CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP007718	Brucella suis bv. 3 str. 686 chromosome 2, complete sequence	1 crisprs	csa3,cas3,DEDDh	0	0	0	0
NZ_CP007719	Brucella suis bv. 3 str. 686 chromosome 1, complete sequence	1 crisprs	csa3,WYL	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007718_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007718_1

175595-175695

Orphan

Consensus_repeat	Method
ATGGACTTCTTGGAAGTCCATGCCGCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007718_1

>merge|NZ_CP007718|1|175595-175695|CRISPRCasFinder
ATGGACTTCTTGGAAGTCCATGCCGCCCCCGCGCCGCTTTGCGGCGCAGGCATTTAGTTCATGGGCGAGCTTTATGGACTTCTTAGAAGTCCATGCCGCCC

>NZ_CP007718|1|1|175595-175695|CRISPRCasFinder
ATGGACTTCTTGGAAGTCCATGCCGCCC	CCGCGCCGCTTTGCGGCGCAGGCATTTAGTTCATGGGCGAGCTTT
ATGGACTTCTTAGAAGTCCATGCCGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007718.1\|WP_004690017.1\|167689_169198_+\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|223202
NZ_CP007718.1\|WP_004690022.1\|180453_183372_+\|isoleucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237514
NZ_CP007718.1\|WP_002966383.1\|179120_180110_+\|bifunctional-riboflavin-kinase/FAD-synthetase	unknown	unknown	gnl\|CDD\|235536
NZ_CP007718.1\|WP_002966377.1\|187533_188097_+\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	unknown	unknown	gnl\|CDD\|223813
NZ_CP007718.1\|WP_002971287.1\|183563_184235_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007718.1\|WP_004692532.1\|164109_164937_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381357
NZ_CP007718.1\|WP_002967189.1\|166186_166843_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NZ_CP007718.1\|WP_004690016.1\|165212_165947_-\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|224294
NZ_CP007718.1\|WP_025198185.1\|174669_174924_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007718.1\|WP_004681424.1\|166961_167579_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP007718.1\|WP_005971898.1\|169206_170337_+\|ATP-phosphoribosyltransferase-regulatory-subunit	unknown	unknown	gnl\|CDD\|183413
NZ_CP007718.1\|WP_002966379.1\|185193_185667_-\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NZ_CP007718.1\|WP_002966390.1\|173128_174520_-\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
NZ_CP007718.1\|WP_004690023.1\|184579_185140_+\|cytochrome-b	unknown	unknown	gnl\|CDD\|225580
NZ_CP007718.1\|WP_006073322.1\|178184_179033_+\|TIGR01459-family-HAD-type-hydrolase	unknown	unknown	gnl\|CDD\|319827
NZ_CP007718.1\|WP_002966391.1\|172624_173026_-\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|225168
NZ_CP007718.1\|WP_014315905.1\|185807_187553_+\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
NZ_CP007718.1\|WP_004690018.1\|170333_171029_+\|ATP-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|237438
NZ_CP007718.1\|WP_002966386.1\|177407_177704_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NZ_CP007718.1\|WP_004692520.1\|188182_189727_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685

Protein	Function_ID	Function_description	E-value
NZ_CP007718.1\|WP_004690017.1\|167689_169198_+\|histidine--tRNA-ligase	gnl\|CDD\|223202	COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis].	6.87005e-159
NZ_CP007718.1\|WP_004690022.1\|180453_183372_+\|isoleucine--tRNA-ligase	gnl\|CDD\|237514	PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional.	0
NZ_CP007718.1\|WP_002966383.1\|179120_180110_+\|bifunctional-riboflavin-kinase/FAD-synthetase	gnl\|CDD\|235536	PRK05627, PRK05627, bifunctional riboflavin kinase/FAD synthetase.	2.77791e-157
NZ_CP007718.1\|WP_004692532.1\|164109_164937_-\|aldo/keto-reductase	gnl\|CDD\|381357	cd19131, AKR_AKR5C2, Escherichia coli 2,5-diketo-D-gluconic acid reductase A (DkgA/YqhE) and similar proteins. Escherichia coli DkgA/YqhE is a founding member of aldo-keto reductase family 5 member C2 (AKR5C2). DkgA/YqhE (EC 1.1.1.274), also called 2,5-DKG reductase A, or 2,5-DKGR A, or 25DKGR-A, or AKR5C, catalyzes the reduction of 2,5-diketo-D-gluconic acid (25DKG) to 2-keto-L-gulonic acid (2KLG). It is also capable of stereoselective -keto ester reductions on ethyl acetoacetate and other 2-substituted derivatives.	8.73712e-178
NZ_CP007718.1\|WP_006073322.1\|178184_179033_+\|TIGR01459-family-HAD-type-hydrolase	gnl\|CDD\|319827	cd07525, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The haloacid dehalogenase-like (HAD) hydrolases are a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members include 2-L-haloalkanoic acid dehalogenase (C-Cl bond hydrolysis), azetidine hydrolase (C-N bond hydrolysis); phosphonoacetaldehyde hydrolase (C-P bond hydrolysis), phosphoserine phosphatase and phosphomannomutase (CO-P bond hydrolysis), P-type ATPases (PO-P bond hydrolysis) and many others. Members are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.96029e-90
NZ_CP007718.1\|WP_002967189.1\|166186_166843_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	3.88001e-109
NZ_CP007718.1\|WP_004690016.1\|165212_165947_-\|L,D-transpeptidase	gnl\|CDD\|224294	COG1376, ErfK, Uncharacterized protein conserved in bacteria [Function unknown].	2.71429e-59
NZ_CP007718.1\|WP_004681424.1\|166961_167579_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.14786e-45
NZ_CP007718.1\|WP_005971898.1\|169206_170337_+\|ATP-phosphoribosyltransferase-regulatory-subunit	gnl\|CDD\|183413	PRK12295, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional.	1.01993e-156
NZ_CP007718.1\|WP_002966377.1\|187533_188097_+\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	gnl\|CDD\|223813	COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair].	1.21532e-78
NZ_CP007718.1\|WP_002966390.1\|173128_174520_-\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
NZ_CP007718.1\|WP_004690023.1\|184579_185140_+\|cytochrome-b	gnl\|CDD\|225580	COG3038, CybB, Cytochrome B561 [Energy production and conversion].	1.46443e-52
NZ_CP007718.1\|WP_002966379.1\|185193_185667_-\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	5.96751e-65
NZ_CP007718.1\|WP_002966391.1\|172624_173026_-\|DoxX-family-protein	gnl\|CDD\|225168	COG2259, COG2259, Predicted membrane protein [Function unknown].	2.4232e-20
NZ_CP007718.1\|WP_014315905.1\|185807_187553_+\|pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	4.94723e-82
NZ_CP007718.1\|WP_004690018.1\|170333_171029_+\|ATP-phosphoribosyltransferase	gnl\|CDD\|237438	PRK13583, hisG, ATP phosphoribosyltransferase.	1.83362e-134
NZ_CP007718.1\|WP_002966386.1\|177407_177704_-\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	5.80408e-54
NZ_CP007718.1\|WP_004692520.1\|188182_189727_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	1.49669e-117

>NZ_CP007718.1|WP_025198185.1|174669_174924_-|hypothetical-protein
MRKELPIETAPKDGRKITVIWIDDDDQRNESIAQYRTLEQLRAGGGQWDEADTGWWTFTDSKTQRKIEPTAWIREIDDDESQED
>NZ_CP007718.1|WP_002966390.1|173128_174520_-|class-II-fumarate-hydratase
MAATRTETDTFGPIDVPADRYWGAQTQRSLQNFRIGGERMPLPLVHALGVVKRAAAETNIALGKLDPVLGQVIAVAASEVIEGKLDDHFPLVVWQTGSGTQSNMNANEVISNRAIELLGGEMGSKKPIHPNDHVNMSQSSNDSFPTAIHIATAVETVNRLYPALEHLTKALKVKEEAFKDIIKIGRTHTQDATPVTLGQEFSGYRAALEYARHRLEQSLADVFLLAQGGTAVGTGLNAPVGFDKGFAEAVSEITGLSFKTAPNKFEALASHGAVLNFHGSLNALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQAEAMTMVATQVFGNQTAVTVAASQGHFELNVFKPVIAYNVLQSIRLLSDTMVSFADHCVEGIEPNTARIKELLERSLMLVTALAPAIGYDNAARIAKTAHKNGTTLREEALASGLVSEEDYDRLVRAERMIAPQ
>NZ_CP007718.1|WP_002966391.1|172624_173026_-|DoxX-family-protein
MSSITPKANGAATLIIRVFLSVLFIIAGYNKLTALDGTADYFASIGLPMPIVTAVVVGLIEFVGGLAILFGFKTRIAAVIVGLFTLGATLVAHMDFAEGMNLLIAQKNLAIAGGLFLLFLHGAGSLSIDARRG
>NZ_CP007718.1|WP_004690018.1|170333_171029_+|ATP-phosphoribosyltransferase
MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEGEDDLDILFLSASEIARELGYGSVDLGVTGEDLARETLAHADERVAIEAQLGFGHADVVVAVPEVWRDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVESLGATEGAPAAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTSRRVEEIAARIRAGLEI
>NZ_CP007718.1|WP_005971898.1|169206_170337_+|ATP-phosphoribosyltransferase-regulatory-subunit
MVGSRTSPIFNALRVELNAREAELVEIPLIQPADPFLDMAGEDLRRRIFLTENENGDSLCLRPEFTIPVCRNHIALNAATPKRYAYLGEVFRQRRDGAAEFLQAGIEDLGAADEAASDARSLADALSCVKAIAPDAPLEIVLGDQSVFAGMLKALGLPQGWRKKLLRSFGDAHSMDLALAELTGTQRRDPLPESLAVLVAEGDEIGLARMLEAEMLEAGISPGAGRTPVEIARRLIEKEDLAATHFPAAALDLLRQFLAIRVSLDTAAVTLRAFAADNALDLGAVLQKFEARADAIAQAGIEMKDIIYDASFGRPLDYYTGLVYEIRDASNRQDGVLAGGGRYDRLLTMLGACEAIPGVGFSIWLDRLQALAGEKQ
>NZ_CP007718.1|WP_004690017.1|167689_169198_+|histidine--tRNA-ligase
MADKADKMKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFLPDQDRPNEGVFSFQDDDEQWLSLRYDLTAPLARYVAENFETLPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDADTVGAPNVSADAEMCMMMADTLERLGIQRGDYAIRVNNRKVLDGVLDAIGLEGEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGKGRLDESGDFTKGAQLPEAAIEKVLAFTAAGGADGAQTIANLQAVVAGNAEGEEGVQELADMQALFFAGGYEGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGGGRYDGLVSRFRGEPVPATGFSIGVSRLMTALKNLGKLDVSDTVGPVVVLVMDKDTQNLGRYQKMVSDLRKAGIRAEMYVGGSGMKAQMKYADRRAAPCVVIQGSQEREAGEVQIKDLVEGKRLSAEIEDNVTWRESRPAQITVREDGLVDAVREILDAQARDRAEQSK
>NZ_CP007718.1|WP_004681424.1|166961_167579_+|LysE-family-translocator
MDLMSLVAFAGILVVAAGTPGPNVGALVARVISRGHKGVFPFMFGLWLGDAVWLSLAVWGLSALAHTFQTAFLVLKYAGVAYLIYLSWKMWFAPVDEEADENTIPRQGEGKRLFLSALGVTLGNPKIMVFYLAILPTVVDITHVSLTGWVELLLVMFMVLAAVDTAWVVLAAQARKFLRSPRMMRLANRTSAGMMAGAAVAIAAR
>NZ_CP007718.1|WP_002967189.1|166186_166843_+|DNA-3-methyladenine-glycosylase-I
MSDMAEARAGLVVGADGRTRCFWPGELPDYLAYHDNEWGVPVADDFRLFEKICLEGFQSGLSWLTILRKRENFRAAFDGFNFHRIATYDESDVERLLADKGIVRHRGKIVSVINNAGRAIELIEEKGSLAAYFWSFEPGAENRPAVVDYPTLVANPITATSTRISKDLKKRGWSFVGPTTVYAFMQAMGLVNDHIEGCHCRATIEKLRQNFKRPGKKL
>NZ_CP007718.1|WP_004690016.1|165212_165947_-|L,D-transpeptidase
MKPRHLLLIGSLTAIAVSIVSTGMAFADDRYSDLPPVRVSQAISAPWVAQLQDAPARPRIARRETRKTKTHYNKVSYQRPATNPATTARKKQFDPIYLPQIVSYSGKEKPGTIVIDTASRFLYLVQADGKARRYGVGVGKQGFSWKGTQRISRKAEWPTWTPPSEMIARERKKGRFLPARMDGGINNPLGARALYLGSTLYRIHGTNQPWTIGKAMSSGCIRMRNEDVTDLYERTPVGTRVVVR
>NZ_CP007718.1|WP_004692532.1|164109_164937_-|aldo/keto-reductase
MTVPTVKLNDGNHIPQLGYGVWQISNDEAVSAVSEALKAGYRHIDTATIYGNEKGVGKAINGSGIARADIFLTTKLWNSDQGYESTLKAFDTSLKKLGTDYVDLYLIHWPMPSKDLFMETWRAFIKLKEEGRVKSIGVSNFRTADLERLIKESGVTPVLNQIELHPQFQQDELRLFHGKHDIATEAWSPLGQGKLLEDPTLKSIAEKHAKSVAQIILRWHIETGNIVIPKSITPARIKENFDIFDFTLNGTDHDAITKLDMADGRIGPNPSVFSA
>NZ_CP007718.1|WP_002966386.1|177407_177704_-|co-chaperone-GroES
MADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVVAAGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG
>NZ_CP007718.1|WP_006073322.1|178184_179033_+|TIGR01459-family-HAD-type-hydrolase
MILPERLDDLTDRYDAIFCDVWGVVHNGETSFAPAIAALQRARAKGVTIILVTNSPRPHPGVVAQMSLLGVPENAYDRVVTSGDVTRDLIAEGPRRIFHIGCERELAIYDGLDVELVEEFEAAGVVCTGLYDDEVETPEDYRELLQRLRSRNLPFICANPDIMVERGPRLIWCAGALAREYGQLGGRTLIAGKPHRPIYEAALRAVESIRGGSVDKSRILGIGDGVLTDVKGAADFGLDVLYISGGVHAADYAVNGDLDMAKMEAFLEKHGHRPIASLHALV
>NZ_CP007718.1|WP_002966383.1|179120_180110_+|bifunctional-riboflavin-kinase/FAD-synthetase
MKKSSFQRLTGTEGLPPALHDCVVAIGNFDGVHRGHQAVLERALELAERESRPAVVLTFEPHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVMEQPFTAEFSQRSAEDFVQHILVEKLRASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDAFTDEGGMLVSSTRIRNLLSEGEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMALAPQTSLKHGIYAVRFRLDDAMLYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGKTAAVSFFGFLRGEVKFDGLDPLIDQMKQDEAQARALLADVRPISGLDRMLSFN
>NZ_CP007718.1|WP_004690022.1|180453_183372_+|isoleucine--tRNA-ligase
MTDTTKIDYSKTLYLPQTEFPIRAGLPQREPLFVQRWEEMNLYKKLREQAKDRPLYVLHDGPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDCHGLPIEWKIEEKYRAAGKNKDEVPINEFRKECREFASNWIKVQTEEFKRLAILGDFENPYTTMNFHAEARIAGELLKFAASGQLYRGSKPVMWSVVERTALAEAEVEYHDIESDMIWVKFPVAGEVATENDLSGSAVVIWTTTPWTIPGNRAVSYSSRIEYGLFEITKAENDFGPRPGERLVFADKLVEECCAKAKLQFKRLRSVSAEELGKIVLDHPLKGFGGGYEFVVPMLDGDHVTDDAGTGFVHTAPSHGREDFEAWMDNARQLEARGIDPNIPFPVGDDGFYTKDAPGFGPDREGGPARVIDDNGKKGDANKVVIEQLIAADKLFARGRLKHSYPHSWRSKKPVIFRNTPQWFVYMDKNLGDGTTLRSRALKAIDETRFVPAAGQTRLRSMIEGRPDWVLSRQRAWGVPICVFVDEEGNILQDDAVNKRIMDAFEKEGADAWFADGARERFLGARAGEGWTQVRDILDVWFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCGTRGRAPYNAVVTHGFTMDEHGKKMSKSLGNTVTPQDVIKESGADILRLWVMTTDYWEDQRLGKSIIQTNIDAYRKLRNTIRWMLGTLAHDEGENVAYADLPELERLMLHRLTELDELVRSGYDTFDFKRIARALVDFMNVELSAFYFDIRKDALYCDAPSSIRRKAALQTVREIFVRLTTWLAPMLPFTMEEAWLDRYPQSVSIHAEQFRPTPAEWRDDVLAEKWRKVRAVRRVVTGALELERADKRIGSSLEAAPVVYIADKSLSDSLEGLDFAEICITSGISVSDAAAPEGAFTLGDVKGVAVVPERAKGEKCARSWRYTTDVGADPEFPEVSARDAAALRELQALGKL
>NZ_CP007718.1|WP_002971287.1|183563_184235_+|hypothetical-protein
MKIEGRVLVLMTALAGLSLSGCVSSPTYGTDKSAGAQLLDDVSNMASFGQGKKKERIDYKPRPDLVRPAPGDKGYLPAPQQSLASSSDPNWPESPEQRRKRVRDEITAHRDDPNYVSPVLQDAPVADNIRTALPRGNSRREDYASRTPTSDPAKVAALKAARAQQNQGSATTRRYLSEPPLAYRQPASTAAVGELGPDEAQKERERKKAASGSRGWRDYLPWN
>NZ_CP007718.1|WP_004690023.1|184579_185140_+|cytochrome-b
MSSKTYIWDDRSGYGLVSRGFHWLMALLFLWQFASAILRVFAKDTPIYSFFWSAHFQLGFALLVLALLRGVWGLMNIHRRPHKDGAIGKLAVLGHLAIYVLMITIPSLALLRAYGSGCGFSFLGMPIFAKTDIQNAMLTAPANALHGPLGWVLLAAIVGHVAMALVHHFALRDDTLRYMTGHGTPN
>NZ_CP007718.1|WP_002966379.1|185193_185667_-|nucleoside-deaminase
MRKAASITKANSATPMDIALEEAHAAGERGEVPIGAVIVRDGEIIARAGNRTREFNDVTAHAEILTIRQAGEMLGSERLIDCDLYVTLEPCAMCAAAISFARIRRLYYGASDPKGGGIEHGGRFYTQPTCHHAPEIYPGFCEADARKILKDFFREKR
>NZ_CP007718.1|WP_014315905.1|185807_187553_+|pseudouridine-synthase
MMAQGDAVTLLKGLYQMTTEDDNKGGKPPHGRKGHSDRPGRPDRDSRPRREGGDRDKPRKFGSRGAPVEEETSERIAKRLARAGIASRREAETMIATGRIAVNGKVLESPAVNVKRTDIITVDGKPLRQTERTRLWLYHKPAGLVTTNRDPEGRPTVFEALPPEMPRVLSVGRLDINTEGLLLLTNDGGLSRVLELPSTGWLRRYRVRAHGKVTQQQLDELKNGIAVDGVFYGSVEAELERVQGANVWISIGLREGKNREVKNILGALGLTVGRLIRVSFGPFQLGDLEEGAVREIKGRTLRDQLGDKLIEESGADFDAPVLNEFSNAAVQGRTRREMEEGELPQEGERRRAPREREWISSTGERRRGREEKTEKVEPRRRGNANVWMAPGARPKGEKEAAKPARVEHQQPHRSAKFSGDLQMRPRRFSEEERGGEESGERRYKRPEGRFEREGGRPDNREKYEKHEGAGKERRPGKRERAELRNAEGQTTERGKGGFEGRKPGKPGGPRSEGRFGGADRDTRSGPRGSGPRGAGDGPRRGHDGKPGGKPGGKPTGRPGGKPGTKPGGGGRSGGGGADRRR
>NZ_CP007718.1|WP_002966377.1|187533_188097_+|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD
MRIVGGKFRGRALVTPSTNAIRPTTDRTRESLFNILAHSFPDKVEGVRVLDLFAGTGALGLEALSRGARYATFVEESAEGRGILRQNIEALGLQGHTKILRRDACQLGIVGTMEPFDLVFADPPYGRRMGEKAFLSALQGGWLNPDALLVLEEDAQAALELDDRFAVREERNYGGTVIRLIELKAAS
>NZ_CP007718.1|WP_004692520.1|188182_189727_+|insulinase-family-protein
MNNPSLRRLLLSTVLGFALALPLAGGAVRAEMQPAAPAETQPAPAAPAAPVAQAALPEISRLDGVSNFTLPNGMQVVVIPDHRAPVVTQMVWYHVGAADEAPGVSGIAHFLEHLMFKGTKNHPAGEFSARIASIGGQENAFTSYDYTAYFQRVSPEALEMVMDFESDRMENLVLDEEAVKTEREVILEERRMRIDSNPGAMLMENTDAVLFYNHPYRKPVIGWQQEMEKLSLKNAIDFYNQYYTPNNATLVIAGDVTPERVRELAMKTWANVHKRAEVLLRERPQEPAKHAARVVTLHDERVSTPSFRISWLVPSYANEKRFANVKPGDAPALDLLSEILGGSQLSRLYQQLIVKQGIAAETGASYDGDALDDGTFSVYGVPRNGASLGDVEKAVAAQVDRIIRDGVTQAELDQARNRFLKAVIFARDSQTGMARIYGSALSVGQTVDDIQKWPDLIKSVTVDQIKDVVRRYLVKDQAVTSYLLPPDTEAESARKKPNAPANDASASGAGGAIQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007719_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007719_1

1636599-1636683

Orphan

Consensus_repeat	Method
GCATCCCGAAAAGTGCGAAGCGGTTTTCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007719_1

>merge|NZ_CP007719|1|1636599-1636683|CRISPRCasFinder
GCATCCCGAAAAGTGCGAAGCGGTTTTCGGATAAGATGCGCGCAAGGAAAGATCTGCATCCCGAAAAGTGCGAAGCGGTGTTCGG

>NZ_CP007719|1|1|1636599-1636683|CRISPRCasFinder
GCATCCCGAAAAGTGCGAAGCGGTTTTCGG	ATAAGATGCGCGCAAGGAAAGATCT
GCATCCCGAAAAGTGCGAAGCGGTGTTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007719.1\|WP_040118683.1\|1627751_1628855_-\|porin	unknown	unknown	gnl\|CDD\|308243
NZ_CP007719.1\|WP_002967515.1\|1626551_1627478_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NZ_CP007719.1\|WP_002963787.1\|1631625_1631808_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007719.1\|WP_002963791.1\|1636111_1636588_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NZ_CP007719.1\|WP_002963792.1\|1636724_1637396_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381681
NZ_CP007719.1\|WP_004690700.1\|1639040_1641293_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_CP007719.1\|WP_002963786.1\|1630928_1631570_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007719.1\|WP_002966733.1\|1646987_1647563_+\|DUF2062-domain-containing-protein	unknown	unknown	gnl\|CDD\|225757
NZ_CP007719.1\|WP_004690698.1\|1637426_1638002_-\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350235
NZ_CP007719.1\|WP_006132452.1\|1646155_1646938_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP007719.1\|WP_006132439.1\|1629696_1630785_+\|porin	unknown	unknown	gnl\|CDD\|308243
NZ_CP007719.1\|WP_004690691.1\|1625055_1626189_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|181255
NZ_CP007719.1\|WP_004690694.1\|1632606_1634664_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381604
NZ_CP007719.1\|WP_004690695.1\|1635139_1636021_+\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
NZ_CP007719.1\|WP_004690699.1\|1638398_1638800_+\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|234744
NZ_CP007719.1\|WP_002971509.1\|1631887_1632544_+\|endonuclease	unknown	unknown	gnl\|CDD\|237082
NZ_CP007719.1\|WP_004690702.1\|1642038_1642794_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|236494
NZ_CP007719.1\|WP_004690703.1\|1643174_1644509_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|237356
NZ_CP007719.1\|WP_004690701.1\|1641300_1641879_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|273579
NZ_CP007719.1\|WP_004690704.1\|1644692_1645904_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031

Protein	Function_ID	Function_description	E-value
NZ_CP007719.1\|WP_040118683.1\|1627751_1628855_-\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	3.54449e-103
NZ_CP007719.1\|WP_002971509.1\|1631887_1632544_+\|endonuclease	gnl\|CDD\|237082	PRK12373, PRK12373, NADH-quinone oxidoreductase subunit E.	2.3845e-28
NZ_CP007719.1\|WP_002963791.1\|1636111_1636588_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	1.57135e-88
NZ_CP007719.1\|WP_002963792.1\|1636724_1637396_-\|uracil-DNA-glycosylase	gnl\|CDD\|381681	cd10031, UDG-F5_TTUDGB_like, Uracil DNA glycosylase family 5, includes Thermotoga maritima TTUDGB and similar proteins. Uracil DNA glycosylase family 5 includes Thermus thermophilus HB8 TTUDGB (also called UDGb) which is not only a UDG acting on double-stranded uracil-containing DNA, but also a hypoxanthine DNA glycosylase acting on double-stranded hypoxanthine-containing DNA (except for the C/I base pair), as well as a xanthine DNA glycosylase acting on both, double-stranded and single-stranded xanthine-containing DNA. TTUDGB also excises thymine from G:T mismatched DNA, and removes analogs of uracil from DNA, including 5-hydroxymethyluracil (hmU) and 5-fluorouracil (fU). This subfamily also contains Bradyrhizobium diazoefficiens family 5 homolog Blr5068 (UdgB) which has been found to efficiently excise uracil from ssDNA and dsDNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Similar to family 4 UDGs, members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	7.75632e-104
NZ_CP007719.1\|WP_004690700.1\|1639040_1641293_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NZ_CP007719.1\|WP_002966733.1\|1646987_1647563_+\|DUF2062-domain-containing-protein	gnl\|CDD\|225757	COG3216, COG3216, Uncharacterized protein conserved in bacteria [Function unknown].	5.43979e-83
NZ_CP007719.1\|WP_004690698.1\|1637426_1638002_-\|NYN-domain-containing-protein	gnl\|CDD\|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	5.09849e-62
NZ_CP007719.1\|WP_006132452.1\|1646155_1646938_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.86834e-33
NZ_CP007719.1\|WP_006132439.1\|1629696_1630785_+\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	1.52358e-117
NZ_CP007719.1\|WP_004690691.1\|1625055_1626189_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|181255	PRK08153, PRK08153, pyridoxal phosphate-dependent aminotransferase.	0
NZ_CP007719.1\|WP_004690694.1\|1632606_1634664_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381604	cd13401, Slt70-like, 70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	2.26681e-60
NZ_CP007719.1\|WP_004690695.1\|1635139_1636021_+\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	8.83567e-177
NZ_CP007719.1\|WP_004690699.1\|1638398_1638800_+\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|234744	PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed.	7.28537e-25
NZ_CP007719.1\|WP_002967515.1\|1626551_1627478_-\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.4048e-42
NZ_CP007719.1\|WP_004690702.1\|1642038_1642794_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|236494	PRK09391, fixK, transcriptional regulator FixK; Provisional.	1.05854e-49
NZ_CP007719.1\|WP_004690703.1\|1643174_1644509_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|237356	PRK13347, PRK13347, coproporphyrinogen III oxidase; Provisional.	0
NZ_CP007719.1\|WP_004690701.1\|1641300_1641879_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|273579	TIGR01367, Orotate_phosphoribosyltransferase, orotate phosphoribosyltransferase, Thermus family. This model represents a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori, Mesorhizobium loti, and related species. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	2.23835e-75
NZ_CP007719.1\|WP_004690704.1\|1644692_1645904_-\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.34906e-107

>NZ_CP007719.1|WP_002963791.1|1636111_1636588_+|SsrA-binding-protein-SmpB
MNKPKNSPARKMIAENRKARFNFEILDTLEAGLVLTGTEVKSLRANQANIAESYASFEDGEFWLINSYIPEYTQGNRFNHEPRRLRKLLVSRREMSRLFNSVSREGMTVVPLKLYFNDRGRAKLELALARGKKTHDKRETEKKRDWNREKARLLRDRG
>NZ_CP007719.1|WP_004690695.1|1635139_1636021_+|4-hydroxy-tetrahydrodipicolinate-synthase
MLKGSITALVTPFDREGAFDEKAFRAFVNWQIEEGTKGLVPVGTTGETPTLSHDEHKRVIEVCIEVAAGRVPVIAGAGSNNTVEAIELAQHAEKAGADAVLVVTPYYNKPNQRGLYEHFSRVVRSISIPLVIYNIPGRSIIDMTPETMGALVRDCKNIVGVKDATGKIERVSEQRAICGKEFIQLSGEDATALGFNAHGGVGCISVTSNIAPRLCAEFQEACQAGNFAKALELQDRLMPLHKALFLEPNPSGPKYALSRLGRIENVLRSPMVTIEAATAEKIDHAMKHAGLIN
>NZ_CP007719.1|WP_004690694.1|1632606_1634664_-|lytic-transglycosylase-domain-containing-protein
MVSLAQSSLPPEIPTPLARPFAPTTTHQSPISLVTPRPRPIAPDPMATSAVSRTDNPAVIGGTLKNGLDALSAKNVASAIASRNNLPRGSLDRQILTWAIATSGMDGVPSTEIAAAASELSGWPGMATLRRNSERALFKENPSSATIIATFGSTRPQTTEGMIALARAYVATGNSTKAHQLLSPWWTRKRLSSDDEQKILKEFSAILTREDHQRRLLHSLYNGRLQSARLLAGPAQAQSLYNAYAAVAQKSPNAASAIAAVDRSWQANPVYQFLKIRYLRRAERYNEAAELLLKAPRKASVLVDPDAWWVERRILSRELLDLGKPQLAYRLAAAHAAETPTMAAEAEFHAGWYALRALNQPKLAAPHFAKITQISARPISASRAYYWLGRAAEAGSGGDARAYYRRSAHFGTTFYGQLAAAKLNEKAPELAYPKPTEAERVRFASRPAVQAIKRLEQVGYGNKAAALYTQLSQELDSVGELALLAVMAERNDNHYMALRVGKTAAMRGLDVGALSHPLGAIPASANIKGSGKALAYAIARQESEFNVSAVSKAGARGLLQLMPATAKTVATRNGMSFSAQKLTADAAYNATLGAHFLGEQLDRFNGSYVLTFAGYNAGPRRASEWVEKYGDPRGKSVEQVVDWIERIPYSETRNYVQRVMENYEVYKTRLTGRADIKTDLVYGRR
>NZ_CP007719.1|WP_002971509.1|1631887_1632544_+|endonuclease
MPLLIVQLAILIAVAFVVGCFLGRILRRRKSAGSDHERTIVAAALSTPPLAEKPEPVPPAEPVRADSDPLKRKAGLEKARIEPVEGSADSDVAAAPVLQKVPAETPDDAGRPQWREAPRRGKADELTAIEGIGKAIEAVLHELGIFHYDQIAQWTREEAIWIERRIGFPGRVEREGWIAQAAKLAEPPAKSTTKRGAKTKKAANNVRSGTRRAKKQAG
>NZ_CP007719.1|WP_002963787.1|1631625_1631808_+|hypothetical-protein
MTVFPIRPFLCYDYSAKGLKCLAKYYAESLMLYLVETFWPVLVLAILIGAATGWLTAGER
>NZ_CP007719.1|WP_002963786.1|1630928_1631570_+|hypothetical-protein
MKKWFWPCLTWTACLTALALWFGADRVETDIAEQTAKALEPYVWAGFYVDGRDVVLKGMAPDPDMQRAAHAALEHVWAIRDITDLTTVLQLASPYRFKIGRNAQGLVLSGFIPNNESRDQVMTAAGEVAPDIFIDDEMAVARGNQPEFMERVLFAIDLAKKLPEAEIEIVDEKLSIRGTVSDEAIYDEIEALKAAQLPYGLKLAVLDVKKSVQ
>NZ_CP007719.1|WP_006132439.1|1629696_1630785_+|porin
MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYGAGYFYIPGTETCLRVHGYVRYDVKGGDDVYTGSDRKGWDKSARFALRVSTGSETELGTLKTFTELRFNYAANNSGVDGKYGNETSSGTVMEFAYIQLGGLRVGIDESEFHTFTGYLGDVINDDVISAGSYRTGKISYTFTGGNGFSAVIALEQGGDNDGGYTGTTNYHIDGYMPDVVGGLKYAGGWGSIAGVVAYDSVIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQNYGQWGGDWAVWGGLKYQATQKAAFNLQAAHDDWGKTAVTANVAYELVPGFTVTPEVSYTKFGGEWKNTVAEDNAWGGIVRFQRSF
>NZ_CP007719.1|WP_040118683.1|1627751_1628855_-|porin
MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYGAGYFYIPGTETCLRVHGYVRYDVKGGDDVYTGSDRKGWDKGARFALMFNTNSETELGTLGTYTQLRFNYTSNNSRHDGQYGDFSDDRDVADGGVSTGTDLQFAYITLGGFKVGIDESEFHTFTGYLGDVINDDVVAAGSYRTGKIAYTFTGGNGFSAVIALEQGGEDVDNDYTIDGYMPHVVGGLKYAGGWGSIAGAVAYDPVIEEWATKVRGDVNITDRFSVWLQGAYSSAATPNQNYGQWGGDWAVRGGAKFIATEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTITPEVSYTKFGGEWKDTVAEDNAWGGIVRFQRSF
>NZ_CP007719.1|WP_002967515.1|1626551_1627478_-|site-specific-integrase
MIIVGETKIDTGDKYAPIIDYNLNYISGKNPKHRLVEHYSVAELTAKYINILWDDGSHKYNVRSFLGEIDEILKGARFSGFDQEMLDSIIGTLRERGNSNATINRKMAALSKLLRKAHKMGDIFNLPEFIRQKERVGRIRFLEQEEEKRLFAAIKSRCEDSYRLSVFLVDTGCRLGEAIGLTWNDIQEQRVTFWVTKSNRSRTVPLTRRARKASHIPRERLKGPFSMLNQVRFRQIWNEAKAEVGLGADDQIVPHILRHTCASRLVRGGIDIRRVQMWLGHQTLQMTMRYAHLATHDLDSCVKVLEIH
>NZ_CP007719.1|WP_004690691.1|1625055_1626189_-|pyridoxal-phosphate-dependent-aminotransferase
MAQPRLTPLVESLPSTVPFIGPETLELQRGKPFKARIGANESSFGPAPSVIEAMRNEATEVWKYGDPENYALRHAIAAHHGLKAEHIMPGAGVDALLGLIVRQYVQQGDKVINSLGGYPTFNYHVAGYGGQLVTVPYRDDKPDLDALIDAAAREKPALLYIANPNNPMGTWHEGADIQSFIERLPETTLLILDEAYCETAPASAFPPFETDRPNVLRMRTFSKAYGLAGIRCGYAVGNPVAIKTFDKVRDHFAVSRMAQAAAIAALKDQAYLHEVVGKICAGRDRIAAIAEANGLHAVASATNFVAIDCGRGKDFAQAVLNGLISRDIFVRKPGTPVLDRCIRVSVGVKEQLDQFEAAFPEALEEARKICAANAENT
>NZ_CP007719.1|WP_002963792.1|1636724_1637396_-|uracil-DNA-glycosylase
MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDEDVRLLIVGLAPGLRGANRTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDACIVNAVRCVPPENKPVGSEINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVPVSRHPFGHGKATDIGPLRIFSSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGSARLSV
>NZ_CP007719.1|WP_004690698.1|1637426_1638002_-|NYN-domain-containing-protein
MFDSREKIALFINGANLYAASKTLGFDIDYRKLLKAFQKRGYLLRAYYYTALVEDQEYSSIRPLIDWLDYNGYKVVTKAAKEFTDSTGRRKVKGNMDIELTVDAMQLTDTVDHFVIFSGDGDFRSLVEALQRKGRKVSVVSTLTTQPAMISDELRRQADHFIDLVSLKAEIGRDPSERAPRRQEEDFDESY
>NZ_CP007719.1|WP_004690699.1|1638398_1638800_+|DNA-directed-RNA-polymerase-subunit-omega
MARVTVEDCVDKVENRFELVLLAGHRARQISQGVPITVDRDNDKNPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEAAPAQIANAAEEIAEGIAEAGEEDVVTFDRMSEEELLAGIEGLVAPEKNDGF
>NZ_CP007719.1|WP_004690700.1|1639040_1641293_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDPYFSHPLEVAAILTDMHLDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTKLKKLDLVSKKAVQAENLRKLLLAISEDVRVLLVKLADRLHNMRTLGVMCEDKRLRIAEETMDIYAPLAGRMGMQDMREELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIETDLSEIFEKNGIKASVKSRQKKPWSVFRKMETKGLSFEQLSDIFGFRVMVDTVQDCYRALGLIHTTWSMVPGRFKDYISTPKQNDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFGVAAHSIYKDRGSANNPHKISTETNAYAWLRQTIEQLSEGDNPEEFLEHTKLELFQDQVFCFTPKGRLIALPRGATPIDFAYAVHTDIGDSCVGAKVNGRIMPLMTELKNGDEVDIIRSKAQVPPAAWESLVATGKARAAIRRATRSAVRKQYSGLGMRILERAFERAGKPFSKDILKPGLPRLARKDVEDVLAAVGRGELPSTDVVKAVYPDYQDTRVTTQNNPAKAGEKGWFNIQNAAGMIFKVPEGGEGAAAKVDPAATTPKPGKRALPIRGTNPDLPVRFAPEGAVPGDRIVGILQPGAGITIYPIQSPALTAYDDQPERWIDVRWDIDDQMSERFPARISVSAINSPGSLAKIAQIAAANDANIHNLSMVRTAPDFTEMIIDVEVWDLKHLNRIISQLKESASVSSAKRVNG
>NZ_CP007719.1|WP_004690701.1|1641300_1641879_+|orotate-phosphoribosyltransferase
MNTDDVLAVFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADLGPIDYVVGPAIGGLIPSYETSRHLGVPSVWVERENGVFRLRRFDVPRGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIVDRSAGKADVGTRLISLAAYEVPAYPADKLPPELAAIPAVKPGSRNI
>NZ_CP007719.1|WP_004690702.1|1642038_1642794_+|helix-turn-helix-domain-containing-protein
MVVVPFALDQNQKLAARTPCKVCEDCCVRSMAVCSALDDGDLAALEAIMTSKKLDTNEMLVEEGEPKLRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLGLADDEVYSQSAEAVVPSALCAFSAKEMERLMERFPKLKERLYQMTRLALRTARDNQLVLGRLAPVEKLASFLLVLSARAEKRGEKPNPVHLLMNRTDIADYLGLTIETVSRSFTKLKTQGLIQLRDANTVEILSRRSLAVVAGLDPDNL
>NZ_CP007719.1|WP_004690703.1|1643174_1644509_+|oxygen-independent-coproporphyrinogen-III-oxidase
MHDDAIRRYAALAVPRYTSYPTAADFVPVGMDTTRRWLRQIGPEESVSLYIHVPYCSQICHYCGCNAKMAIREDVIENFVNALLGEIRTVSASLTARPRVAHLHWGGGTPSILNAGQFQTVLAAIRTAFDFDLSMEHAIELDPRTVTPLLAKTLAEMGVNRASLGVQDVDSRVQMAIGRVQPIETVAEATRLLREVGINRINFDLIYGLPLQTVETLRETCERVVTLSPDRVACYGYAHLPQRRANQRLIDENTLPDADERFRQARIVADSFIGFGYQPVGIDHFALPDDDLAIAAREGTLNRNFQGYTNDRCGTLIGFGPSSISQFPGGYAQNISDVGQYRKRVEAGELATVRGYTLRDTDRIRSAIISALMCNFCVDLNAVAPGMEFSDEFALLRPLVADGLVAVEGRTIRATENGKSLIRLVAAAFDEFRRDSVHGFSFAV
>NZ_CP007719.1|WP_004690704.1|1644692_1645904_-|MFS-transporter
MSVSAAQQPSNSSADNTVLTIILATSLGHFLNDMMQSLLPAIYPMLKENYSLSFWQIGLLTFTFQMTASILQPLVGIYTDRKPMPYSLTFGMGCTLIGLVFLATAHHYSFLLLGAACVGFGSSVFHPEAARVARLASGGRHGFAQSLFQVGGNFGSSIGPLLAAFIVLPFGQISVSWFSVAALIGMFVLWYVGNWYNRYRLANASKPKPDKTLPLPRNRVIAPVAVLALLVFTKYIYMAILTSYYTFYTISHFGVSVQTSQLLLFLFLGAVAAGTIIGGPIGDKIGARKVIWASILGVLPFTLALPYANLEMTAVLTIIIGLILASAFPAIIVFAQELLPGRVGMVSGLFFGFAFGMAGIAAAVLGIVADQKGIEFVYRICSYLPFLGLLTIFLPKLERRRKA
>NZ_CP007719.1|WP_006132452.1|1646155_1646938_+|helix-turn-helix-transcriptional-regulator
MPENEDLQRFHERRIAMLESMTGPAIALPTRYPDGYFVPRHSHSRAQLLCASQGVVLVTTDAGRWMIPSDHAMWIPAGVEHSVAILGDVFMRSIYISVDAISGVPNYLHVVGLTDLMRCLIIDATSHDSIPAPEYPLGLPFPSDPRLQKLCRDFVKKPSSRATIDEWADRMAMSRRSFTRHFQRETGVSLSVWRQQACLFAAVPRLSEGEPVTSVALDLGYDSVSAFTTMFRRMLGVPPKFYQPRLDVAPSERSDKAAFG
>NZ_CP007719.1|WP_002966733.1|1646987_1647563_+|DUF2062-domain-containing-protein
MLFQRRYPPTRWERLRLYLWPRRSFSRSFRYGGKRILRITASPHAVAAGLAVGVFSAFTPFFGFHLIIAIVLAYFLAGNVAAAALGTTLANPLTLPFIWGSTFELGRFIMSGSVDSVPPVHLGHALETMRFEEVWTPLLKPMLFGSTILGAAFAVLVYFVTRYAVSVFRRRRLERLAEKHRLHRQRELQKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1460139 : 1525788

Tupanvirus(16.67%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004690613.1\|1460139_1461552_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_002963624.1\|1461693_1462320_-	invasion associated locus B family protein	NA	NA	NA	NA
WP_004690614.1\|1462720_1463608_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_004690615.1\|1463745_1465404_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.2e-09	36.3
WP_004683128.1\|1465631_1466579_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_004683131.1\|1466578_1466764_+	hypothetical protein	NA	NA	NA	NA
WP_004690616.1\|1466783_1467389_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_004690617.1\|1467597_1468476_+	cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_004688061.1\|1468589_1468973_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_004683138.1\|1468969_1469719_+	SURF1 family protein	NA	NA	NA	NA
WP_004690618.1\|1469827_1470868_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_004690619.1\|1470873_1471854_+	homoserine kinase	NA	NA	NA	NA
WP_002963635.1\|1471850_1472315_+	ribonuclease HI	J9Q745	Salmonella_phage	1.7e-40	53.6
WP_002963636.1\|1472344_1472830_-	peroxiredoxin	M1I839	Pelagibacter_phage	3.0e-24	46.8
WP_004690620.1\|1473009_1473810_-	hypothetical protein	NA	NA	NA	NA
WP_004683145.1\|1473944_1474547_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_004690621.1\|1474660_1477555_-	sensor domain-containing phosphodiesterase	NA	NA	NA	NA
WP_002963640.1\|1477551_1478172_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004690622.1\|1478342_1479635_-	insulinase family protein	A0A2K9L1M6	Tupanvirus	1.1e-33	28.1
WP_004690623.1\|1479688_1481080_-	threonine synthase	NA	NA	NA	NA
WP_004690624.1\|1481159_1481411_-	hypothetical protein	NA	NA	NA	NA
WP_004690625.1\|1481561_1482140_+	hypothetical protein	NA	NA	NA	NA
WP_025198227.1\|1482453_1484088_+	EAL domain-containing protein	NA	NA	NA	NA
WP_004690627.1\|1484216_1484402_+	hypothetical protein	NA	NA	NA	NA
WP_004688072.1\|1484443_1485130_-	HAD family phosphatase	NA	NA	NA	NA
WP_004688073.1\|1485277_1487068_-	chloride channel protein	NA	NA	NA	NA
WP_004689516.1\|1487404_1488538_+	site-specific DNA-methyltransferase	A0A249XUJ2	Enterococcus_phage	4.7e-28	30.4
WP_002963651.1\|1488620_1489238_-	HAD family phosphatase	NA	NA	NA	NA
WP_004690628.1\|1489234_1490311_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_002971552.1\|1490276_1490423_-	hypothetical protein	NA	NA	NA	NA
WP_004689517.1\|1490584_1491112_+	DUF721 domain-containing protein	NA	NA	NA	NA
WP_002971551.1\|1491349_1492003_+	DsbA family protein	NA	NA	NA	NA
WP_004690629.1\|1492081_1495540_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_004691958.1\|1495562_1496456_+	cation transporter	NA	NA	NA	NA
WP_002967466.1\|1496565_1496907_-	glyoxalase	NA	NA	NA	NA
WP_004691957.1\|1497170_1499834_+	pyruvate, phosphate dikinase	A0A2D2W2B1	Stenotrophomonas_phage	7.0e-91	41.6
WP_004690635.1\|1501866_1502655_+	DUF1499 domain-containing protein	NA	NA	NA	NA
WP_005969743.1\|1502655_1503561_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_004690636.1\|1503761_1504361_+	biotin transporter BioY	NA	NA	NA	NA
WP_004688080.1\|1504514_1505024_+	ureidoglycolate lyase	NA	NA	NA	NA
WP_004690637.1\|1505035_1505392_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_004690638.1\|1505462_1506299_+	DUF2793 domain-containing protein	A0A0B5A0F6	Paracoccus_phage	2.5e-39	45.2
WP_004691955.1\|1506835_1508704_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	4.2e-18	28.4
WP_004690639.1\|1508690_1509698_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_129171622.1\|1509579_1509852_+	hypothetical protein	NA	NA	NA	NA
WP_004691954.1\|1510356_1511175_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_077281772.1\|1511786_1512137_+\|transposase	transposase	NA	NA	NA	NA
WP_002963675.1\|1513565_1514345_-	LPS biosynthesis N-formyltransferase WbkC	E3SNR5	Prochlorococcus_phage	3.3e-09	31.4
WP_004691951.1\|1514370_1515225_-	hypothetical protein	NA	NA	NA	NA
WP_002963677.1\|1515221_1515980_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_004683211.1\|1515976_1516759_-	ABC transporter permease	NA	NA	NA	NA
WP_004690643.1\|1516773_1517877_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2K9L470	Tupanvirus	2.0e-44	31.9
WP_024767981.1\|1517884_1518976_-	GDP-mannose 4,6-dehydratase	M1HKK4	Acanthocystis_turfacea_Chlorella_virus	4.5e-137	68.9
WP_029097245.1\|1520098_1521037_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_002963682.1\|1522236_1523355_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_077281774.1\|1524111_1524264_-	hypothetical protein	NA	NA	NA	NA
WP_006072314.1\|1524306_1524861_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_144242537.1\|1525025_1525788_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.0e-23	41.7

DBSCAN-SWA_2

1851152 : 1863066

uncultured_Mediterranean_phage(90.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002968731.1\|1851152_1852004_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.4e-31	33.5
WP_004690782.1\|1851996_1852722_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.1e-43	45.7
WP_002964012.1\|1852867_1853086_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.5e-07	65.1
WP_004686803.1\|1853196_1853778_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_004690783.1\|1853774_1854599_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.7e-43	40.7
WP_004690784.1\|1854675_1855959_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.5e-104	47.0
WP_004683703.1\|1856107_1856875_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.0e-39	40.2
WP_004683704.1\|1856871_1857540_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.6e-14	38.5
WP_002964018.1\|1857684_1857870_+	hypothetical protein	NA	NA	NA	NA
WP_004690785.1\|1857918_1859217_+	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	1.0e-18	41.1
WP_002964020.1\|1859265_1860132_-	ATP-binding protein	NA	NA	NA	NA
WP_002964021.1\|1860291_1860633_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.1e-12	40.2
WP_080546505.1\|1860750_1863066_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.1e-51	43.5

DBSCAN-SWA_3

1934856 : 1944891

Brucella_phage(37.5%)

transposase,integrase

attL 1934739:1934779|attR 1949854:1949894

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1934739:1934779	attL	NA	NA	NA	NA
WP_004690811.1\|1934856_1935882_-\|integrase	site-specific integrase	A0A141GEZ3	Brucella_phage	1.6e-48	37.8
WP_004690812.1\|1935868_1936072_-	hypothetical protein	NA	NA	NA	NA
WP_002971459.1\|1936074_1936290_-	hypothetical protein	NA	NA	NA	NA
WP_002964088.1\|1936286_1936490_-	hypothetical protein	NA	NA	NA	NA
WP_006072696.1\|1936539_1937259_+	hypothetical protein	A0A076GD06	Sinorhizobium_phage	4.6e-05	46.8
WP_002964091.1\|1937255_1937486_+	hypothetical protein	NA	NA	NA	NA
WP_002964092.1\|1937482_1937758_+	hypothetical protein	NA	NA	NA	NA
WP_004683738.1\|1937780_1938368_+	hypothetical protein	NA	NA	NA	NA
WP_004683739.1\|1938602_1939313_+	porin family protein	O11861	Bartonella_henselae_phage	5.1e-41	36.8
WP_002964095.1\|1939660_1939831_-	DUF1508 domain-containing protein	A0A2P1N580	Mycobacterium_phage	3.1e-05	45.1
WP_002964097.1\|1940178_1940493_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	6.9e-06	43.4
WP_004688321.1\|1940492_1940738_-	hypothetical protein	NA	NA	NA	NA
WP_080723468.1\|1941578_1942335_+\|transposase	IS5-like element IS711 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.8e-15	40.2
WP_006132649.1\|1942336_1943110_+	hypothetical protein	A0A141GEY5	Brucella_phage	2.9e-122	97.3
WP_004689673.1\|1943244_1944891_+	hypothetical protein	A0A141GEY6	Brucella_phage	1.3e-175	62.0
1949854:1949894	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007718

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP007719

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection