIPIPAVPEVQRALEASVDEIYGGDHSLMRTGTVLSTGDRNWEWHTPKDLWEWLRGSTAVAVDMESCTLAANGYRFRVPYGTLLSVSDLPLHAVPKLPAQAQAFYTSSKEAHVMCAVRAMEKLARDPARLHTRKLRRTIGEVPFR
>NZ_CP008944.1|WP_051866647.1|53861_54212_-|hypothetical-protein
MDATPPPIWQASAELWAHHNSQDLVYRLDLAFSSAAERDRVWRVLGQSRPVSEGAVLCGGAALTCLGARGMQVISGGEDALDSLDDAVNDALATALDTAGITNRPTVTGVDRRLVP
>NZ_CP008944.1|WP_084168448.1|52030_53662_-|peptide-MFS-transporter
MNPTDNSSRPDNGGHSSPGEQTSKAPGSTSTSAASPAAEERSEEAHFDFANPDVTSVKASVKKSRKFFGQPWGLANLFGIELWERFSFYGMQALLTYYLFYSVTEGGLGMDESAAVSLVGAYGGFVYICSLAASFVADRLFGAERTLFYSAILVMVGHIALAVIPSYAGLAIGLVCIGLGSGGVKTASQVVLGDLYAREDPRRDAGFSIFYMAVNIGAFFGPLLTGAVWGMAGFHWGFGLAAIGMAAGLIQYILMRKTTIADAGSEIPNPLPHSQYLPWLIGVIVGVIVIAVLIGTGVIRIEWLSSIMATIAFVAAAWLLVQMNASPLTTPVERSRLIGYIPLLIGGVLFFAIFQSQFTVLALYSDQRLDRSFFGIELAPSQVQAFNPLFIIIFAGIFAVMWTKLGTRQWSSPVKFGVANLIIGVSLFVFVPFSNSGQNGTPLVVVVGILFLFTMGELLLSPVGNALATKVAPKAFKSRLFAVWLMALSMGTALSGVLGQYYDPSDPAVERTFFITVGIAALVIGAVLISLRKWVLRKFVDVR
>NZ_CP008944.1|WP_038603977.1|64612_65026_-|phage-holin-family-protein
MRMLWNFFVHAAATAFGLLVVTAFVPGVTLTAEASPAIGDGSHDRLWAFLGAGAIVAALNMFIKPIFKLIGLPLTIVTLGLFCWVINAVILLIAAGIAQAFGLGLSISGFWAALFGAIVLGVVNAVVSPITSSLERN
>NZ_CP008944.1|WP_144239933.1|65352_65904_+|HAD-IA-family-hydrolase
MHLPGPQHGAGILDAIGADARVWTVYEELRYRLDAALITETAYWQQIGERVGLGSIDSARAIEADYAGCLEADIGTVKHVLDLIGDGWKVGILSNIPPGLAARVRSKHGHWLEAFDAVTFSCDIGVAKPEQEAYEVAVDALQADPKGTVFFDDRPDYLAGAEAAGLKAVRFSGWDSVASALGL
>NZ_CP008944.1|WP_084168450.1|66056_66683_+|gamma-carbonic-anhydrase-family-protein
MAAPNHTDRTDRKDADGSAGVLGQGPYFYEFNGKRPRVHPDAWIAPTATLIGDVVVEADASVFYGVVLRGDIGPIRVGRGSNIQDNSVLHVEEGQSCILGENVTVGHLALVHGAVVEDGCLIGMGSKVLSHAVIGAGSLVAAGAVVLENAQVPPRSLMAGVPAKARRELSEEQSQAFIPHAENYVEIAKNQGERVQPAPWEGSATEER
>NZ_CP008944.1|WP_051866651.1|66862_68908_-|DUF222-domain-containing-protein
MNRSLEQSVHALHAALQDVRRHFSPDTPLLELRDALPALRELRKVTQAKADLDILIAFLADKNGAGNLVYSSKPADFLMKIFGISFPEAASRIAQGRDLYGEATAPSLEDFINQHLGPHGQEEPDSDAHDSEGPRGRPDSESGSGTGSGSDPEGDPGSDSEAGTNAGSEAGAQRRAQAEREEAERLRREREAQKKLQDDLKENPVDPERRAVITKEMQRLLPSAPIGKKELTALAMEEARHRNIRDLRRWLRNRIDKENGAARNPAQIHGLREFTVSPPDAMGGARFSGYAPPALLALLENCLAPAKRPPHDGEKTDLRTAKQRRADALFAALHAYGAADTKNRSGVGSIVVSLTKEDIDLLDEPALAAKATFATNTHARLGAAKLGFTCLHSKKGNPLALGRFERSASLDKKIALVASELVCTAPGCDEPAINCDTHHLWPFSFGGDSLIDNLTTLCRRHHVDNNDARDPERKRPYMTRDEQTGRVGRTYPRSRRQYRPQGSQRRLRNWEEQEIRFNDSEAARMSASARIREREQVFYDNDGDHRGDGHQDRESSMHQQRSDAYTMHQHRSGEDQSHEHRRDGRWSRGGRRHASTPRGAAATPNTPPGASPAASSNTPPVQPFTAQPTTPPAEQPTMPTGEPPTAPWGASRVKYEEDDAHWTDYLDYLSELSPEVPEDAA
>NZ_CP008944.1|WP_084168451.1|69151_70438_-|ROK-family-transcriptional-regulator
MRSRPETTPFARPQTPAAKCLHLIRLGGPTTRPQLIEATGLSQPTITRAVTALLNAGLIRPREDLTQVHGPGRPTTPLELAPFRPVLAGAAVGTETTYIGIYDAHGRRLRHSEIPVRVVDESAGDFLEHLVAGINRILARINRPLAAVGVTTSGRVDHRGLVTAPNLGWQAVDFTSTLRYHFDVPVTVTAATSAILGAETQLAPLPTDSDDTPATLAIFADDSVSAALARPGGVAQLDTLPHVTFPTPAVQPGGSTPADVRAAAASTSEKVRPDVRRTEDMLRTAPTSTEERLSTEGLMAQVAAAGHGSLTLTQVTERAGRNAHLRALLDARSRALAAVVGKLITKHRPHTVVLAGSAFTADEQAPRTFARAFHEEVGRGHDVDLRLIPGHRDIVLSIARAVALDKLLREPIAVADSAGANSTGAAAT
>NZ_CP008944.1|WP_038603982.1|70623_71424_-|NAD-dependent-deacylase
MSSAQLAAAIARAAELIRGATPADRPLEVEIFTGAGISADSGLSTFRDAETGLWSHVDPTALANIDAWERDPEPMWAWYLWRARLSLSAEPNPGHLTVARWQAEGPGHVHVTTQNIDNLHERAGAREVAHLHGSLFSFRCSRCAAPYNGVDAERDIPREPVERLTPPKCPRCGGIVRPGVVWFGEALPPQEWDAAEAAMRRADVVIIIGTSGVVYPAASLPLLAAQRGAVIIEVTPKPTELTPVATETLLTTAGIGLPALYQEVAG
>NZ_CP008944.1|WP_051866653.1|71569_73246_+|DUF885-domain-containing-protein
MSSPTCLSSAGEDSREPSLLDAACEAFAGDLAELSPTDATQWGIPGYDGELQDFSPEYWEALSERTREMIMDVDAFDEATDSSDDDEDFDDVDNVTAATLRDRLGVFLDKHHHAEDLRLLNVIESPVQIIRDSFLVMGHETREEREAVRSRLAQVPAALEGYRSSLSDAASHGLVAPLRQVDAVNSQCEDLADDGSILEQLGLDADSAEVTAAKEAFGQFADWLNEQLAPAAPHEDAVGRERFELFAHEHIGDEVDLDEAYRWSLERLRELRSQQEKVAEQLYGPGTSVRQAMHKLNQDEHYTIHGTGALVDWMQGVADQAIIHLDGSEFDVPDEIKTIECGIDPAGTGAIFYTPPSDDFARPGRMWWSVPEGQETFHMWQELSTVFHEGVPGHHLQLGVALAESSLNFWRRSVNWIAGHGEGWALYAEELMHELDMYEDPGFCMGLLDAQRLRAARVALDIGVHLCKKTPDGGVWDASYAKTFLRENTAMAEANLAFELDRLLGWPGQGSAYAIGEQLWRSLREDALAQGMSLGQFHNEALRRGSIPMSILREDLLD
>NZ_CP008944.1|WP_038603986.1|74628_77166_-|ATP-dependent-helicase-HrpB
MAYPFDLEKIGAGLPVAQSIPQIVRELRQSRRCIVEAPPGTGKTTLVPPAVANLVAEDAARGQKTGAPGRVIVTGPRRLAVRAAADRLRQLSAGSVGGTNTADTSAAITSDAARARKRHGLVGHRMHGDSVAGTAVEFVTPAVLVRMLLSDPALDGVSAIILDEVHERQLDTDLALAFAAELAELREDLYLLVMSATLPAEGFSRVLPGAPVVSTPAVTHPTEVSYHPHPGRMSTEPRRRAAFWAHLAQLADAAVARTGHSALVFAPGAREVDEVAYLCQTRAFRLHGRLSAAEQRAAMSEGSGPRVVVATSIAESALTVPGVRVVVDSGMSRVPRRDAERGMQGLVTVSETQATAEQRAGRAGREGPGLVLRAFSAQDYRHFDADITPEITTTELTQAALWMAEWGTPLGVGLKLLTPPPRAGLDTAGEVLLRLGAVEADGSITELGRRLARLPLDPRLGRALLALGEPAAEALAALAAGLPGDLARASAPRSEVRRLERLSWDASAACGAVHARSSGAGSARRNSAERTAGLAVALAYPERVARREGNTDQYLLAGGSRAQLPADLGLSGARWLAIGEVTRVGSPSSAGRAGATIRSAARIDEADALGSIGVTERYSVDWAASKLQARKVLSTGAIELSSTPTRVTAQQAAPAIAQAIAREGLELFAPSAKARALIERLRFLHAQVGAPWPDPAAVDPFGWLGPELDQLARGKSPGSIDLYPALQRLLPWPEATRLDELAPARLQVPSGSHPRVDYSTGVPVVRVKLQECFGLAQSPTCAGVPVQFRLLSPAGRDLAITSDLASFWAGPYHQVRSEMRGRYPKHPWPDDPWNAQATARTKRRS
>NZ_CP008944.1|WP_038603990.1|77293_78739_-|hypothetical-protein
MQLSRRMGALLATAAVAVSGIIAPAASADTFHDTYPETPKLNPALPIVHTTHGSDHLKANVLNPKPVCNSGEDYRTVVYKVTDNFSPAGTISATNKSKSTIPLTQNLSKSQSISISIKGDRTDQTSINLGGDVSKDGNSGSIGIAKTITEQVGGQFSYTLSWDTGQQIGPYDVPPGHTGEATYGFRTINLDGTQQYCRPNGTWSNPTPWRVLAPMKNEVEVKVYENASDSWLGNAHEATAAEEADPEVATDANPSVDPEVDTSVADTEVEDGTNASPEIVPETTIDPEGEKPAEGDRVLSDAEVAATADEDAPETVDPAVTEKQKLDLEPYFTVAAGKSPGFAGMVALRVKNVGEKRYYQDNMATRFRIDVHTAEGPEGVDRLITPGWFNGAYTRDLGFNEDQSIRSFEVVLSNAINPGETQLLANLKFGDGGTKLGRLKNYITVTQTGRIEGDHSEYNDQNVDSRQHTFDHMGRTNIGIF
>NZ_CP008944.1|WP_084168075.1|78987_79653_-|sugar-O-acetyltransferase
MTRNISGFDPDAFSSLERMRSGEWYLCTSEEFAAEQRRSAELVHELNQLGNTDPERARALIQKLTLAEHAEATVFAPAFIEFGAHVSLGPGVFINAGVTILSSAEVKIGARTMLGPNCQLITPTHPTDSVAMRRGGWERAAAIELGEDVWLGAGVTVLPGVTIGSGTTVGANSTVTKSLPENCVAVGTPARVVRRCDPQRAEAETRGLAPGVPIEPLSLFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

231698 : 247024

Erysipelothrix_phage(90.0%)

tail,terminase,capsid,head,holin,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038604129.1\|231698_232169_-\|holin	phage holin family protein	A0A2K5B2A2	Erysipelothrix_phage	4.4e-33	55.6
WP_038604131.1\|232261_232459_-	hypothetical protein	NA	NA	NA	NA
WP_038604133.1\|232451_232913_-	DUF1617 family protein	NA	NA	NA	NA
WP_038604135.1\|235926_236613_-	hypothetical protein	NA	NA	NA	NA
WP_038604137.1\|236612_239297_-	tape measure protein	A0A2K9V3J7	Faecalibacterium_phage	2.4e-38	38.3
WP_005295604.1\|239323_239500_-	hypothetical protein	NA	NA	NA	NA
WP_038604139.1\|239517_239928_-	hypothetical protein	A0A2K5B295	Erysipelothrix_phage	1.8e-30	54.9
WP_038604141.1\|239940_240537_-\|tail	phage tail protein	A0A2K5B294	Erysipelothrix_phage	5.6e-73	69.6
WP_038604143.1\|240555_240900_-	hypothetical protein	A0A2K5B293	Erysipelothrix_phage	3.5e-19	38.9
WP_038604145.1\|240896_241334_-	hypothetical protein	A0A2K5B292	Erysipelothrix_phage	1.6e-24	45.5
WP_038604147.1\|241302_241665_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_038604148.1\|241668_241983_-\|head,tail	phage gp6-like head-tail connector protein	A0A2K5B290	Erysipelothrix_phage	2.0e-29	60.0
WP_038604150.1\|242016_243237_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	3.1e-126	57.2
WP_038604152.1\|244089_245397_-\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	2.0e-168	71.2
WP_038604154.1\|245425_247024_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	6.2e-236	74.7

DBSCAN-SWA_2

253864 : 269071

Erysipelothrix_phage(38.46%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038604177.1\|253864_255115_-	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	7.0e-134	56.9
WP_038604179.1\|255086_256277_-	methionine adenosyltransferase	A0A2K5B278	Erysipelothrix_phage	1.8e-107	56.5
WP_038604181.1\|256367_256943_-\|terminase	terminase	A0A2K5B277	Erysipelothrix_phage	1.4e-49	53.4
WP_038604184.1\|257191_257569_-	HNH endonuclease	Q6UAS2	Klebsiella_phage	5.3e-13	37.5
WP_038604189.1\|258186_259548_-	DEAD/DEAH box helicase	A0A1W6JQF1	Corynebacterium_phage	3.7e-157	61.7
WP_038604190.1\|259528_259807_-	VRR-NUC domain-containing protein	A0A1S7FZ22	Listeria_phage	2.7e-14	45.6
WP_038604192.1\|259943_262208_-	primase C-terminal domain-containing protein	A0A1B0RXC5	Streptococcus_phage	8.3e-186	46.1
WP_038604194.1\|262204_262648_-	hypothetical protein	A0A2K5B270	Erysipelothrix_phage	7.1e-33	48.9
WP_038604196.1\|262644_263409_-	phage antirepressor KilAC domain-containing protein	A0A0A8WIE3	Clostridium_phage	2.2e-50	43.1
WP_038604199.1\|263651_264587_+	Abi family protein	NA	NA	NA	NA
WP_038607411.1\|264583_266545_-	DNA polymerase	A0A1W6JQ98	Corynebacterium_phage	4.1e-213	56.2
WP_038604201.1\|266544_267072_-	HNH endonuclease	B5U5I0	Mycobacterium_virus	2.1e-23	52.2
WP_051866687.1\|267151_267337_-	hypothetical protein	NA	NA	NA	NA
WP_038604205.1\|267357_267912_-	DUF2815 family protein	A0A2K5B2A9	Erysipelothrix_phage	1.0e-57	63.3
WP_038604207.1\|267937_269071_-	DUF2800 domain-containing protein	A0A1W6JQ97	Corynebacterium_phage	3.6e-121	59.8

DBSCAN-SWA_3

1878214 : 1885767

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038608455.1\|1878214_1880362_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.4e-206	51.3
WP_038606519.1\|1880434_1880863_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	R4JF54	Bacillus_phage	2.3e-12	35.5
WP_038606521.1\|1880968_1881202_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	4.9e-17	56.6
WP_005511141.1\|1881501_1881624_-	50S ribosomal protein L36	NA	NA	NA	NA
WP_038606523.1\|1881844_1882693_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.3e-75	54.3
WP_038608458.1\|1882689_1883454_-	fructosamine kinase family protein	NA	NA	NA	NA
WP_038606525.1\|1883450_1883903_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_144239963.1\|1884191_1884698_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.9e-13	41.2
WP_084168373.1\|1884741_1885767_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	1.0e-127	69.6

DBSCAN-SWA_4

2101174 : 2140814

Erysipelothrix_phage(51.61%)

tail,terminase,capsid,protease,head,holin,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038606883.1\|2101174_2101741_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	2.4e-73	71.0
WP_038606886.1\|2102154_2103726_-	recombinase family protein	Q6DMS5	Streptococcus_phage	3.7e-124	46.8
WP_038606889.1\|2103722_2104973_-	recombinase family protein	Q6DMS5	Streptococcus_phage	7.3e-59	41.6
WP_038606891.1\|2105019_2105229_-	hypothetical protein	NA	NA	NA	NA
WP_038606893.1\|2105761_2106574_-	N-acetylmuramoyl-L-alanine amidase	A0A1D8ETE4	Propionibacterium_phage	1.5e-60	61.3
WP_038606896.1\|2106576_2107032_-\|holin	phage holin family protein	A0A2K5B2A2	Erysipelothrix_phage	8.6e-34	52.3
WP_038606899.1\|2107123_2107345_-	hypothetical protein	NA	NA	NA	NA
WP_038606902.1\|2107341_2107764_-	DUF1617 family protein	A0A2K9VCL5	Lactobacillus_phage	1.0e-12	31.9
WP_038606905.1\|2107775_2110607_-\|tail	phage tail protein	A0A1B1P770	Bacillus_phage	1.4e-68	36.8
WP_038606907.1\|2110682_2111375_-	hypothetical protein	A0A1B0Y2S2	Lactobacillus_phage	2.4e-19	31.1
WP_038606910.1\|2111374_2113921_-	tape measure protein	A0A2K9V3J7	Faecalibacterium_phage	5.0e-38	37.6
WP_084168411.1\|2114177_2114795_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_169740224.1\|2114791_2114941_-	hypothetical protein	NA	NA	NA	NA
WP_038606913.1\|2114985_2115402_-	hypothetical protein	A0A2K5B295	Erysipelothrix_phage	1.7e-28	51.6
WP_038606915.1\|2115414_2116011_-\|tail	phage tail protein	A0A2K5B294	Erysipelothrix_phage	5.6e-73	69.6
WP_038606918.1\|2116023_2116368_-	hypothetical protein	A0A2K5B293	Erysipelothrix_phage	1.1e-20	38.5
WP_038606921.1\|2116364_2116802_-	hypothetical protein	NA	NA	NA	NA
WP_038606924.1\|2116794_2117133_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_038606927.1\|2117137_2117455_-\|head,tail	phage gp6-like head-tail connector protein	A0A2K5B290	Erysipelothrix_phage	3.2e-27	58.0
WP_038606930.1\|2117485_2118715_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	1.3e-129	58.6
WP_038606934.1\|2118729_2119599_-\|protease	Clp protease ClpP	A0A2K5B288	Erysipelothrix_phage	4.2e-53	60.6
WP_038608631.1\|2119595_2120897_-\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	2.8e-170	73.3
WP_144239925.1\|2120945_2121485_+	hypothetical protein	NA	NA	NA	NA
WP_038606936.1\|2121481_2123086_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	1.6e-239	76.2
WP_038608634.1\|2123115_2123403_-	hypothetical protein	NA	NA	NA	NA
WP_084168412.1\|2124170_2124377_-	cell division protein	NA	NA	NA	NA
WP_038606939.1\|2125134_2126538_-	DNA cytosine methyltransferase	A0A1P8DJM9	Virus_Rctr41k	2.3e-37	29.1
WP_038606942.1\|2126534_2127785_-	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	3.7e-135	57.2
WP_038606944.1\|2127756_2128947_-	methionine adenosyltransferase	A0A2K5B278	Erysipelothrix_phage	8.4e-105	54.0
WP_038606947.1\|2129029_2129602_-\|terminase	terminase	A0A2K5B277	Erysipelothrix_phage	4.4e-51	52.4
WP_038606949.1\|2129884_2130262_-	HNH endonuclease	A0A2H4PHY5	Pseudomonas_phage	4.2e-10	45.1
WP_084168543.1\|2130401_2130851_-	hypothetical protein	NA	NA	NA	NA
WP_038606953.1\|2130850_2132224_-	DEAD/DEAH box helicase	A0A1W6JQF1	Corynebacterium_phage	8.1e-160	62.1
WP_038608640.1\|2132204_2132483_-	VRR-NUC domain-containing protein	A0A2I7R067	Vibrio_phage	6.3e-11	38.6
WP_038606956.1\|2132618_2134880_-	primase C-terminal domain-containing protein	A0A1B0RXC5	Streptococcus_phage	1.2e-203	48.9
WP_038606959.1\|2134876_2135314_-	hypothetical protein	A0A2K5B270	Erysipelothrix_phage	2.9e-31	46.1
WP_038606961.1\|2135310_2136075_-	phage antirepressor KilAC domain-containing protein	A0A1Q1PVZ8	Staphylococcus_phage	1.7e-42	44.8
WP_038608643.1\|2136222_2136414_+	hypothetical protein	NA	NA	NA	NA
WP_038606964.1\|2136417_2138385_-	DNA polymerase	A0A2K5B2B0	Erysipelothrix_phage	1.8e-208	55.1
WP_038606967.1\|2138463_2139015_-	DUF2815 family protein	A0A2K5B2A9	Erysipelothrix_phage	6.1e-66	72.6
WP_038606970.1\|2139038_2140178_-	DUF2800 domain-containing protein	A0A1W6JQ97	Corynebacterium_phage	1.6e-124	62.0
WP_038606972.1\|2140164_2140572_-	hypothetical protein	NA	NA	NA	NA
WP_038608646.1\|2140568_2140814_-	hypothetical protein	A0A2I4R673	Erysipelothrix_phage	1.8e-06	47.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP008945

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1786 : 38878

Erysipelothrix_phage(65.52%)

capsid,holin,portal,terminase,head,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038606889.1\|1786_3037_-	recombinase family protein	Q6DMS5	Streptococcus_phage	7.3e-59	41.6
WP_038606891.1\|3083_3293_-	hypothetical protein	NA	NA	NA	NA
WP_038606893.1\|3825_4638_-	N-acetylmuramoyl-L-alanine amidase	A0A1D8ETE4	Propionibacterium_phage	1.5e-60	61.3
WP_038606896.1\|4640_5096_-\|holin	phage holin family protein	A0A2K5B2A2	Erysipelothrix_phage	8.6e-34	52.3
WP_038606899.1\|5187_5409_-	hypothetical protein	NA	NA	NA	NA
WP_038606902.1\|5405_5828_-	DUF1617 family protein	NA	NA	NA	NA
WP_038606905.1\|5839_8671_-\|tail	phage tail protein	A0A1B1P770	Bacillus_phage	1.4e-68	36.8
WP_038606907.1\|8746_9439_-	hypothetical protein	A0A1B0T6A0	Bacillus_phage	8.0e-23	33.2
WP_038606910.1\|9438_11985_-	tape measure protein	A0A2K9V3J7	Faecalibacterium_phage	5.0e-38	37.6
WP_084168411.1\|12241_12859_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_169740224.1\|12855_13005_-	hypothetical protein	NA	NA	NA	NA
WP_038606913.1\|13049_13466_-	hypothetical protein	A0A2K5B295	Erysipelothrix_phage	1.7e-28	51.6
WP_038606915.1\|13478_14075_-\|tail	phage tail protein	A0A2K5B294	Erysipelothrix_phage	5.6e-73	69.6
WP_038606918.1\|14087_14432_-	hypothetical protein	NA	NA	NA	NA
WP_038606921.1\|14428_14866_-	hypothetical protein	A0A2K5B292	Erysipelothrix_phage	4.6e-24	41.3
WP_038606924.1\|14858_15197_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_038606927.1\|15201_15519_-\|head,tail	phage gp6-like head-tail connector protein	A0A2K5B290	Erysipelothrix_phage	3.2e-27	58.0
WP_038606930.1\|15549_16779_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	1.3e-129	58.6
WP_038606934.1\|16793_17663_-\|protease	Clp protease ClpP	A0A2K5B288	Erysipelothrix_phage	4.2e-53	60.6
WP_038608631.1\|17659_18961_-\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	2.8e-170	73.3
WP_144239925.1\|19009_19549_+	hypothetical protein	NA	NA	NA	NA
WP_038606936.1\|19545_21150_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	1.6e-239	76.2
WP_038608634.1\|21179_21467_-	hypothetical protein	NA	NA	NA	NA
WP_084168412.1\|22234_22441_-	cell division protein	NA	NA	NA	NA
WP_038606939.1\|23198_24602_-	DNA cytosine methyltransferase	A0A1P8DJM9	Virus_Rctr41k	2.3e-37	29.1
WP_038606942.1\|24598_25849_-	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	3.7e-135	57.2
WP_038606944.1\|25820_27011_-	methionine adenosyltransferase	A0A2K5B278	Erysipelothrix_phage	8.4e-105	54.0
WP_038606947.1\|27093_27666_-\|terminase	terminase	A0A2K5B277	Erysipelothrix_phage	4.4e-51	52.4
WP_038606949.1\|27948_28326_-	HNH endonuclease	A0A2K5B276	Erysipelothrix_phage	1.3e-30	52.1
WP_084168543.1\|28465_28915_-	hypothetical protein	NA	NA	NA	NA
WP_038606953.1\|28914_30288_-	DEAD/DEAH box helicase	A0A1W6JQF1	Corynebacterium_phage	8.1e-160	62.1
WP_038608640.1\|30268_30547_-	VRR-NUC domain-containing protein	A0A2K5B272	Erysipelothrix_phage	7.1e-15	52.9
WP_038606956.1\|30682_32944_-	primase C-terminal domain-containing protein	A0A1B0RXC5	Streptococcus_phage	1.2e-203	48.9
WP_038606959.1\|32940_33378_-	hypothetical protein	A0A2K5B270	Erysipelothrix_phage	2.9e-31	46.1
WP_038606961.1\|33374_34139_-	phage antirepressor KilAC domain-containing protein	A0A1Q1PVZ8	Staphylococcus_phage	1.7e-42	44.8
WP_038608643.1\|34286_34478_+	hypothetical protein	NA	NA	NA	NA
WP_038606964.1\|34481_36449_-	DNA polymerase	A0A2K5B2B0	Erysipelothrix_phage	1.8e-208	55.1
WP_038606967.1\|36527_37079_-	DUF2815 family protein	A0A2K5B2A9	Erysipelothrix_phage	6.1e-66	72.6
WP_038606970.1\|37102_38242_-	DUF2800 domain-containing protein	A0A1W6JQ97	Corynebacterium_phage	1.6e-124	62.0
WP_038606972.1\|38228_38636_-	hypothetical protein	A0A2K5B2A7	Erysipelothrix_phage	1.5e-05	54.8
WP_038608646.1\|38632_38878_-	hypothetical protein	A0A2I4R673	Erysipelothrix_phage	1.8e-06	47.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP008944

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP008945

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection