CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP007724	Corynebacterium glutamicum strain AR1 chromosome, complete genome	2 crisprs	DEDDh,csa3,cas3,cas9,WYL,DinG	0	1	3	0
NZ_CP007725	Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence	1 crisprs	c2c9_V-U4	0	3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007724_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007724_1

344287-344385

Orphan

Consensus_repeat	Method
TGCGTGGGCAGTGTGGTTTGGTTTTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007724_1

>merge|NZ_CP007724|1|344287-344385|CRISPRCasFinder
TGCGTGGGCAGTGTGGTTTGGTTTTGGGGGCTCGGAACCGGTCACAGATGCCCACGATTGCGGTTTTTCCGTTGCGTGGGCAGTGTGGTTTGGTCTTGG

>NZ_CP007724|1|1|344287-344385|CRISPRCasFinder
TGCGTGGGCAGTGTGGTTTGGTTTTGG	GGGCTCGGAACCGGTCACAGATGCCCACGATTGCGGTTTTTCCGT
TGCGTGGGCAGTGTGGTTTGGTCTTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007724.1\|WP_011013538.1\|340630_340816_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007724.1\|WP_038582245.1\|349952_350729_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP007724.1\|WP_038582234.1\|342204_342948_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP007724.1\|WP_003855829.1\|351871_352171_+\|flp-pilus-assembly-TadE/G-like-family-protein	unknown	unknown	gnl\|CDD\|274799
NZ_CP007724.1\|WP_038582247.1\|350725_351301_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP007724.1\|WP_038582239.1\|346456_347299_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP007724.1\|WP_003855827.1\|351324_351525_+\|DUF4244-domain-containing-protein	unknown	unknown	gnl\|CDD\|379429
NZ_CP007724.1\|WP_044029692.1\|339685_340369_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP007724.1\|WP_038582243.1\|348834_349968_+\|TadA-family-conjugal-transfer-associated-ATPase	unknown	unknown	gnl\|CDD\|200328
NZ_CP007724.1\|WP_003855817.1\|345740_346292_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
NZ_CP007724.1\|WP_003863285.1\|351528_351849_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007724.1\|WP_003863309.1\|338194_338668_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NZ_CP007724.1\|WP_038582225.1\|336039_336984_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP007724.1\|WP_038582236.1\|343038_344235_+\|MarP-family-serine-protease	unknown	unknown	gnl\|CDD\|367140
NZ_CP007724.1\|WP_038582230.1\|340861_341644_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
NZ_CP007724.1\|WP_038582232.1\|341651_342212_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP007724.1\|WP_044394387.1\|338782_339610_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP007724.1\|WP_038582241.1\|347776_348838_+\|septum-site-determining-protein	unknown	unknown	gnl\|CDD\|274798
NZ_CP007724.1\|WP_003855805.1\|336976_338173_+\|glutaryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
NZ_CP007724.1\|WP_003863295.1\|344730_345726_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669

Protein	Function_ID	Function_description	E-value
NZ_CP007724.1\|WP_038582245.1\|349952_350729_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	2.23708e-65
NZ_CP007724.1\|WP_038582234.1\|342204_342948_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.52208e-53
NZ_CP007724.1\|WP_038582247.1\|350725_351301_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	2.23321e-14
NZ_CP007724.1\|WP_038582239.1\|346456_347299_-\|HAD-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.61676e-74
NZ_CP007724.1\|WP_003855827.1\|351324_351525_+\|DUF4244-domain-containing-protein	gnl\|CDD\|379429	pfam14029, DUF4244, Protein of unknown function (DUF4244). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 66 and 95 amino acids in length. There is a conserved EYA sequence motif.	1.21917e-15
NZ_CP007724.1\|WP_044029692.1\|339685_340369_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	7.01707e-55
NZ_CP007724.1\|WP_038582243.1\|348834_349968_+\|TadA-family-conjugal-transfer-associated-ATPase	gnl\|CDD\|200328	TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.	9.76936e-154
NZ_CP007724.1\|WP_003855817.1\|345740_346292_-\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	1.12452e-31
NZ_CP007724.1\|WP_003855829.1\|351871_352171_+\|flp-pilus-assembly-TadE/G-like-family-protein	gnl\|CDD\|274799	TIGR03816, tadE_like_DECH, helicase/secretion neighborhood TadE-like protein. Members of this small, highly hydrophobic protein family occur in a pilus/secretion-like region that usually is next to an uncharacterized DEAH-box helicase, in Actinobacteria. Members show sequence similarity to the TadE-like family described by pfam07811. The function is unknown. [Unknown function, General].	9.82352e-08
NZ_CP007724.1\|WP_003863309.1\|338194_338668_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	1.47997e-80
NZ_CP007724.1\|WP_038582225.1\|336039_336984_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	7.01283e-87
NZ_CP007724.1\|WP_038582236.1\|343038_344235_+\|MarP-family-serine-protease	gnl\|CDD\|367140	pfam02674, Colicin_V, Colicin V production protein. Colicin V production protein is required in E. Coli for colicin V production from plasmid pColV-K30. This protein is coded for in the purF operon.	1.7714e-18
NZ_CP007724.1\|WP_038582230.1\|340861_341644_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	2.91798e-106
NZ_CP007724.1\|WP_038582232.1\|341651_342212_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	3.50747e-22
NZ_CP007724.1\|WP_044394387.1\|338782_339610_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	8.74231e-64
NZ_CP007724.1\|WP_038582241.1\|347776_348838_+\|septum-site-determining-protein	gnl\|CDD\|274798	TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein. Members of this protein family belong to the MinD/ParA family of P-loop NTPases, and in particular show homology to the CpaE family of pilus assembly proteins (see ). Nearly all members are found, not only in a gene context consistent with pilus biogenesis or a pilus-like secretion apparatus, but also near a DEAD/DEAH-box helicase, suggesting an involvement in DNA transfer activity. The model describes a clade restricted to the Actinobacteria.	3.85612e-91
NZ_CP007724.1\|WP_003855805.1\|336976_338173_+\|glutaryl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	3.60113e-108
NZ_CP007724.1\|WP_003863295.1\|344730_345726_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.10411e-22

>NZ_CP007724.1|WP_038582236.1|343038_344235_+|MarP-family-serine-protease
MLSPSLVVDAVIVLVMAFALWGGWRQGAFTSLLSTVGVVSGLVVGAAAAPFVMGLTDSTALRFLLAIGTVVLLVGLGNLIGAHLGAAIRDNIKFRSSRTLDSGLGAIFQVLATLIVVWLVAIPLATGLPGTVASGIRDSRILGFVDKYTPQGLDTLPSKIAAMLSESGLPPLISPFTGGSSVEVDAPEINVTNVDLVEAMRPSVIHVMGDAQECSRRLMGSGFVASPDYVVTNAHVVAGTSTVSLDTMIGTRSAEVVFYDPNLDIAVLYSPDLGLDPLPWASTPLDTGDEAIVMGFPQSGPFNASPARVRERIMITGSNIYANGQHEREAYSVRGSIQSGNSGGPMTNEMGEVVGVVFGAAIDGSDTGYILTAEEVQERIGDITALTQPVDTMQCAVS
>NZ_CP007724.1|WP_038582234.1|342204_342948_+|CoA-pyrophosphatase
MRNYPDLPHDFPGQNTELTPAKAPVWMHRLIDRIHAGSMANPLDGAEPLGDTDSEKRAAVLMLFSGSETSFDLPNDASVLLTHRTPTMRSHAGQIAFPGGRIDPTDTNAVDCAFREAWEETGLDRRTATPLAQLNEVHIRATGYPVYPILGHWHTPSPVAVASPHETDEVFDAPLYDLIDPKNRLMVGWREWHGPAFRINDYIIWGFTGGLLSAILDTAGWATEWDTDRIFDLENTLSTSRNNERMR
>NZ_CP007724.1|WP_038582232.1|341651_342212_+|TlpA-family-protein-disulfide-reductase
MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKITTRPDCVASGAAGVDLPCLGGANGVANELATVVNLWAWWCEPCRAELPIFDEFATTHPELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGTLGLPGVVPITVVVSPEGEVVGTFPQPFETIDDLETAVAGALQNA
>NZ_CP007724.1|WP_038582230.1|340861_341644_+|endonuclease-III
MGSITPQKRPRVGSHIANKGQETDIGRKRRARRINRTLTVAYPDAHCELDFTNPLELTVATILSAQCTDVRVNQVTPALFKRYPTAADYANADRTELEEFIRPTGFYRNKATSLIGLGEALISLHDGQVPGTLEQLVELPGVGRKTANVVLGNAFGVPGITVDTHFGRLVRRLKLTDEEDPVKVEKVMNELIEKPEWTMFSHRLIFHGRRICHSRRAACGACMLAADCPSFGLEGPSDPFEAQKLIKSDDREHLLKMAGI
>NZ_CP007724.1|WP_011013538.1|340630_340816_-|hypothetical-protein
MTGLLVVIIPLLLMLFAFAMERIESSFLHSNAPQNTEVKLAKDAIGAENLNDGDVQEASAA
>NZ_CP007724.1|WP_044029692.1|339685_340369_-|Crp/Fnr-family-transcriptional-regulator
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIVEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
>NZ_CP007724.1|WP_044394387.1|338782_339610_+|MBL-fold-metallo-hydrolase
MEHPAYSQLRPVTPSASVVLCPNPGYSSLEGTNSWVIRAPEDPRSIVIDPGPEDEGHLNVLHSKAEEVGLILLTHRHYDHADGAQRFRQLTNAPVRAMDPSYCAGAEEIHDGEIITIDGVTPQIEVVATPGHTRDSVSYFIWSGVPHESTLEGIVSGDTIAGRHTTMISETDGDLGEYLNSLAILEERGKDIPLLPGHGPDGQDVASFARKYIERRELRLNQIREVWETRGRDVSMKDLIDAIYDDVDPVLRGAAEQSTHVAIRYLQAQEASASN
>NZ_CP007724.1|WP_003863309.1|338194_338668_+|MaoC-family-dehydratase
MTTSTTPNTIVSFEDAPTLTGQDLGFSQWRTVTQEMVNTFADATDDQQWIHTDPERAKDGPFGGAIAHGFLTLSMIIPFWGELLDVTGVTTKVNYGLDKVRFTSPVKVGSRIRMGAVVREISEVKGNGLHLVADGTIEIEGQERPAVVATFLTRFYA
>NZ_CP007724.1|WP_003855805.1|336976_338173_+|glutaryl-CoA-dehydrogenase
MRDPIQGAVIPSDLFGFAEVLTEAERAVLLETRRVLEEEVKPYINEAWDKAVFPNAIMQPLQDLQLLDPPALREAGESVRDIFTGFRNFELARCDINVGTYYNASAGLFRTACMVGGSPEQAQRLDAQIKSGEVKGVFALTEPDHGSDIAGGLATTATKDADTGEWIINGEKRWIGGASTADLIATFARDTADNQVKCFLVAPQAEGVSMEIIDRKASLRIMQNAHITYNNVRVSEDARLHNINSFKDVSECLRRMRSDVAWMAVGAQAGAYEAAVKYVRSREQFGRPIAGFQLIQEKLALMLGNLTASLGMMVKLTEQQQAGIFKEENSALAKMFTSLKLRETASWAREICGGNGIILDNDVARFHADAEAVYSYEGTHEINALIVGRAITGVSAFI
>NZ_CP007724.1|WP_038582225.1|336039_336984_+|amidohydrolase
MSNNVVKYECAVDADNIVAVDMHVHLEVDSCGHESMPADIMEASSKYFKAAERTPSADAIADIYREHKMAAVVFTIDARTQMGHLPNSIDDLVASCARNNDVLIPFGSVDPRTGEDALVEARRQVEELGVRGFKFHPSVQGFDPSAPEFYPLWELLESFGLPCVFHTGQNGMGAGLPGGRGIKLRFSNPMLLDDVAADFPNLTIIMAHPSVPWQDEANSIATHKANVFIDLSGWSPKYFPESLVRQSNNVLSKKVLFGTDFPLITPEKWLAAFANLPLKDEVRPGILKDNAVKVLGLAASTERGSQAEKAVQHA
>NZ_CP007724.1|WP_003863295.1|344730_345726_-|alpha/beta-hydrolase
MAFFSFSTSPLTRLIPGSRSKATGAKRRLSSTIASIERSPGIIALDGPFTHDHVSVRGIRLHLAEAGSPTNPLVLLIHGAFGGWYDYREVIGPLADAGFHVAAIDLRGYGMSDKPPTGYDLRHAAGELSSVIAALGHDDALLVGSDTGASIAWAIASMYPERVRGLISLGAIHPLDMRRAIRRKPHLHVSDLSRLAPFRLPSFLHNLFHFGITSEARREIVNNTSSSYQRSNAFTETVLLRKKALSIDHTITPIIRTNRYLVGSIPSKTVSAPVWLLRTNTRRWEHLANTARTRTTGPFTTIAIPGGYELPYLENPSEFAATIAEFARTTF
>NZ_CP007724.1|WP_003855817.1|345740_346292_-|phage-holin-family-protein
MSNKDGLFTDGSSTFAPKVDSIPLSDVDTSVSGEASIGTLISNATSQMSSLFRAEVELAKTELAGEAKKAAIGGGAFSVAGVIALYSSFFFFFFVAALLSEWIKPWAAFLIVFLFMLVIAAALALFGWRKVKKMGAPKNTIQSVNQLKNLVPGQASEKLEKANKRGLYTSASFHSPGAITGDH
>NZ_CP007724.1|WP_038582239.1|346456_347299_-|HAD-family-hydrolase
MKHPDPAQKVEGTTATTPTKVAAFFDLDKTIIAMSSTYAYGREFMNSGLISPVEALQLSLAQATYMFAGHTSEQMDNTRDQLTAMIRGWEVQQVRSIAEETMHSVVTPTIYAEARELIEHHQELGHDVIIISASVKELVEPIARELGVRKTVTTVLEAHDGMYTGEVLFYCKGDAKAQSILDLAEANNYDLSLSFAYSDSFTDLPMLEAVGNPAAVNPDRALKKIALEQGWKILSFKNPEPLFQMPSTRDVGIGTGVVAGIAAVTAGSIWWMKRARRGSA
>NZ_CP007724.1|WP_038582241.1|347776_348838_+|septum-site-determining-protein
MNTTTHQAILIAVEDPVLHPEAMHVAAATGRPVIETTNLMDISRHFHRASAVLIDASMASQLSPGKRRDRVFLLDSDPGPSDWKTAMKIHAEQAMLLPAQAGELLSALGRDDKQLPVASGHVIGVAGVVGGTGASTFAAALAKRRAESVTTVLIDADPSSGGIDLLLGIEDVPGARWPDVGLRRGTVQAADVLKALPSTPDEVVVLSTARSNILDPFALSESDVSAAIDCFLSADRSVDVVVDLPHARVHPDIAERLSHLVLVIPAEVRAVAAARARYMELQQLHVSIACVLRHRGWSGLDVAEVEEILGADITAEIGSIQRLAKSVEMHGLTGSLPRVLSSACDAVLGEVAA
>NZ_CP007724.1|WP_038582243.1|348834_349968_+|TadA-family-conjugal-transfer-associated-ATPase
MTDIDLVVENVQRIIATKETPPTSAEIASLIREQAGVISNEDIVMVLRRLRSDSVGVGPLESLLALPGVTDVLVNAHDSVWIDRGQGVEKVDMDLGSEEAVRRLATRLALTCGRRLDDAQPFADGRITRDDGSVLRIHAVLAPLAESGTCISVRVLRQARLSLDDLINSGTVPEDIAPALRNIINQRRSFLVVGGTGTGKTTLLSAMLTEVPADQRIICIEDTAELHPGHPSTINLVSRQANVEGAGAVSMADLLKQSLRMRPDRIVVGEIRGGEVVDLLAAMNTGHDGGAGTIHANSISEVPARMEALAATGGLDRMALHSQLAAAVDIVLVMKHTPFGRRLAQLGVLRGNPVTTQVVWDLDHGMHEGSEEAWFMP
>NZ_CP007724.1|WP_038582245.1|349952_350729_+|type-II-secretion-system-F-family-protein
MVYALGLLSMAVLISGSTGPGARTRPPTPGNGVHLFALIALFCLATVLFIVVDAYTMIAGIIIATTLFWYLRQTHAAAQRTKQSLQLASFLSLCAGNLRAGVTMVDAMDYALDNTTPDKFLSPTLQTAARQARSGGSGPRVLIDASLPDLQRLGHLWETSERHGIPLVALIDQMRSRISSKQRHGESTRAALQGPQATAVILTVLPLAGLLMGTAMGANPLGLLTGGGIGGFLLVIGVGLDAAGFVVTHKILQSASPS
>NZ_CP007724.1|WP_038582247.1|350725_351301_+|type-II-secretion-system-F-family-protein
MITAIVLAAAAMFIGSPNPGVRGGLISPKSGKSLRIRAGPKKLGNADPVDVSADIELFSACLDAGLNTRDAAQVVAHVAAITHRELWTHVVALLSIGVSAPQAFALMAGVDGLDELANLATVSHRSGSALSDGCRNISTALLASAGDKRTAAAERAGVFIALPLALCFLPAFMIVGLAPVVLSLGTQLINF
>NZ_CP007724.1|WP_003855827.1|351324_351525_+|DUF4244-domain-containing-protein
MSNNLELLRLRTRAILAQDDGLTTVEYALGTLAAAALAAVLYMVVNSDAVSSAFESIISDALSARP
>NZ_CP007724.1|WP_003863285.1|351528_351849_+|hypothetical-protein
MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLAAYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVFPVEN
>NZ_CP007724.1|WP_003855829.1|351871_352171_+|flp-pilus-assembly-TadE/G-like-family-protein
MTIASAGVASILISLLVVLAWQAGNLVAREQAQVAADVSAVAGAYAFARGELPDAACATAKHTAEANNAQLENCATEGEDLTLTVTVRGQEAHAKAGPL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP007724_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007724_2

447187-447257

Orphan

Consensus_repeat	Method
TCAAGGAAGGCGTTAATACGTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007724_2

>merge|NZ_CP007724|2|447187-447257|CRISPRCasFinder
TCAAGGAAGGCGTTAATACGTGCTAGCTGTTCGTCAATGCCTGCCCTGTCAAGGATGGCGTTAATACGTGC

>NZ_CP007724|2|2|447187-447257|CRISPRCasFinder
TCAAGGAAGGCGTTAATACGTGC	TAGCTGTTCGTCAATGCCTGCCCTG
TCAAGGATGGCGTTAATACGTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007724.1\|WP_038582491.1\|451471_452125_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|188483
NZ_CP007724.1\|WP_038582487.1\|451010_451316_+\|DUF2516-family-protein	unknown	unknown	gnl\|CDD\|378483
NZ_CP007724.1\|WP_003855472.1\|450569_450992_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007724.1\|WP_038582468.1\|444977_445469_+\|DUF433-domain-containing-protein	unknown	unknown	gnl\|CDD\|377269
NZ_CP007724.1\|WP_038582465.1\|440717_442739_+\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|236054
NZ_CP007724.1\|WP_038582494.1\|452121_453771_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340868
NZ_CP007724.1\|WP_158407471.1\|444046_444931_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238566
NZ_CP007724.1\|WP_038582496.1\|453770_455405_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP007724.1\|WP_011013607.1\|442738_443488_+\|succinate-dehydrogenase/fumarate-reductase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|181038
NZ_CP007724.1\|WP_051904583.1\|436181_437933_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367526
NZ_CP007724.1\|WP_003859703.1\|438006_439431_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|226322
NZ_CP007724.1\|WP_020309525.1\|456446_457121_+\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_CP007724.1\|WP_011896668.1\|455477_456392_-\|formyltetrahydrofolate-deformylase	unknown	unknown	gnl\|CDD\|235676
NZ_CP007724.1\|WP_038582481.1\|448200_449178_-\|winged-helix-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377630
NZ_CP007724.1\|WP_044029715.1\|445690_445972_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226603
NZ_CP007724.1\|WP_038582475.1\|446047_446998_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NZ_CP007724.1\|WP_011013608.1\|443546_443876_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007724.1\|WP_038582484.1\|449249_450554_+\|DUF445-domain-containing-protein	unknown	unknown	gnl\|CDD\|225347
NZ_CP007724.1\|WP_038582462.1\|439927_440701_+\|succinate-dehydrogenase-cytochrome-b-subunit	unknown	unknown	gnl\|CDD\|239578
NZ_CP007724.1\|WP_038582499.1\|457522_458392_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP007724.1\|WP_038582491.1\|451471_452125_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|188483	TIGR03968, transcriptional_regulator_TetR_family, mycofactocin system transcriptional regulator. Members of this family are TetR family putative transcriptional regulators that occur in genome contexts near proteins of the mycofactocin system. These include the precursor peptide (TIGR03969), a radical SAM peptide maturase (TIGR03962), and a putative carrier protein (TIGR03967). [Regulatory functions, DNA interactions].	5.50655e-11
NZ_CP007724.1\|WP_038582487.1\|451010_451316_+\|DUF2516-family-protein	gnl\|CDD\|378483	pfam10724, DUF2516, Protein of unknown function (DUF2516). This family is conserved in Actinobacteria. The function is not known.	6.21472e-23
NZ_CP007724.1\|WP_038582468.1\|444977_445469_+\|DUF433-domain-containing-protein	gnl\|CDD\|377269	pfam04255, DUF433, Protein of unknown function (DUF433).	1.0451e-08
NZ_CP007724.1\|WP_038582465.1\|440717_442739_+\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|236054	PRK07573, sdhA, fumarate reductase/succinate dehydrogenase flavoprotein subunit.	0
NZ_CP007724.1\|WP_038582494.1\|452121_453771_+\|MFS-transporter	gnl\|CDD\|340868	cd06179, MFS_TRI12_like, Fungal trichothecene efflux pump (TRI12) of the Major Facilitator Superfamily of transporters. This family includes Fusarium sporotrichioides trichothecene efflux pump (TRI12), which may play a role in F. sporotrichioides self-protection against trichothecenes. TRI12 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.34709e-74
NZ_CP007724.1\|WP_158407471.1\|444046_444931_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	4.75439e-41
NZ_CP007724.1\|WP_038582496.1\|453770_455405_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.31757e-78
NZ_CP007724.1\|WP_038582481.1\|448200_449178_-\|winged-helix-DNA-binding-domain-containing-protein	gnl\|CDD\|377630	pfam06224, HTH_42, Winged helix DNA-binding domain. This family contains two copies of a winged helix domain.	2.28132e-31
NZ_CP007724.1\|WP_051904583.1\|436181_437933_+\|hypothetical-protein	gnl\|CDD\|367526	pfam03495, Binary_toxB, Clostridial binary toxin B/anthrax toxin PA Ca-binding domain. This domain is a calcium binding domain in the anthrax toxin protective antigen.	0.000555455
NZ_CP007724.1\|WP_011013607.1\|442738_443488_+\|succinate-dehydrogenase/fumarate-reductase-iron-sulfur-subunit	gnl\|CDD\|181038	PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated.	1.63367e-163
NZ_CP007724.1\|WP_011896668.1\|455477_456392_-\|formyltetrahydrofolate-deformylase	gnl\|CDD\|235676	PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed.	4.7287e-179
NZ_CP007724.1\|WP_003859703.1\|438006_439431_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|226322	COG3800, COG3800, Predicted transcriptional regulator [General function prediction only].	0
NZ_CP007724.1\|WP_044029715.1\|445690_445972_+\|hypothetical-protein	gnl\|CDD\|226603	COG4118, Phd, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	2.19345e-05
NZ_CP007724.1\|WP_038582484.1\|449249_450554_+\|DUF445-domain-containing-protein	gnl\|CDD\|225347	COG2733, COG2733, Predicted membrane protein [Function unknown].	0
NZ_CP007724.1\|WP_020309525.1\|456446_457121_+\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	3.45169e-85
NZ_CP007724.1\|WP_038582475.1\|446047_446998_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	1.22682e-24
NZ_CP007724.1\|WP_038582462.1\|439927_440701_+\|succinate-dehydrogenase-cytochrome-b-subunit	gnl\|CDD\|239578	cd03498, SQR_TypeB_2_TM, Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. C. glutamicum SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunit. The transmembrane subunit of members of this subfamily is also called Sdh cytochrome b558 subunit based on the Bacillus subtilis protein. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron acceptor (quinone). The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes. Proteins in this subfamily from G. metallireducens and G. sulfurreducens are bifunctional enzymes with SQR and QFR activities.	4.12135e-67

>NZ_CP007724.1|WP_038582475.1|446047_446998_-|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MNSPLSRTEAKNLQKSIAMRIDHLSKTEDRSKDSIRYQLLFECFLRRIFAHQDSGWVLKGGTALLMRNGHGRFTQDIDLARAQKWDDTEEIRQEFEKIARRKANDPFVFEVTSVRLQSASTPDGYSTPTIQVKLSARLGANVFHAIKIDVSIQRHTQLPLETVLVEPLFNQVSKTENYDSFYISVIAIESHLADKICAMYERHRSGVSNRYRDLADIIQIIRTHNFSIEKLSEILNHETNRRHMEWPEKLNAPGPDWEKEYERNAPEYDGLPANLHTLQASLDYAGACLNEVLEKSRISGIWNHQEFCWEDPFPQG
>NZ_CP007724.1|WP_044029715.1|445690_445972_+|hypothetical-protein
MKTLGISDVSRIGISGLVQTVESGESISIAKQGRVVAQLLPAQKSQRLWEEQDDLMDAVLVLSRMLSDDGMRIELQEVIELLGFDVSELESEI
>NZ_CP007724.1|WP_038582468.1|444977_445469_+|DUF433-domain-containing-protein
MSFDLKLTQFLTGVTEYQLKLWSKEKILVPEINSVPPIRYSFRDIVALRIVAKYPVEVSLWSLEENDYEKYGFAVEDVYLSFTNAEGKKVPDLQRPAPGIEIDAEILGGTPRVAGSRIPAAVIAEILRDPETTEQEIQEFHPNLKTADFKNVRNFDSVVYGAV
>NZ_CP007724.1|WP_158407471.1|444046_444931_+|ABC-transporter-substrate-binding-protein
MKKYAVAALALLTLAGCSTSEEVAASSDSAPQRIVIAQANFLDLALALDLEPVGTTYWGGAGGVQDYLLSSAPASMEAVGNDDEPNFETVAKLQPDLIIGDEEIETNLAKYEAIAPVSIIKSVDENGSNSWRDQLTALAELTGTQEKAAAVIEEADKSVASLDSKITSPGEKTMLLRIREQQVRQYLPDSFVGAGVPQRLQNITLVESTVPSENGQWSVIPPENIGLLDADRIIAFIDSPQALENAESNPLWSQLPAVKNGQLCTTENLTPWILTGPAAAEIVTSDLEACFAAS
>NZ_CP007724.1|WP_011013608.1|443546_443876_+|hypothetical-protein
MSSAKKKPAPERMHYIKGYVPVAYSSPHSSLERSATWLGMGFLLTALAGVGAVLFAVGANSVGQQQEHWVLYSIIGVVFAVVCTVLGTVLIIKGRAPYNRYVKETGRTQ
>NZ_CP007724.1|WP_011013607.1|442738_443488_+|succinate-dehydrogenase/fumarate-reductase-iron-sulfur-subunit
MKLTLEIWRQAGPTAEGKFETVQVDDAVAQMSILELLDHVNNKFIEEGKEPFAFASDCREGICGTCGLLVNGRPHGADQNKPACAQRLVSYKEGDTLKIEPLRSAAYPVIKDMVVDRSALDRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACIGCGACVAACPNGAAHLFTGAKLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGECADVCPAGIPLTAVAAVTKERARAAFRGKDD
>NZ_CP007724.1|WP_038582465.1|440717_442739_+|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit
MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPTKDMWEYQKDHMNLVSPLNRRKFRVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAYRHVKDTVKGGDYRGRESDCWRLAVESVRVIDHMNAIGAPFAREYGGALATRSFGGVQVSRTYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVIVTERNGEKRCEGLIMRNLITGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASAIMRAYEAGAYFASPSFIQFHPTGLPVNSTWQSKTILMSESLRNDGRIWSPKEPNDNRDPNTIPEDERDYFLERRYPAFGNLVPRDVASRAISQQINAGLGVGPLNNAAYLDFRDATERLGQDTIRERYSNLFTMYEEAIGEDPYSSPMRIAPTCHFTMGGLWTDFNEMTSLPGLFCAGEASWTYHGANRLGANSLLSASVDGWFTLPFTIPNYLGPLLGAERLSEDAPEAQAAIARAQARIDRLMGNRPEWVGDNVHGPEYYHRQLGDILYFSCGVSRNVKDLQDGIDKIRALREDFWKNMRITGSTDEMNQVLEYAARVADYIDLGELMCVDALDRDESCGAHFRDDHLSEDGEAERDDENWCFVSAWEPGENGTFVRHAEPLFFESVPLQTRNYK
>NZ_CP007724.1|WP_038582462.1|439927_440701_+|succinate-dehydrogenase-cytochrome-b-subunit
MTVRNPDREAIRHGKITTEALRERPAYPTWAMKLTMAITGLIFGGFVLVHMIGNLKIFMPDYAADSAHPGEAQVDVYGEFLREIGSPILPHGSVLWILRIILLVALALHIYCAFALTGRSHQSRGKFRRTNLVGGFNSFATRSMLVTGIVLLAFIIFHIFDLTMGVAPAAPTSFEHGEVYANMVASFSRWPVAIWYIIANLVLFVHLSHGIWLAVSDLGITGRRWRAILLAVAYIVPALVLIGNITIPFAIAVGWIA
>NZ_CP007724.1|WP_003859703.1|438006_439431_-|helix-turn-helix-domain-containing-protein
MGKTYVGSRLRQLRRERDLSQASLAATLGLSASYVNQIEHDVRPLTVPVLLRITEAFGVDATFFSRDDDSRLLAEVQDVMLDREINPANVELQELSEMVYNHPQLARAMVEMHQRYRNVRDKFSIAVDNRTNTPEERRPIAEAVSMPHEEVRDFIYARQNYFDALDRRAEAIAAQLGWQPYDSRAMEDSIARRLQMDHDVTITSSKEESGTLHHFDPETRLLTIHARLNPGQRAFRMATELGYLEANDLIEGIVDDGIWSTPEARTLAIRGVASYFAAAVMLPYKIFHSEAEKSGYDIEYLGQLFGVGYETTAHRLSTLQRPNLRGIPFTFVRVDRAGNMSKRQSATGFHFTHYGGTCPLWNVFETFTNPGQVLRQFAQMPDGRNYLWISRTVRHHEARFGEVDKMFAIGLGCEARHADRTVYSRGFNLQDLSTATPIGSGCRVCTRENCAQRAFPSVHGRINIDAHESTIAPY
>NZ_CP007724.1|WP_051904583.1|436181_437933_+|hypothetical-protein
MENRTLDAGDNVGESSMHRLITWLQNRRLMWISALAVVLVVVLIIGLTFAFNSNNDEEPTDDVSRSESPVPKPSEEPDKTLDSDGDGIPDVVELGGWKTVGGEIYRTDPNNADTDSDGLSDGEEAGEVISGEGFGAVYAGIADPTEADSDGDGLDDREEVLGWTTTRGEQFFTDPMKPDTDGDGLDDGVEAGIVFGTPSQQATYPGYSDPTKKDTDEDGLDDVAEADNGTDPYSRDTDGDGLSDQHEVEVIGTDPLSTDTDDDGLDDRYEDEHREDEGLDPLFAEAPRMTKKEHALEFAKGAFAGDILPGDSIAWLSGNLSAVGVGFVPAIGWVFGTLGDLRDIIANVIQRDWVSASFNLAGLVPYGGDTANASRKVVAFVKANPHLIAGVGALVVTHKYLPENIKTEILKKIWKSWDFHIDAGSNPKALKRLQKSGRIDLDAIKEAMQGPLHVRGESVKFMPHWKQGEIQLAHTLRMTSRNVSTQVRVNTDGCVQVCNSVRRDFDVVADGVAHESKVGYVALTENIRAQINSDAYLMSRGDIAAAHWHFYPSGITSQVGANKNVIALLEEKGIKYTIHLPRS
>NZ_CP007724.1|WP_038582481.1|448200_449178_-|winged-helix-DNA-binding-domain-containing-protein
MPALSLGRVRALRLISQLLAPSAALNFKSERNAVDVAKHMLASQAQLRGSALVALDTRAENADAATALEKSLLIRSWTQRGTHQILAAEDVRWMTLLCSPRILAASAKRRSSLSLDSAAVQRARDALATAAEKSPVSRTQAYEIFRSADVDPGENRGQHLLRHFGGEGDIVQGPPINGEDSFVLLDSICPLSLALTGDEALTEMTRRYFYSRGAATQKDLVWWTGLTVRDVKKGIAAVSAEGSIAAVQGPNGEEMWIPTWAQDVTETEVNDALALELTLPAFDEYLLSYTDRSHVMDPEHLFSIGPGKNGVFKPFKVIHGEALPV
>NZ_CP007724.1|WP_038582484.1|449249_450554_+|DUF445-domain-containing-protein
MGKHEVAQQTVPGPSPEMEAQRRKELRKHKAIATGLLIFAAAVYFLCRFVETRPGETAAWVGFVRAAAEAGMIGGLADWFAVTALFRHPLWLPIPHTAIIPRKKDQLGEALSGFVGDNFLNAQLITEKVSQARIPERAGEWLAQPENGEKVSREVGKLTANIVRAIDPSDAEAVIKSAVIDKLAEPTWGPPAGRLLEQLLAEGKAEPVVQELAQWLHKKALGSEPLIDRLLNERRPIWAPKFTAQLVSGKVYDEVIKFTEAVAADPNHEARKSLRRFLNKLAQDLQHDPDMIIKVEEIKRDIMGSGAIAQAAPTIWASASESLIESAEDESSILRRKISEAATSWGQRLLVDDSLRHSLDTRITGAAAFLADNYAPEVTGIISETIERWDAEEASEKIELMVGKDLQYIRLNGTIVGALAGLAIYAISHILFGA
>NZ_CP007724.1|WP_003855472.1|450569_450992_+|hypothetical-protein
MSDAKDDSILSKWSNAASELSGAVSGVAKKLREELSEKETFSKLKTEASEAVDQAKSGSYLDAGKEFARDAGSIIKDAAKTVKGAVSDSDKNDVKSAFGDAVEASRDKFDDTLEKRKAKKDSPEPGDDDIIDGEVIPPQN
>NZ_CP007724.1|WP_038582487.1|451010_451316_+|DUF2516-family-protein
MDISMLNVITSYTVWAIFAIIGICGFVGAFLAATTREDAFEVADRQKKMVWVAILIASGFVLTVLGPSIPILPWVAIIMIGLYWFDVRPQIKSILEGAGGW
>NZ_CP007724.1|WP_038582491.1|451471_452125_+|TetR/AcrR-family-transcriptional-regulator
MDIEEQPSLRETKRQKTLEAIEDNATRLILERGFDNVTIEDICAEAGISKRTFFNYVESKEAVAIGHTAKLPTDEEREGFLATRHENIIDTVFDLVINLFGNHDNSKSGVAGDIMRRRKEIRVKHPELAVQHFARFHQAREGLEHLIVEYFEKWPGSQHLDESADREAIAIVGLLISVMLQGSREWHDMPQGTQADFQACCRKAIKNTFLLRGGFSE
>NZ_CP007724.1|WP_038582494.1|452121_453771_+|MFS-transporter
MTSQVKPDDERPVTTISKSGAPSAHTSAPYGAAATEEAVEEKTTGRVGFIIAALMLAMLLSSLGQTIFGSALPTIVGELGGVNHMTWVITAFLLGQTISLPIFGKLGDQFGRKYLFMFAIALFVVGSIIGALAQNMTTLIVARALQGIAGGGLMILSQAITADVTTARERAKYMGIMGSVFGLSSILGPLLGGWFTDGPGWRWGLWLNVPIGIIALVAIAVLLKLPARERGKVSVDWLGSIFMAIATTAFVLAVTWGGNEYEWASPMIIGLFITTLVAAIVFVFVEKRAVDPLVPMGLFSNRNFVLTAVAGIGVGLFMMGTIAYMPTYLQMVHGLNPTQAGLMLIPMMIGLIGTSTVVGNIVSKTGKYKWYPFIGMLIMVLALVLLSTLTPSASLALIGLYFFVFGFGLGCAMQILVLIVQNSFPITMVGTATGSNNFFRQIGGAVGSALIGGLFISNLSDRFTENVPAAVASMGEEGAQYASAMSDFSGASNLTPHLVESLPQALREAIQLSYNDALTPIFLALTPIAVVAAILLFFIREDHLKETHE
>NZ_CP007724.1|WP_038582496.1|453770_455405_+|MFS-transporter
MTHETSVPGPADAQVAGDTKLRKGRAKKEKTPSSMTPEQQKKVWWVLSALMVAMMMASLDQMIFGTALPTIVGELGGVDHMMWVITAYLLAETIMLPIYGKLGDLVGRKGLFIGALGIFLIGSVIGGLAGNMTWLIIGRAVQGIGGGGLMILSQAIIADVVPARERGRYMGVMGGVFGLSAVLGPLLGGWFTEGPGWRWAFWMNIPLGIIAIGVAIYFLDIPKKSVKFRWDYLGTFFMIVAATSLILFTTWGGSQYEWSDPIIIGLIITTIVAAALLVVVELRAEDPLVPMSFFQNRNFTLTTIAGLILGIAMFGIIGYLPTYLQMVHGINATEAGYMLIPMMVGMMGTSIWTGIRISNTGKYKLFPPIGMVVTFVALIFFARMEVSTTLWQIGIYLFVLGVGLGLAMQVLVLIVQNTLPTAVVGSATAVNNFFRQIGSSLGSALVGGMFVGNLGTLMEERMPAAMAQLSPEEQAAMAAQGGLDSNELTPAIVNQLPTVLHDAFAGSYNDALIPVFYVMMPLIGIALLLLLFIKQEKLRETTTD
>NZ_CP007724.1|WP_011896668.1|455477_456392_-|formyltetrahydrofolate-deformylase
MTPSSPEVRNRPSTAPEERQFVLTFGCPDSTGIVAKLSSFLAERGGWITEAGYFTDPDSNWFFTRQAIRAESIDTTIEQLREEFAPLAEEFGPRAKWSFTDTAQVKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAVVGNHENLRYIAENHNVPFFHVPFPKDAVGKRKAFDQVAEIVNGYDPDAIVLARFMQILPPDLCEMWAGRVLNIHHSFLPSFMGARPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVIRVTHKDTPTEMQRLGRDAEKQVLARGLRFHLEDRVLVYGNRTVVFD
>NZ_CP007724.1|WP_020309525.1|456446_457121_+|deoxyribose-phosphate-aldolase
MDMTISRATMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTICVPNSMVNLTAKAQEAGIRVATVAGFPHGKTPALVKAAEARLAVQSGASEVDVVLDIAVVKEGDANRLLQEIVAIREAVPNPVVLKFILETAVVSDDAIVTAVNALIAAGADFAKTSTGFHPAGGATVEAVRVMASASRGRVGIKAAGGVKTWEDAVAFVEAGATRIGTSNAGAILEGAPE
>NZ_CP007724.1|WP_038582499.1|457522_458392_+|hypothetical-protein
MKPIRFEDVQHEMNRRQFSAKYTRVVGTFWIKKEYAENPVVVADALLRRFPNGVIRGFTALIVRGYSLLDEPRTAEISVPRGASHVTVLLGKVVRHKMPEVHVVKGRRCVSVAQALLDEFPEMVLEQQVALVDHLVRQNEDLYKQLQQVKALKEVMRLVNPMAESRPESMLRVRLRREGIWGFEPQIPVECDGVTRFVDLGNPKLRIALEYQGAVHFEDAEKRSQDSRRVNELRAAGWVVIEVTWPDLADQARWGRLLTELRKQIGRAEEERKMRRTPIPMPPDPFRPY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP007724_2	2.1\|447210\|25\|NZ_CP007724\|CRISPRCasFinder	447210-447234	25	NZ_CP009216	Corynebacterium ureicelerivorans strain IMMIB RIV-2301 plasmid unnamed, complete sequence	40116-40140	5	0.8

1. spacer 2.1|447210|25|NZ_CP007724|CRISPRCasFinder matches to NZ_CP009216 (Corynebacterium ureicelerivorans strain IMMIB RIV-2301 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

tagctgttcgtcaatgcctgccctg	CRISPR spacer
tagctgttcgtcaatgcccgcggcc	Protospacer
******************.**  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

34952 : 80759

Escherichia_phage(55.56%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038586652.1\|34952_35612_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_038581881.1\|37879_38104_+	hypothetical protein	NA	NA	NA	NA
WP_162472690.1\|38375_38525_-	hypothetical protein	NA	NA	NA	NA
WP_003861074.1\|39091_39364_-	cell division protein CrgA	NA	NA	NA	NA
WP_038581883.1\|39476_41420_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A2R3ZRI5	Marseillevirus	7.0e-16	31.5
WP_038581885.1\|41416_42826_-	serine/threonine protein kinase	K7YID8	Megavirus	1.2e-17	31.2
WP_038581886.1\|42829_44254_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_038581888.1\|44250_45576_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_044029636.1\|45572_46928_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_003855394.1\|46927_47392_-	FHA domain-containing protein	NA	NA	NA	NA
WP_003861088.1\|47408_48305_-	DUF3662 and FHA domain-containing protein	NA	NA	NA	NA
WP_038586655.1\|48800_49181_-	hypothetical protein	NA	NA	NA	NA
WP_080724052.1\|52563_52983_+	hypothetical protein	NA	NA	NA	NA
WP_038581893.1\|53123_54290_-	hypothetical protein	NA	NA	NA	NA
WP_145973342.1\|54312_54750_-	hypothetical protein	NA	NA	NA	NA
WP_044029638.1\|55373_57161_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_038581903.1\|58439_59066_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	8.5e-24	36.4
WP_038581905.1\|59585_60737_+	hypothetical protein	NA	NA	NA	NA
WP_038581909.1\|61495_61822_+	hypothetical protein	NA	NA	NA	NA
WP_145973343.1\|62304_62604_-	hypothetical protein	NA	NA	NA	NA
WP_010889963.1\|62850_63561_+\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5
WP_038586668.1\|63833_64049_+	hypothetical protein	NA	NA	NA	NA
WP_038581924.1\|67920_68379_-	hypothetical protein	NA	NA	NA	NA
WP_038581926.1\|69206_69917_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	57.3
WP_038586680.1\|70080_71307_+	hypothetical protein	NA	NA	NA	NA
WP_034982465.1\|71978_72242_+	hypothetical protein	NA	NA	NA	NA
WP_051907067.1\|72243_72588_-	hypothetical protein	NA	NA	NA	NA
WP_162472691.1\|72858_72999_+	hypothetical protein	NA	NA	NA	NA
WP_003858908.1\|73521_73782_+	hypothetical protein	NA	NA	NA	NA
WP_003858906.1\|73781_74183_+	hypothetical protein	NA	NA	NA	NA
WP_010889963.1\|74664_75375_-\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5
WP_044029642.1\|76076_77108_-	recombinase family protein	M4QQC6	Vibrio_phage	2.8e-19	40.5
WP_051904565.1\|77310_77850_-	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_010889963.1\|77924_78635_+\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5
WP_003858644.1\|78879_79338_-	hypothetical protein	NA	NA	NA	NA
WP_010889963.1\|80048_80759_+\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5

DBSCAN-SWA_2

1414449 : 1470312

Iris_mild_mosaic_virus(12.5%)

tRNA,integrase,protease,transposase

attL 1459223:1459274|attR 1472852:1472903

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038583803.1\|1414449_1415940_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_003854060.1\|1416011_1416227_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038583806.1\|1416227_1416701_-	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_038583808.1\|1416817_1417342_-	hypothetical protein	NA	NA	NA	NA
WP_162472705.1\|1417426_1417930_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_038583812.1\|1417965_1418487_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_038583815.1\|1420222_1421200_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_038583818.1\|1421523_1423320_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_145973367.1\|1423644_1423935_-	hypothetical protein	NA	NA	NA	NA
WP_038586943.1\|1424473_1424803_+	hypothetical protein	NA	NA	NA	NA
WP_038583821.1\|1425015_1427403_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	6.4e-19	47.7
WP_038583828.1\|1427814_1429224_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_162472698.1\|1429849_1431253_-\|transposase	IS1380-like element IS1677 family transposase	NA	NA	NA	NA
WP_010991833.1\|1431782_1432139_-	hypothetical protein	NA	NA	NA	NA
WP_011015203.1\|1432143_1433766_-	hypothetical protein	A0A160DH52	Gordonia_phage	9.0e-17	32.4
WP_080724100.1\|1434008_1435376_-\|transposase	IS1380-like element ISCgl4 family transposase	NA	NA	NA	NA
WP_038583836.1\|1435947_1436427_-	hypothetical protein	NA	NA	NA	NA
WP_038583839.1\|1436487_1437054_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	7.0e-09	36.8
WP_003861499.1\|1437036_1437744_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_038583842.1\|1437924_1439370_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_011014282.1\|1439387_1439981_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_162472699.1\|1440439_1441843_+\|transposase	IS1380-like element IS1677 family transposase	NA	NA	NA	NA
WP_011265722.1\|1442020_1443031_-	NUDIX hydrolase	NA	NA	NA	NA
WP_003858849.1\|1443308_1444307_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003861506.1\|1444331_1445414_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_038583847.1\|1445470_1446451_-	DUF3515 domain-containing protein	NA	NA	NA	NA
WP_044029946.1\|1446518_1447508_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_038583862.1\|1447507_1448257_+	uracil-DNA glycosylase	S4VZ65	Pandoravirus	5.6e-30	35.7
WP_038583864.1\|1448268_1449972_+	DAK2 domain-containing protein	NA	NA	NA	NA
WP_038583867.1\|1449976_1452100_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_003858832.1\|1452119_1452335_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003858829.1\|1452334_1452919_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_038583872.1\|1452922_1453405_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.5e-15	30.8
WP_003858826.1\|1453976_1454741_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-19	28.9
WP_038583875.1\|1454744_1455695_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003858822.1\|1455737_1456742_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003858818.1\|1456841_1457651_+	DUF1266 domain-containing protein	NA	NA	NA	NA
WP_003858816.1\|1457733_1458714_-	DUF368 domain-containing protein	NA	NA	NA	NA
1459223:1459274	attL	NA	NA	NA	NA
WP_003858814.1\|1459361_1460051_-\|integrase	site-specific integrase	G9FH48	Rhodococcus_phage	2.1e-15	36.2
WP_003858812.1\|1460060_1460516_+	hypothetical protein	NA	NA	NA	NA
WP_003861519.1\|1460512_1461259_+	hypothetical protein	NA	NA	NA	NA
WP_003858809.1\|1461451_1461886_+	metallopeptidase	NA	NA	NA	NA
WP_089158527.1\|1462564_1463766_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.5e-27	34.2
WP_003858803.1\|1463871_1464486_+	DUF4258 domain-containing protein	NA	NA	NA	NA
WP_003858801.1\|1464488_1464710_+	DUF2283 domain-containing protein	NA	NA	NA	NA
WP_038583885.1\|1465358_1465793_-	hypothetical protein	NA	NA	NA	NA
WP_003858799.1\|1465808_1466024_-	hypothetical protein	NA	NA	NA	NA
WP_003858795.1\|1466462_1466834_-	hypothetical protein	NA	NA	NA	NA
WP_003858794.1\|1466908_1467121_+	hypothetical protein	NA	NA	NA	NA
WP_003858792.1\|1467550_1467754_+	hypothetical protein	NA	NA	NA	NA
WP_003861526.1\|1468725_1469103_-	hypothetical protein	NA	NA	NA	NA
WP_003861528.1\|1469361_1470312_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
1472852:1472903	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2458297 : 2508642

Escherichia_phage(28.57%)

integrase,protease,transposase

attL 2452754:2452768|attR 2475046:2475060

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2452754:2452768	attL	NA	NA	NA	NA
WP_038585363.1\|2458297_2459041_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_038585370.1\|2461301_2462180_+	nickel pincer cofactor biosynthesis protein LarB	A0A096XTB6	Enterococcus_phage	9.2e-16	37.9
WP_089158527.1\|2463754_2464955_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.5e-27	34.2
WP_044030199.1\|2465317_2466070_+	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_044030201.1\|2466143_2466944_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_011015149.1\|2466953_2467613_+	oligoribonuclease	M4M9I5	Vibrio_phage	3.4e-23	37.4
WP_003860847.1\|2467609_2468854_-	esterase family protein	NA	NA	NA	NA
WP_038585376.1\|2469041_2470253_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_038585379.1\|2471033_2471681_+	hypothetical protein	NA	NA	NA	NA
WP_155274390.1\|2471690_2471834_-	hypothetical protein	NA	NA	NA	NA
WP_010889963.1\|2471832_2472543_+\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5
WP_038585382.1\|2473259_2473469_+	hypothetical protein	NA	NA	NA	NA
WP_080724205.1\|2473465_2474092_-	hypothetical protein	NA	NA	NA	NA
WP_038585385.1\|2474149_2475391_-	glutaminase	NA	NA	NA	NA
2475046:2475060	attR	NA	NA	NA	NA
WP_080724136.1\|2475435_2475747_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_158407474.1\|2475661_2476039_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_038585404.1\|2476103_2476520_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_038585407.1\|2476590_2478147_+	glucuronate isomerase	NA	NA	NA	NA
WP_038585410.1\|2478300_2478804_+	gluconokinase	NA	NA	NA	NA
WP_038585413.1\|2478967_2480134_+	HNH endonuclease	NA	NA	NA	NA
WP_038585417.1\|2480207_2480768_+	isochorismatase family protein	A0A1V0SL12	Klosneuvirus	6.5e-07	21.1
WP_003857689.1\|2480807_2481083_-	DUF3618 domain-containing protein	NA	NA	NA	NA
WP_038585419.1\|2481255_2481732_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_044030205.1\|2481753_2482419_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_038585426.1\|2482408_2482816_-	holo-ACP synthase	NA	NA	NA	NA
WP_038585429.1\|2482826_2484284_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_162472694.1\|2484466_2484616_-	hypothetical protein	NA	NA	NA	NA
WP_010889963.1\|2486721_2487432_-\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5
WP_038585435.1\|2495754_2495961_-	hypothetical protein	NA	NA	NA	NA
WP_038585438.1\|2496846_2498031_-	PucR family transcriptional regulator	NA	NA	NA	NA
WP_038585443.1\|2498206_2498782_+	M23 family metallopeptidase	A0A1C9M0Q3	Mycobacterium_phage	4.4e-27	44.4
WP_003857998.1\|2499055_2499520_+	hypothetical protein	NA	NA	NA	NA
WP_003857996.1\|2499600_2499957_+	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_044030210.1\|2500030_2500651_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_003857993.1\|2500677_2501415_-	ribonuclease PH	NA	NA	NA	NA
WP_044030212.1\|2501539_2503060_-	hypothetical protein	NA	NA	NA	NA
WP_038585452.1\|2503192_2503960_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_034983156.1\|2504062_2504917_-	glutamate racemase	NA	NA	NA	NA
WP_038585464.1\|2504967_2505594_+	hypothetical protein	NA	NA	NA	NA
WP_038585467.1\|2505603_2506098_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_038585470.1\|2506127_2506877_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_038585473.1\|2506873_2507788_-	P1 family peptidase	NA	NA	NA	NA
WP_003857980.1\|2507787_2508327_-	DUF2017 domain-containing protein	NA	NA	NA	NA
WP_038587061.1\|2508339_2508642_-\|protease	ATP-dependent Clp protease adapter ClpS	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP007725

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007725_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007725_1

4385-4597

TypeV-U4

Consensus_repeat	Method
GGGATCTTCCTCGTGTGCGTGGGAAGAACA	CRISPRCasFinder

3 spacers

c2c9_V-U4

The CRISPR arrays of NZ_CP007725_1

>merge|NZ_CP007725|1|4385-4597|CRISPRCasFinder
GGAATGCCCCTTACGCGTGTGGGAAGAACACGTGTGACCGTTTATGCGCAGACGTGTGACCGGGATCTTCCTCGTGTGCGTGGGAAGAACATACGGGACAGTTTATGCGCGAATACGGGACAGGGATCTTCCTCGTGTGCGTGGGAAGAACATGTGCTCGTATCCCAACATTTGGCGTGCGTCGGGATCTTCCTCGTGTGCGTGGGAAGAACA

>NZ_CP007725|1|1|4385-4597|CRISPRCasFinder
GGAATGCCCCTTACGCGTGTGGGAAGAACA	CGTGTGACCGTTTATGCGCAGACGTGTGACC
GGGATCTTCCTCGTGTGCGTGGGAAGAACA	TACGGGACAGTTTATGCGCGAATACGGGACA
GGGATCTTCCTCGTGTGCGTGGGAAGAACA	TGTGCTCGTATCCCAACATTTGGCGTGCGTC
GGGATCTTCCTCGTGTGCGTGGGAAGAACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007725.1\|WP_010991829.1\|10085_10466_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP007725.1\|WP_010991827.1\|10996_11596_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP007725.1\|WP_158407477.1\|4672_6250_-\|transposase	c2c9_V-U4	-	gnl\|CDD\|223747
NZ_CP007725.1\|WP_162472710.1\|7515_8127_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP007725.1\|WP_044030538.1\|8958_10014_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007725.1\|WP_051904642.1\|12598_14068_+\|replicase-RepA	unknown	unknown	gnl\|CDD\|376986
NZ_CP007725.1\|WP_080724222.1\|762_4143_+\|relaxase-domain-containing-protein	unknown	unknown	gnl\|CDD\|378042
NZ_CP007725.1\|WP_040145020.1\|14288_15248_+\|XamI-family-restriction-endonuclease	unknown	unknown	gnl\|CDD\|312917
NZ_CP007725.1\|WP_010991826.1\|11595_11823_+\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|369567
NZ_CP007725.1\|WP_040145021.1\|12135_12399_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP007725.1\|WP_040145025.1\|6852_7146_+\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|227054

Protein	Function_ID	Function_description	E-value
NZ_CP007725.1\|WP_010991829.1\|10085_10466_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	3.31008e-14
NZ_CP007725.1\|WP_010991827.1\|10996_11596_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.11302e-28
NZ_CP007725.1\|WP_158407477.1\|4672_6250_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.09153e-32
NZ_CP007725.1\|WP_162472710.1\|7515_8127_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	6.82119e-46
NZ_CP007725.1\|WP_051904642.1\|12598_14068_+\|replicase-RepA	gnl\|CDD\|376986	pfam03090, Replicase, Replicase family. This is a family of bacterial plasmid DNA replication initiator proteins. pfam01051 is a similar family. These RepA proteins exist as monomers and dimers in equilibrium: monomers bind directly to repeated DNA sequences and thus activate replication; dimers repress repA transcription by binding an inversely repeated DNA operator. Dimer dissociation can occur spontaneously or be mediated by Hsp70 chaperones.	7.77567e-39
NZ_CP007725.1\|WP_080724222.1\|762_4143_+\|relaxase-domain-containing-protein	gnl\|CDD\|378042	pfam08751, TrwC, TrwC relaxase. Relaxases are DNA strand transferases which function during the conjugative cell to cell DNA transfer. TrwC binds to the origin of transfer (oriT) and melts the double helix.	1.36285e-61
NZ_CP007725.1\|WP_040145020.1\|14288_15248_+\|XamI-family-restriction-endonuclease	gnl\|CDD\|312917	pfam09572, RE_XamI, XamI restriction endonuclease. This family includes the XamI (recognizes GTCGAC but cleavage site unknown) restriction endonuclease.	3.43178e-94
NZ_CP007725.1\|WP_010991826.1\|11595_11823_+\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|369567	pfam07878, RHH_5, CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5. This family contains bacterial proteins that form a ribbon-helix-helix fold. This fold occurs in many examples of bacterial antitoxins.	0.00613989
NZ_CP007725.1\|WP_040145025.1\|6852_7146_+\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|227054	COG4710, COG4710, Predicted DNA-binding protein with an HTH domain [General function prediction only].	1.06033e-05

>NZ_CP007725.1|WP_080724222.1|762_4143_+|relaxase-domain-containing-protein
MHSQSVAYYESTVDDAPSPDGYYSEAGSAPAQAWVKGENAAGYARLLGVEQGQILNGGEVASWFNKVTSPKGDKLGRALRADGVPGFDLTFCAPKSVSVLWGLSGRDQVRAIVDQAHSAAVSTALDYLNTHAAYTRLWDESETLIVDKTLGLSGVKYEHRTSRAGDPHVHSHVLLANRQLCADGKARALDGVSLYHEARAAGMLYQAALREELTRHLGVTWGAVTNGQADIVGLDDRGLLEAFSTRTTEISQWEEKNSLPHNYQLQRVGQKTTRQVKDVDASVSELEDRWGMHEDAVARVEQIIADADTAESPTAPQTQVLPTPEAVLAEVITERSTFTRADVVEKCAEMIPVGALTVDEIVEFAEVTATQALESVALSVTPERAREVDKTQREGSQRFTTDVVIEEVNRGIDLATTRTHNAVLAASIQPVEGVLSPAQARAMTAVVSSDFLASVVVAPAGAGKTSSLKAARQVWEQAGRTVVGLAPTGKAADVMVGEQVAHESSTIARALYGTQDLSPADVAARLGWDRSTVVVVDEAGMVSTPDVVRLLEIARAADARMVLVGDPQQYGAVKARSGMLATLAYELPDAVELTEVFRQRDAAERAASIQLRSGDKESIKRAGQWYMLNDRLFAGSVTAMLDDALAGWSADTAAGKDSLLVAVTGEQVQALNAGAQKIRAERGELDLSEARELSTGQWLHAGDVLLSRKNDYDLTTSAGDVVRNGQRWRVDQLHGDGSISVTRLDQTRARAVLPAAYLRESGQLGYASTGHSAQGATVDVARVVAGAGQVDRASVYVPLTRGREGNYLYLTESMPGDSAEGHGRVMPVARREEGDYPRDLLIAAAVRDGADLTPHQVWGKARSDWELTRLAAGHGIEESPFTGTRMGEMMAAREALRDARWRAEYESVTPLPVRVKRTPKTQASAKKVATGLVDRVSTPKDQGMMSREERDARLAAAERALEEVEQRQRVVNGEHRELVRQLQQANDEVHDVVRQVDRLGYQIAARQRARENRGVLAKLFKPNAGVEEIEQLSAQKVALEQQHTELVEHREKVFEEVQVVQERREEVREECSRARTAVAFAFTEQLQPTPLNLNASSFSKSSGADLNAHQQFGMNQSRGHDHGMDM
>NZ_CP007725.1|WP_158407477.1|4672_6250_-|transposase
MVFRGARFRLDPTGEQQGILSQQAGAARVAYNMMCTLNKDILEARSQLYSTLIKDGKTKDKAKKELKAAAKEDPSLAIVWARDFDKNYITPERNRHKHAAQRIAAGENPVDVWNPDEERFNEPWLHTANRRVLRSGQKQYEQALDNFFKSQNGSRAGQKMGKPRFKTKIRSTDSFTIDAVDVSSSTTLIRDIGPKDHARYKTGEASTGIIADYRHVRLSHLGTFRVFGSTKALVRQLDRGGRIKSCTVSRSADRWYVSFLVELPIEIARSTPTKKQYKAGAVGIDLGVKSLAALSTGEIIPNPRFLRTADKKIKKLQRKIARCQKGSKNSIRLKRRLARCHHELALQRAGYLNELTSMLASSFSAIALEDLNVAGMTSSARGTVENPGKNVKQKAGLNRSILDISPGRIRTLLEYKCTDRGVELQVIDRFFPSSQLCSSCGSKTTIPLAQRIYHCDVCGGVIDRDVNAAINIVYEAKRLVEQKCSEHSAPEGAEDKRPWSVHLPSTQYVDGLYTRKRQGPSGHSS
>NZ_CP007725.1|WP_040145025.1|6852_7146_+|ribbon-helix-helix-protein,-CopG-family
MATDKQRSYVGRGPVVSVRLEPELVERLDALSERTRRSRGTYLRMAIWAMLPELEKMHWEQAAADFESLAIKDAFEEITQHLMDEAINRANKDSNDA
>NZ_CP007725.1|WP_162472710.1|7515_8127_-|recombinase-family-protein
MQTAQTPAPPAPKATASGQRVGYLRVSSTDQNLARQREALGVLDREFVDELSARSRAHRPALEECMAYLRTGDELVVASIDRLARSLVDLRTIIDQVTAKGASVRFLKEGLVFSATDQDPRATLMLGILGSFAEFERSIIRERQAEGIALAKKAGKYTGRKRALSPEQVEHARMRVEAGETKTAIAQGLGVGRATLYRALSVD
>NZ_CP007725.1|WP_044030538.1|8958_10014_+|hypothetical-protein
MAQTENDPAGGNDPAGGIRLSTVVAAGVMCAVASGVASAVVVLVIDRPQREPVGEWISNFAQSLGLAGLSAIVAAALALCGIYQQVSVARQGLEDQRETEANRVQQERETEANRAWWERFEWAANRAVPASKDSIPLPYDAILNTLTALLKTATDDVQRATVRAVVDEAAKRNEDFGKRDDNMKQALQNYASSAGKTSAHSVMVDGLLYEYEAIEALESVVYPGKVQGHKRVSGKPEAGSHRGAVTREVDAMVFYRGKTIVVEAKYSKNKEELDLRRTKDAVARTRSLIGISGADAGLIVSPGGLRSGVLDQESGNILDVAWESSKDDTALQSVLDRLVAISDSAEGSSSS
>NZ_CP007725.1|WP_010991829.1|10085_10466_+|ParA-family-protein
MSILTIAHTKGGVGKTTSAVLLCAAAHARGIAVTLIDSEAQGIATARGLAGWHAARCNRSHRQGGSRQPCGYWCAMGLRPGSGPTAPLGHQRVPVPERRPGPPHFPPSLRESRTRRRGGFPWTPGE
>NZ_CP007725.1|WP_010991827.1|10996_11596_+|ParA-family-protein
MSILTIAHTKGGVGKTTSAVLLCAAAHARGLAVTLIDSDAQGTATAWAHAAEEAGDTFPWPIITAATPAHLARTLDGHNGLVIVDTPPGGYEVIETAIEAGDLILIPTSASPLDINRVWPTVEATSHKPAVVCLSQIDSRTTLPKIARTALENEGVVVAETEIPAREALRHMYATTPQRLYGYDELLTELLSSNLLGEH
>NZ_CP007725.1|WP_010991826.1|11595_11823_+|ribbon-helix-helix-protein,-CopG-family
MADLSKKLAKAPVTSAPQKKVAETFTTATEKPTRTTIYLPTSLAKRLKHAAVEEERSVSAILAGLAEDWLNKEDD
>NZ_CP007725.1|WP_040145021.1|12135_12399_+|hypothetical-protein
MPPARRGSRTTTGRKTARPSAATPTPIDEEGTELTRRTTIYLKGETWKSMKLMTIETGESVSAYIERLIDKDVKRVQKKLLQNPKSL
>NZ_CP007725.1|WP_051904642.1|12598_14068_+|replicase-RepA
MSLPSKGRSSTPAGVRVAQPLPTHRDTGGLDDTPAGFTDRDALIDHLGRKAIHGSKDRDFGKAYYRHEDGTLRPRLYRVDSEALTRCQYVMLTTQQYAAVLVVDIDQPGQSGGHPANLSPEVRQKMAALIEHNLGPSWVGINPQNGKAQAIWLIDPVYADKSGKSRHMSLLAATSRALGALLDHDPNFSHRFSRSPFYDGNDPTAYRWYCQHKHVRRLADLLKEIRTMTGQEQYTKPQQQFSSGRELINAVKTRREEAQAFKALAQDVETELSTELDQYDPELIDGVRVLWISQGRAARDETAFRYALKTCHRLRAAGERMTDAAIIDAYEHAYNVAQRQGGDGRDSEMPPMRDRQTMARRVRGYVTQSKTDIGTSVSPGRATSTERKALATMGRRGGKKAAERWKDRESHYAQTELEKLADASKKRSRKAKGTRLTIAGWVMNVESETGMWPTIAETMVEFSVSRETVKRALRSAGIELPRGRRKISN
>NZ_CP007725.1|WP_040145020.1|14288_15248_+|XamI-family-restriction-endonuclease
MSFVINRLRSDLWKADTLASVEQYNNWFFEAAPDAYQTARAIVQKQVLDLMEATNFMRDITPEVIFEKPELLETLRQGTAPPIARDRLSGLSGVARHLVKRLEEGHLPQRTKRDVLERDIQALCDVIERLLDHDLFDWLATSENPTEKQKLLASVVVSDRKTGAIADPVIRNAQERRQLSVIRAWLLERGYKEKPHDNLKPFTDMTPGTFSFRQIFPALKEDGTSVGMPIDAVIQPHNLYDSGLPLLVEAKSAGDFTNTNKRRKEEATKLTQIRRAENEANFILFLCGYFDASYLGYEAAEGIDWVWEHRLKDFELAGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_CP007723	Corynebacterium glutamicum strain ATCC 21831 plasmid unnamed, complete sequence	12718-12748	0	1.0
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_CP007725	Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence	4415-4445	0	1.0
NZ_CP007725_1	1.2\|4476\|31\|NZ_CP007725\|CRISPRCasFinder	4476-4506	31	NZ_CP007723	Corynebacterium glutamicum strain ATCC 21831 plasmid unnamed, complete sequence	12657-12687	0	1.0
NZ_CP007725_1	1.2\|4476\|31\|NZ_CP007725\|CRISPRCasFinder	4476-4506	31	NZ_CP007725	Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence	4476-4506	0	1.0
NZ_CP007725_1	1.3\|4537\|31\|NZ_CP007725\|CRISPRCasFinder	4537-4567	31	NZ_CP007723	Corynebacterium glutamicum strain ATCC 21831 plasmid unnamed, complete sequence	12596-12626	0	1.0
NZ_CP007725_1	1.3\|4537\|31\|NZ_CP007725\|CRISPRCasFinder	4537-4567	31	NZ_CP007725	Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence	4537-4567	0	1.0
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_KU306397	Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence	27608-27638	2	0.935
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_KU306397	Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence	27630-27660	2	0.935
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_KU306397	Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence	27652-27682	2	0.935
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_KU306397	Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence	27674-27704	2	0.935
NZ_CP007725_1	1.1\|4415\|31\|NZ_CP007725\|CRISPRCasFinder	4415-4445	31	NZ_KU306397	Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence	27696-27726	2	0.935

1. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_CP007723 (Corynebacterium glutamicum strain ATCC 21831 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
cgtgtgaccgtttatgcgcagacgtgtgacc	Protospacer
*******************************

2. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_CP007725 (Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
cgtgtgaccgtttatgcgcagacgtgtgacc	Protospacer
*******************************

3. spacer 1.2|4476|31|NZ_CP007725|CRISPRCasFinder matches to NZ_CP007723 (Corynebacterium glutamicum strain ATCC 21831 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tacgggacagtttatgcgcgaatacgggaca	CRISPR spacer
tacgggacagtttatgcgcgaatacgggaca	Protospacer
*******************************

4. spacer 1.2|4476|31|NZ_CP007725|CRISPRCasFinder matches to NZ_CP007725 (Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tacgggacagtttatgcgcgaatacgggaca	CRISPR spacer
tacgggacagtttatgcgcgaatacgggaca	Protospacer
*******************************

5. spacer 1.3|4537|31|NZ_CP007725|CRISPRCasFinder matches to NZ_CP007723 (Corynebacterium glutamicum strain ATCC 21831 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgtgctcgtatcccaacatttggcgtgcgtc	CRISPR spacer
tgtgctcgtatcccaacatttggcgtgcgtc	Protospacer
*******************************

6. spacer 1.3|4537|31|NZ_CP007725|CRISPRCasFinder matches to NZ_CP007725 (Corynebacterium glutamicum strain AR1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgtgctcgtatcccaacatttggcgtgcgtc	CRISPR spacer
tgtgctcgtatcccaacatttggcgtgcgtc	Protospacer
*******************************

7. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_KU306397 (Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence) position: , mismatch: 2, identity: 0.935

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
tgtgtgaccgtttatgcgcagatgtgtgacc	Protospacer
.*********************.********

8. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_KU306397 (Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence) position: , mismatch: 2, identity: 0.935

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
tgtgtgaccgtttatgcgcagatgtgtgacc	Protospacer
.*********************.********

9. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_KU306397 (Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence) position: , mismatch: 2, identity: 0.935

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
tgtgtgaccgtttatgcgcagatgtgtgacc	Protospacer
.*********************.********

10. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_KU306397 (Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence) position: , mismatch: 2, identity: 0.935

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
tgtgtgaccgtttatgcgcagatgtgtgacc	Protospacer
.*********************.********

11. spacer 1.1|4415|31|NZ_CP007725|CRISPRCasFinder matches to NZ_KU306397 (Corynebacterium glutamicum strain DSM 1412 plasmid pBL90, complete sequence) position: , mismatch: 2, identity: 0.935

cgtgtgaccgtttatgcgcagacgtgtgacc	CRISPR spacer
tgtgtgaccgtttatgcgcagatgtgtgacc	Protospacer
.*********************.********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007724

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP007725

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection