CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009128	Burkholderia pseudomallei strain BSR chromosome 1, complete sequence	2 crisprs	cas3,DEDDh,csa3,DinG,WYL,RT	0	4	287	0
NZ_CP009127	Burkholderia pseudomallei strain BSR chromosome 2, complete sequence	3 crisprs	csa3,cas3,DinG	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009128_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009128_1

442904-442983

Orphan

Consensus_repeat	Method
ACGGAATGGGCCCCGGCATGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009128_1

>merge|NZ_CP009128|1|442904-442983|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATGGGCGGCGGCTACGGGCGCGGAATGATGGGCGGCTACGGAATGGGGCCCGGCATGATG

>NZ_CP009128|1|1|442904-442983|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATG	GGCGGCGGCTACGGGCGCGGAATGATGGGCGGCT
ACGGAATGGGGCCCGGCATGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009128.1\|WP_004536432.1\|451809_452157_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009128.1\|WP_004530511.1\|451035_451590_-\|YaeQ-family-protein	unknown	unknown	gnl\|CDD\|377782
NZ_CP009128.1\|WP_024431929.1\|436093_437185_-\|phage-portal-protein	unknown	unknown	gnl\|CDD\|222860
NZ_CP009128.1\|WP_004525837.1\|443935_444484_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009128.1\|WP_004523110.1\|439321_440434_-\|histone-deacetylase	unknown	unknown	gnl\|CDD\|212521
NZ_CP009128.1\|WP_004525842.1\|438435_439311_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
NZ_CP009128.1\|WP_004197761.1\|450414_450831_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319916
NZ_CP009128.1\|WP_004523120.1\|448918_450013_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	unknown	unknown	gnl\|CDD\|185333
NZ_CP009128.1\|WP_004531075.1\|444746_446195_+\|RNA-polymerase-sigma-factor-RpoD/SigA	unknown	unknown	gnl\|CDD\|274108
NZ_CP009128.1\|WP_161605795.1\|437769_438081_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009128.1\|WP_004535409.1\|446208_447822_-\|glutamate--cysteine-ligase	unknown	unknown	gnl\|CDD\|235001
NZ_CP009128.1\|WP_004200731.1\|435256_435739_+\|DUF2778-domain-containing-protein	unknown	unknown	gnl\|CDD\|378506
NZ_CP009128.1\|WP_004553744.1\|433714_434719_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369676
NZ_CP009128.1\|WP_004545654.1\|447980_448922_-\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP009128.1\|WP_017881331.1\|440462_441557_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP009128.1\|WP_004537736.1\|441699_442668_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP009128.1\|WP_004523107.1\|435735_436020_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009128.1\|WP_154218334.1\|433244_433613_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009128.1\|WP_004524601.1\|453879_454035_-\|lipoprotein	unknown	unknown	gnl\|CDD\|215083
NZ_CP009128.1\|WP_004524603.1\|452642_453203_-\|spermidine-N1-acetyltransferase	unknown	unknown	gnl\|CDD\|237916

Protein	Function_ID	Function_description	E-value
NZ_CP009128.1\|WP_004530511.1\|451035_451590_-\|YaeQ-family-protein	gnl\|CDD\|377782	pfam07152, YaeQ, YaeQ protein. This family consists of several hypothetical bacterial proteins of around 180 residues in length which are often known as YaeQ. YaeQ is homologous to RfaH, a specialized transcription elongation protein. YaeQ is known to compensate for loss of RfaH function.	1.52049e-103
NZ_CP009128.1\|WP_024431929.1\|436093_437185_-\|phage-portal-protein	gnl\|CDD\|222860	PHA02536, Q, portal vertex protein; Provisional.	0
NZ_CP009128.1\|WP_004523110.1\|439321_440434_-\|histone-deacetylase	gnl\|CDD\|212521	cd09996, HDAC_classII_1, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes bacterial as well as eukaryotic Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Included in this family is a bacterial HDAC-like amidohydrolase (Bordetella/Alcaligenes species FB18817, denoted as FB188 HDAH) shown to be most similar in sequence and function to class II HDAC6 domain 3 or b (HDAC6b). FB188 HDAH is able to remove the acetyl moiety from acetylated histones, and can be inhibited by common HDAC inhibitors such as SAHA (suberoylanilide hydroxamic acid) as well as class II-specific but not class I specific inhibitors.	1.0559e-172
NZ_CP009128.1\|WP_004523120.1\|448918_450013_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	gnl\|CDD\|185333	PRK15435, PRK15435, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada.	8.19665e-122
NZ_CP009128.1\|WP_004531075.1\|444746_446195_+\|RNA-polymerase-sigma-factor-RpoD/SigA	gnl\|CDD\|274108	TIGR02393, RNA_polymerase_sigma_factor_RpoD, RNA polymerase sigma factor RpoD, C-terminal domain. This model represents the well-conserved C-terminal region of the major, essential sigma factor of most bacteria. Members of this clade show considerable variability in domain architecture and molecular weight, as well as in nomenclature: RpoD in E. coli and other Proteobacteria, SigA in Bacillus subtilis and many other Gram-positive bacteria, HrdB in Streptomyces, MysA in Mycobacterium smegmatis, etc. [Transcription, Transcription factors].	2.83254e-88
NZ_CP009128.1\|WP_004545654.1\|447980_448922_-\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	8.158e-54
NZ_CP009128.1\|WP_004197761.1\|450414_450831_+\|lactoylglutathione-lyase	gnl\|CDD\|319916	cd07253, GLOD5, Human glyoxalase domain-containing protein 5 and similar proteins. Uncharacterized subfamily of VOC family contains human glyoxalase domain-containing protein 5 and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46868e-30
NZ_CP009128.1\|WP_004200731.1\|435256_435739_+\|DUF2778-domain-containing-protein	gnl\|CDD\|378506	pfam10908, DUF2778, Protein of unknown function (DUF2778). This is a bacterial family of uncharacterized proteins.	2.57059e-50
NZ_CP009128.1\|WP_004553744.1\|433714_434719_+\|hypothetical-protein	gnl\|CDD\|369676	pfam08065, K167R, K167R (NUC007) repeat. This family represents the K167/Chmadrin repeat. The function of this repeat is unknown.	0.0060801
NZ_CP009128.1\|WP_017881331.1\|440462_441557_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.08734e-149
NZ_CP009128.1\|WP_004537736.1\|441699_442668_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.83868e-70
NZ_CP009128.1\|WP_004525842.1\|438435_439311_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP009128.1\|WP_004535409.1\|446208_447822_-\|glutamate--cysteine-ligase	gnl\|CDD\|235001	PRK02107, PRK02107, glutamate--cysteine ligase; Provisional.	0
NZ_CP009128.1\|WP_004524601.1\|453879_454035_-\|lipoprotein	gnl\|CDD\|215083	PLN00162, PLN00162, transport protein sec23; Provisional.	0.00226922
NZ_CP009128.1\|WP_004524603.1\|452642_453203_-\|spermidine-N1-acetyltransferase	gnl\|CDD\|237916	PRK15130, PRK15130, spermidine N1-acetyltransferase; Provisional.	7.47948e-86

>NZ_CP009128.1|WP_004537736.1|441699_442668_+|LysR-family-transcriptional-regulator
MRRIDLLSALETFVCAVEEGSLSQAARRLAKTPSAVTKAIAGLEATLGVQLLERTTRRLALTESGRLYLATATDVLRRLADGARQLSERDDEPRGLLRVTTAHSFGHAILAPLCAPFAQAFPRVRIELSLSDHYVDIVGEGFDLALRMGNYDLPSQIVKPIGSNRGLLCASPGYLARRGRPTAPADLARHDCVIYRHPTLANTWTFERGGVRARLEPKGPLVTDDYGLALAAALDGAGVLPCPQWSVVDALEAGRLVPLLVDWRFESASFGEDRICAAYPSSRRGSTKIRRLVERVQARLADSEARVARVLGDALCADLARR
>NZ_CP009128.1|WP_017881331.1|440462_441557_-|polyamine-ABC-transporter-substrate-binding-protein
MKRIAWLAAVLASLACAAARAAGGNVLNIYNWAEYFAPDTIAGFEKETGIKVRLDVYDSNEALQTKLTTGNSGYDLVFPSNDFLARQIQAGLYRKLDKSRLPNLTNLDPAIVARAAEVDPGNQYSVPYMQGTFGLGLNVAKVKQALGGPLPANTLELIFNPAYAAKLERCGIAFNDAGSEVFPLALRYIGRDPNTTDPRDYEAALDMMKKIRPTIRQFIATPVMNDLATGDVCVVTGYSGAVLVAARRAAEAKNGQQIVYSLPSAGAPFWFDSMAIPKGAAHADHALRFIDYILRPDVVAKISNKVMYPNPNRVATPLVDRRLTANPAIYPDAATMRTLWVKRPMPPQAMRMQTRYWTRFKTGY
>NZ_CP009128.1|WP_004523110.1|439321_440434_-|histone-deacetylase
MIPTGLLFDPAFLSHRQGDLVYVVPHGTLNLGEHFDSPLRLAYTKQLLDAVGMTERLTRVAFARATDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSASTEDVARLAAGAACAAVDAVMTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARHAQAAHGVERVAIVDWDVHHGNGTQQAFYDDPSVLFVSLHEAANFPVDGGEARETGGGAGAGYNANVPLPSGTGDAGYRHAFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQRDGFRHMARALRQAAGGACGGRIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQFVQYPLGEGERAAVKAARAALAPYWPTLHRS
>NZ_CP009128.1|WP_004525842.1|438435_439311_-|N-carbamoylputrescine-amidase
MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELFETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIFDADGRALGIYRKTHIPDGPGYTEKYYFTPGDTGFRVWDTAYGRIGVGICWDQWFPECARAMALAGAELLLYPSAIGSEPHDASIDSRAHWHNAQRGHAAANLMPVAASNRVGVERGASGEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRALSEGAADRVR
>NZ_CP009128.1|WP_161605795.1|437769_438081_-|hypothetical-protein
MAMLRGGSPRPFAGAAQARGRAVADRGVAFDCEDAEAAAQLLEHAIAVEEVDLMREDAILGDGKPDVVRAAEITFLYRAELHRGGSPCAVGLGMLYFRGSSDH
>NZ_CP009128.1|WP_024431929.1|436093_437185_-|phage-portal-protein
MSSWRRRASTTAPSACSNVTSSAATTLRNRPRQIRAPARAEVFTFDDPMPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTFRPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVRRKADFSGFVYVNGWQERHEFEPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHAGFILYMTDAAQKQDDVDKMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKDEFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAELNDWLGDEVVRFDDYEIPLAPVAA
>NZ_CP009128.1|WP_004523107.1|435735_436020_+|hypothetical-protein
MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVFRALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA
>NZ_CP009128.1|WP_004200731.1|435256_435739_+|DUF2778-domain-containing-protein
MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVADKGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWFALYRIDGQIDDWTIVNGIRRGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK
>NZ_CP009128.1|WP_004553744.1|433714_434719_+|hypothetical-protein
MAQKKKVVYFLGAGASFGAGAKATVQAGHQLPIPTQATFRPTFLRFCKSQKNRARIESFLFRYFLGYGKTPVRTPAAKRRHLLTSIDVEEVFTFLSERTRAPSTSTQLRTYALQVWGALAEEIGQVFSRFNANSATKAIYKDFLKHHFRRFDTVVSFNYDTIFENSLPARRSARYVGLRDSAGTIPLLKPHGSVNWVQADDGTITVGNPVGPAVIVAPTHLKFIADPDQKEVQHPGYLDQAHEIQKIWAEMEREMRFARSLVFIGYSFPVADLYFASVLRSVLADRDTTPNIVIVNPDAVAISERLLRRFPLVTVSRFFDLAQFIRAGRAVIAQ
>NZ_CP009128.1|WP_154218334.1|433244_433613_+|hypothetical-protein
MLLLPAANSDAPLPPEHCLRRFLYAPPPFKINALRDSQSANPRLIKVNPGHPSTPELSFHCTAQAATSSATCPTNPPRTAPLTRSFAAIDYKAPEIPSTFNNLDKYRVSKTIDCKGFGALSG
>NZ_CP009128.1|WP_004525837.1|443935_444484_+|hypothetical-protein
MEEAYARRALLLHLGSVLQILSRLEGAPDNQSIEALLAANGMLADVPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGWKAYAATLREVSPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRERAAASVESATPAGAPVRRESYE
>NZ_CP009128.1|WP_004531075.1|444746_446195_+|RNA-polymerase-sigma-factor-RpoD/SigA
MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFAHDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDTTASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADPALGRARAALQRARARGDEGARAFARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPEKSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLRAIEKFEHRRGFKFSTYATWWIRQAISRAIADRARTIRVPVHVGDEARRVRKAADRIERRSGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLFDALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIEKRALQTLRVTAEACNAHDFLDVQP
>NZ_CP009128.1|WP_004535409.1|446208_447822_-|glutamate--cysteine-ligase
MPNNMTSRQTDLLQQRLAVLSTSPTREQLPDGLRGIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLERLDELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGASPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYLDALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFGRVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDTHARAIAAQRAKLDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSLAEQAELEGKNAGSFDAFVAAYRAYTLNRFSV
>NZ_CP009128.1|WP_004545654.1|447980_448922_-|DNA-3-methyladenine-glycosylase-2-family-protein
MSAAVEPAAVRPDSVVLELPFKSPYDWPRVLRFFAGRAIPGVEAVGDGAYRRTVDHHGAIGTLTVRKHPRKRCLVALVEGDAARHADAAFAARLSTMFDLQADPAAIGAHLARDAWFAPLVGAAPGLRVPGAWSGFELIVRAIVGQQVSVKAATTIVGRLVERAGERLAPHAPGAIGWRFPEPAALAACDLSRIGMPGKRAAALQGVARAVAAGDVPLEAYASDPAGVRAALLALPGIGPWTVEYVAMRAWRDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSARGG
>NZ_CP009128.1|WP_004523120.1|448918_450013_-|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada
MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPERIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA
>NZ_CP009128.1|WP_004197761.1|450414_450831_+|lactoylglutathione-lyase
MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQLRAGRSLIDLLAVGAPIDRAGSGAPGKGRNMDHLCLRVEPFDAAALRTHLAAHGARPGDEARRYGADGYGPSLYLFDPEGNMVELKGPPEAVAP
>NZ_CP009128.1|WP_004530511.1|451035_451590_-|YaeQ-family-protein
MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIAAFALFAHERLEFCKGLSDTDEPDLWQKDLTGAIEVWVDVGQPDERRIAKASGRAGRVNVIAYGGRTSDIWWQGARGKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWLSSATHDPVAIEWTTLKAREDA
>NZ_CP009128.1|WP_004536432.1|451809_452157_-|hypothetical-protein
MLKRTGLFLALAGGIVAFSVAQANGDASLKPQQEIQLTKNAWGCLSKDNLDSVLNHERDGKAQAKQQYFDDYRCLSVPEGQRFRVVSVDKGDVQFVSAENSDQQGLWTDARFIKQ
>NZ_CP009128.1|WP_004524603.1|452642_453203_-|spermidine-N1-acetyltransferase
MQIQNEQHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFTELSQLYDQHVHDQRERRFVAFDSDGELVGLVELIELDYIHRRGEFQIIIAPNRQGRGFATRATRLAVEYAFKVLNLRKLYLIVDKSNVAAIRVYEKCGFKHEAELIEEFFGNGQYHNALRMCIFQRDYFAAQPGAELHARE
>NZ_CP009128.1|WP_004524601.1|453879_454035_-|lipoprotein
MKKIIIALAVSAGILSGCAVYVPDQPGVIMAPQGGPGNGFCPPGQAKKGNC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009128_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009128_2

589090-589295

Orphan

Consensus_repeat	Method
AAGCGCTGAAGCGNTGACTC	CRT

4 spacers

The CRISPR arrays of NZ_CP009128_2

>merge|NZ_CP009128|2|589090-589295|CRT
GAGCGCTGAAGCGTTCGCTTCGGTCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCGACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGTTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCAACCACGGCATGGGATCGGAGTAAGCGCTGAAGCGCTGACTC

>NZ_CP009128|2|1|589090-589295|CRT
GAGCGCTGAAGCGTTCGCTT	CGGTCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCGACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGTTGACTC	CGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCAACCACGGCATGGGATCGGAGT
AAGCGCTGAAGCGCTGACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009128.1\|WP_004195838.1\|595236_597504_+\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|235514
NZ_CP009128.1\|WP_004525749.1\|592776_593562_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270231
NZ_CP009128.1\|WP_004195834.1\|591717_591912_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009128.1\|WP_004524508.1\|584428_584968_+\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NZ_CP009128.1\|WP_004524499.1\|597968_601898_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|236989
NZ_CP009128.1\|WP_004195832.1\|589313_589739_+\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|234796
NZ_CP009128.1\|WP_004524510.1\|581987_582518_+\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP009128.1\|WP_004524507.1\|585014_586556_+\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NZ_CP009128.1\|WP_004185283.1\|583955_584426_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|180240
NZ_CP009128.1\|WP_004195828.1\|583558_583828_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|180739
NZ_CP009128.1\|WP_004530461.1\|586627_587503_+\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535
NZ_CP009128.1\|WP_004524512.1\|580583_581717_+\|citrate-transporter	unknown	unknown	gnl\|CDD\|238537
NZ_CP009128.1\|WP_004538602.1\|582630_583482_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP009128.1\|WP_004195818.1\|579688_580576_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_CP009128.1\|WP_111963022.1\|592135_592270_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP009128.1\|WP_038716750.1\|592235_592577_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP009128.1\|WP_004546057.1\|589945_591676_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP009128.1\|WP_004185243.1\|587582_588977_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_CP009128.1\|WP_004524502.1\|593701_594796_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP009128.1\|WP_004524500.1\|597779_597956_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009128.1\|WP_004195838.1\|595236_597504_+\|primosomal-protein-N'	gnl\|CDD\|235514	PRK05580, PRK05580, primosome assembly protein PriA; Validated.	0
NZ_CP009128.1\|WP_004525749.1\|592776_593562_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270231	cd01069, PBP2_PheC, Cyclohexadienyl dehydratase, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes cyclohexadienyl dehydratase PheC. These proteins catalyze the decarboxylation of prephenate to phenylpyruvate in the alternative phenylalanine biosynthesis pathway in some proteobacteria and archaea. The PheC proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. Since they the PheC proteins are so similar to periplasmic binding proteins, (PBP), it is evolutionarily plausible that several pre-existing PBP proteins might have been recruited to perform the enzymatic function.	1.47897e-125
NZ_CP009128.1\|WP_038716750.1\|592235_592577_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	1.61989e-34
NZ_CP009128.1\|WP_004524508.1\|584428_584968_+\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	2.00477e-65
NZ_CP009128.1\|WP_004524499.1\|597968_601898_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	gnl\|CDD\|236989	PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0
NZ_CP009128.1\|WP_004195832.1\|589313_589739_+\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|234796	PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated.	5.65855e-63
NZ_CP009128.1\|WP_004524510.1\|581987_582518_+\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.44425e-11
NZ_CP009128.1\|WP_004524507.1\|585014_586556_+\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NZ_CP009128.1\|WP_004185283.1\|583955_584426_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|180240	PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated.	5.5546e-56
NZ_CP009128.1\|WP_004195828.1\|583558_583828_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|180739	PRK06876, PRK06876, F0F1 ATP synthase subunit C; Validated.	4.52385e-24
NZ_CP009128.1\|WP_004530461.1\|586627_587503_+\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	2.10577e-157
NZ_CP009128.1\|WP_004524512.1\|580583_581717_+\|citrate-transporter	gnl\|CDD\|238537	cd01117, YbiR_permease, Putative anion permease YbiR. Based on sequence similarity, YbiR proteins are predicted to function as anion translocating permeases in eubacteria, archaea and plants. They belong to ArsB/NhaD superfamily of permeases that have been shown to translocate sodium, sulfate, arsenite and organic anions. A typical ArsB/NhaD permease is composed of 8-13 transmembrane domains.	7.24581e-60
NZ_CP009128.1\|WP_004538602.1\|582630_583482_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	4.13283e-72
NZ_CP009128.1\|WP_004195818.1\|579688_580576_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	6.61248e-79
NZ_CP009128.1\|WP_111963022.1\|592135_592270_+\|hypothetical-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	8.4013e-11
NZ_CP009128.1\|WP_004546057.1\|589945_591676_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP009128.1\|WP_004185243.1\|587582_588977_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_CP009128.1\|WP_004524502.1\|593701_594796_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0

>NZ_CP009128.1|WP_004185243.1|587582_588977_+|F0F1-ATP-synthase-subunit-beta
MSTAALVEGKIVQCIGAVIDVEFPRESMPKIYDALILEGSELTLEVQQQLGDGVVRTICLGASDGLRRGVVVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGPIESENKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDPLDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFEKAKKIQ
>NZ_CP009128.1|WP_004530461.1|586627_587503_+|F0F1-ATP-synthase-subunit-gamma
MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYAEKVRAIAAHMSRANPEYRHPFMVANDGVKTAGMILVTTDKGLCGGLNTNVLRASLQKFKELEEQGQKVEATAIGGKGLGFLNRFGAKVISQVVHLGDTPHLDKLIGAVKTQLDLYSEGKLSAVYLAYTRFVNTMKQETVIEQLLPLSSEHFDTNDGTPATSWDYIYEPDAQAVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKELSEIVGGAAAV
>NZ_CP009128.1|WP_004524507.1|585014_586556_+|F0F1-ATP-synthase-subunit-alpha
MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAIDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVAASASESAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHADLIKRIEDTKDLSKDDESALHAALKDFKKSGAY
>NZ_CP009128.1|WP_004524508.1|584428_584968_+|F0F1-ATP-synthase-subunit-delta
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
>NZ_CP009128.1|WP_004185283.1|583955_584426_+|F0F1-ATP-synthase-subunit-B
MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL
>NZ_CP009128.1|WP_004195828.1|583558_583828_+|F0F1-ATP-synthase-subunit-C
MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQPELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG
>NZ_CP009128.1|WP_004538602.1|582630_583482_+|F0F1-ATP-synthase-subunit-A
MAASEGTRAPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWSIVCGLITILLLRLAARKATSGVPGRFQCAVEMLVEMVEDQSKAIVHGNRAFIAPLALTVFVWVALMNSLDFLPVDLPGRVIGWLGLSGIISHHRIVPTADLNGTLGIALGVFVLMLYYSIKIKGAGGFAHELVSAPFGSHPLLWIPNLALNIVEFVAKTVSLGMRLFGNMYAGELVFLLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHDAH
>NZ_CP009128.1|WP_004524510.1|581987_582518_+|ATP-synthase-subunit-I
MADRAPDKRHEDRRAAQRTVSGAVGRRAAAADDWDAEQQEDDVVPLTRAEAQALFGPEVSRPSRVTPYRVVVAQMVLSLVATLAWWLFSRSPGAAAQSAFLGGAIGWVPSALFVARLRLSGAGTVMGWVAGEALKLGVTIAMFAAVAFGYPGVHWVPLLVTYLVVLKTYWIALAWR
>NZ_CP009128.1|WP_004524512.1|580583_581717_+|citrate-transporter
MSNSVVGRAPARIIAFVRHEPVLSILVAALIALQAVHSLSAIALVRLVDWQTVATLAGLLMLTKALELSGFLMWLAHRIVHRVRSERALAALLVVFAAALSVWLTNDVALFVVIPLVLSLRELTPLPFKRLVIYIALAVNAGAIATPLGNPQNLFLWQLSGVSFGRFVIALGPLALVLMALLLAMVVFAFDGRPLDLSRDSTERPVDRAQAFATVAMFAGFVLLADAHHALAGVLAVAAVFLIVRRDAVLKIDWLLLLIFVLMFIVLRSAASLPAVHQAIAGIGLDTPLRAYAAGALLSQIISNVPAAILLSEFTHDWRALAFGVSVGGFGIAFGSLANLIAIRLSRARGMWLPFHLVSIPFGIASAVLGALLLHYF
>NZ_CP009128.1|WP_004195818.1|579688_580576_+|ParB/RepB/Spo0J-family-partition-protein
MNAVAKKKGLGRGLEALLGGSADITEAVKIEGAPNVLALGKLQAGKYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLEEVPVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRSRSAVSNLLRLLNLAMPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRETEKLVAHTTKAEPAVKARAKDDGGRDTRRLEEELSDLLASNVKIKVGRRGRGQLTIDFGDLDALEGILARLRGNVAA
>NZ_CP009128.1|WP_004195832.1|589313_589739_+|F0F1-ATP-synthase-subunit-epsilon
MATIKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIESESGDEEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDIDLAKAQSELATAMAQLEAIQRLAKIRGKH
>NZ_CP009128.1|WP_004546057.1|589945_591676_+|AMP-binding-protein
MAADSGMGALIAPMHGLSYVRGPADVPLSDATIGQFLLDTVARFPDRAAVVFREQGVRRTWREFADEVDALAAALIQLGIARGDRVGIWSPNRAEWLLTQFATARIGAVLVNVNPAYRLAELEYALNKVGCKLLIAAERFKTSAYAEMIAEIAPELATTRAGDVLCAARVPSLRTVVTMSDAAHAGMLSFADVLARGRAALASARLDAIGATLDCRDPINIQFTSGTTGSPKGATLTHRNVVNNARSIANVMRLTEADAMCIPVPLYHCFGMVLSVLACVSAGAKMVFPGAAFEPGATLAAVSDERCTALQGVPTMFIAELDHPDFDRFDLSTLRTGIMAGSPCPIETMKRVVAKMHMSEVTIAYGMTETSPVSFQSATTDSLEKRTTTVGRIQPHLEAKIVDATGAIVPVGETGELCTRGYSVMLGYWDDEARTREAVVDGWMRTGDLATLDEEGFCNIVGRLKDMLIRGGENVYPREIEEFLFRHPKIQSVQVFGVPDSKYGEEVCAWIVLRAGETMTDDELREFCSGQIAHYKVPRYVRFVDELPMTVTGKVQKFVMRERMIDELGLSVQQTA
>NZ_CP009128.1|WP_004195834.1|591717_591912_+|hypothetical-protein
MSPLKTTRYGVSARRPKVERIGMGRRRLQQGCPWEGIRYETDGLVIRACVRSHAAHETASVLKP
>NZ_CP009128.1|WP_111963022.1|592135_592270_+|hypothetical-protein
MTAISTDEVPRKILKRDRVIAVVGFSDKPYRPSYEVAAYLRQNG
>NZ_CP009128.1|WP_038716750.1|592235_592577_+|CoA-binding-protein
MKSLLTCDKMVNRIVPVNPLLAGAALLGERVHPSLADARAALAADGIEIDMVDVFRKPEEVPAVVDAAIAIGARSLWLQPGVVHDEAAAKVRTAGLDVVVDRCVKIEHRGRFG
>NZ_CP009128.1|WP_004525749.1|592776_593562_-|transporter-substrate-binding-domain-containing-protein
MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCTTGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGGISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFAKQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK
>NZ_CP009128.1|WP_004524502.1|593701_594796_+|uroporphyrinogen-decarboxylase
MAQTLLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKQPDYATEVTLQPLERFPLDAAILFSDILTIPDAMGLGLDFAAGEGPKFAHPVRTEADVAKLAVPDIGATLGYVTDAVREIRRALTDGEGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYARPDLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRFSLDYVRRVLAQLKREHDGARVPAIAFTKGGGLWLEELAATGVDAVGLDWTVNLGRARERVAGRVALQGNLDPTILFAPPEAIRAEARAVLDSYGNHPGHVFNLGHGISQFTPPEHVAELVDEVHRHSRAIRSGAGS
>NZ_CP009128.1|WP_004195838.1|595236_597504_+|primosomal-protein-N'
MADAFVRVALDHPLPTLFDYRYRGDMPAAPGMLVQVPFGRRSVVGLVCEVTAHTDVPAAKLKAVDAVCTELPPLSRHWLELAAFAADYYQRGLGEVALPALPQALRDVPRWGRLLAPELRYRLLDAGRAALPDALPARGAALRRLAQALADAPALSLAEVRALHPKAVAVLDEWQAQGWAACDEIAITHADAQLVDNPAPASARRPTALPPQLTDQQAEALDAIAAADGFAPFLLHGVTGSGKTEVYLRALAALLERRPEAQALVLVPEINLTPQFEAAFRARFAATLPADAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPALAMIVVDEEHEPAYKQQEGLRYSARDLAVWRAKQLAIPVVLGSATPSLETWWQAEQGRYRRLTLTKRAVADAALPTVRLVDLEEERRRGRGSMGGLSGPLVAALKARLERGEQSLVFLNRRGYAPALACDACGWVAGCPRCSAYVVMHKPEHAVRCHHCGWEARIPRACPECGNVDIAPLGRGTQRVEETLALAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQRVSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLIQTRYPRHALYHALARQDYVGFAGATLGERRDAHLPPFVYQALLRAEGRTLDAALAFLQQAADAFSGLPGAERVTVYDAVPMTIVKVANVHRAQLLIESASRAALQHTLRAWQPLLRELKGVLRWSVEVDPLDI
>NZ_CP009128.1|WP_004524500.1|597779_597956_-|hypothetical-protein
MPARCRPRTLKDRKIVRQAIKRCNQISHPVAPHISPLLSIIYQKRQPARTTLNDRYFP
>NZ_CP009128.1|WP_004524499.1|597968_601898_+|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGVADLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASLASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEDALKVVPLGAPHAKIALPRELYGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAAPRDVRNPADLRDVVGTVSEATPDEVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRAVMFTGSTEVARLINKTLSSRLDPDGRPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDTHIAAMKDKGHAVTQLEMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLDKLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPRSLEAALVADAPQEGETRDNPSAALTALRDWLIEQREPALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAALATGNRALFAGAAGEALAAALPAQLKAHAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPGPIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	73538-73563	4	0.846
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	306425-306450	4	0.846
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP009128_2	2.1\|589110\|26\|NZ_CP009128\|CRT	589110-589135	26	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	1003771-1003796	5	0.808
NZ_CP009128_2	2.2\|589156\|27\|NZ_CP009128\|CRT	589156-589182	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	119428-119454	5	0.815
NZ_CP009128_2	2.3\|589203\|26\|NZ_CP009128\|CRT	589203-589228	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP009128_2	2.3\|589203\|26\|NZ_CP009128\|CRT	589203-589228	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP009128_2	2.3\|589203\|26\|NZ_CP009128\|CRT	589203-589228	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP009128_2	2.3\|589203\|26\|NZ_CP009128\|CRT	589203-589228	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279887	Mycobacterium phage Timmi, complete genome	40471-40497	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH651175	Mycobacterium phage Gophee, complete genome	40756-40782	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	GQ303264	Mycobacterium phage Puhltonio, complete genome	40765-40791	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	GU247134	Mycobacterium phage Scoot17C, complete genome	40898-40924	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX683293	Mycobacterium phage Daffy, complete genome	40480-40506	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279888	Mycobacterium phage TomBombadil, complete genome	40756-40782	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF957056	Mycobacterium phage Thora, complete genome	40771-40797	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT316463	Mycobacterium phage Slatt, complete genome	40775-40801	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX576645	Mycobacterium phage Derpp, complete genome	40325-40351	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH651184	Mycobacterium phage Phareon, complete genome	40464-40490	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN006063	Mycobacterium phage Serendipity, complete genome	40779-40805	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH779500	Mycobacterium phage Crownjwl, complete genome	40543-40569	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH230875	Mycobacterium phage CheetO, complete genome	40766-40792	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG962365	Mycobacterium phage DoesntMatter, complete genome	40752-40778	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279882	Mycobacterium phage Sophia, complete genome	40470-40496	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX670813	Mycobacterium phage MitKao, complete genome	40468-40494	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH576970	Mycobacterium phage DonSanchon, complete genome	40462-40488	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279866	Mycobacterium phage MRabcd, complete genome	40461-40487	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH513973	Mycobacterium phage Kwksand96, complete genome	40330-40356	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN945899	Mycobacterium phage Skippy, complete genome	40749-40775	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279908	Mycobacterium phage Roliet, complete genome	40764-40790	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_023727	Mycobacterium phage Vista, complete genome	40769-40795	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT897909	Mycobacterium phage Maru, complete genome	40413-40439	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH727555	Mycobacterium phage Mulan, complete genome	40624-40650	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_027985	Mycobacterium phage UncleHowie, complete genome	40468-40494	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN698990	Mycobacterium phage IsaacEli, complete genome	40907-40933	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KY965066	Mycobacterium phage BlackStallion, complete genome	40902-40928	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN703415	Mycobacterium phage Mcshane, complete genome	40462-40488	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX592589	Mycobacterium phage Iridoclysis, complete genome	40748-40774	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH051251	Mycobacterium phage DuchessDung, complete genome	39751-39777	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX576646	Mycobacterium phage TyrionL, complete genome	40325-40351	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279871	Mycobacterium phage Plmatters, complete genome	40764-40790	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279883	Mycobacterium phage Struggle, complete genome	40317-40343	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	40771-40797	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH371107	Mycobacterium phage Doddsville, complete genome	40479-40505	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_028942	Mycobacterium phage Phipps, complete sequence	40744-40770	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KJ567044	Mycobacterium phage EmpTee, complete genome	40765-40791	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279881	Mycobacterium phage Solosis, complete genome	40476-40502	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG944223	Mycobacterium phage Trypo, complete genome	40900-40926	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT897902	Mycobacterium phage Boehler, complete genome	40772-40798	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279855	Mycobacterium phage Haleema, complete genome	40476-40502	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JX649096	Mycobacterium phage Serpentine, complete genome	40766-40792	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK494104	Mycobacterium phage HenryJackson, complete genome	40476-40502	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG944225	Mycobacterium phage Xavier, complete genome	40473-40499	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JX649099	Mycobacterium phage Gyarad, complete genome	40764-40790	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH450116	Mycobacterium phage Buckeye, complete genome	40786-40812	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN638753	Mycobacterium phage Morgushi, complete genome	40469-40495	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG757158	Mycobacterium phage HighStump, complete genome	40603-40629	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112539	Mycobacterium phage Dione, complete genome	40459-40485	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279873	Mycobacterium phage QueenBeane, complete genome	40755-40781	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF668276	Mycobacterium phage Lulumae, complete genome	40455-40481	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT897903	Mycobacterium phage DirtJuice, complete genome	40749-40775	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH513980	Mycobacterium phage Roy17, complete genome	40455-40481	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT316460	Mycobacterium phage Kimbrough, complete genome	40480-40506	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF937097	Mycobacterium phage Hertubise, complete genome	40776-40802	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH230874	Mycobacterium phage Banjo, complete genome	40448-40474	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH651186	Mycobacterium phage Podrick, complete genome	40755-40781	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG962362	Mycobacterium phage AltPhacts, complete genome	40744-40770	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF704103	Mycobacterium phage Vortex, complete sequence	40466-40492	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	FJ174694	Mycobacterium phage Chah, complete genome	40916-40942	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH051264	Mycobacterium phage Cobra, complete genome	40767-40793	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112536	Mycobacterium phage Cannibal, complete genome	40738-40764	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX578071	Mycobacterium phage Mana, complete genome	40470-40496	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919539	Mycobacterium phage Virapocalypse, complete genome	40759-40785	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KC661274	Mycobacterium phage SDcharge11, complete genome	40742-40768	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KJ194579	Mycobacterium phage Swish, complete genome	40890-40916	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH371114	Mycobacterium phage Childish, complete genome	40486-40512	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279852	Mycobacterium phage Fringe, complete genome	40886-40912	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KY385382	Mycobacterium phage ImtiyazSitla, complete genome	40451-40477	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN699010	Mycobacterium phage TallGrassMM, complete genome	40385-40411	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG757159	Mycobacterium phage JangoPhett, complete genome	40759-40785	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279891	Mycobacterium phage Wallhey, complete genome	40329-40355	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919503	Mycobacterium phage Dingo, complete genome	40750-40776	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KY676783	Mycobacterium phage Chorkpop, complete genome	40482-40508	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112527	Mycobacterium phage Altwerkus, complete genome	40450-40476	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JX649100	Mycobacterium phage Alex, complete genome	40792-40818	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_028691	Mycobacterium phage Apizium, complete genome	40650-40676	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH371125	Mycobacterium phage Morty, complete genome	40907-40933	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF937109	Mycobacterium phage Yoshand, complete genome	40903-40929	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279878	Mycobacterium phage Samaymay, complete genome	40755-40781	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	40892-40918	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112551	Mycobacterium phage Riggan, complete genome	40751-40777	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN945903	Mycobacterium phage Jiminy, complete genome	40319-40345	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KM363597	Mycobacteriophage Zonia, complete genome	40780-40806	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KF713485	Mycobacterium phage Suffolk, complete genome	40766-40792	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG770212	Mycobacterium phage Haimas, complete genome	40762-40788	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279861	Mycobacterium phage Legolas, complete genome	40500-40526	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279843	Mycobacterium phage CamL, complete genome	40755-40781	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279846	Mycobacterium phage Cosmolli16, complete genome	40474-40500	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KM408320	Mycobacterium phage Lasso, complete genome	40730-40756	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KR029086	Mycobacterium phage PDRPv, complete genome	40479-40505	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KY385380	Mycobacterium phage Ashraf, complete genome	40451-40477	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH825705	Mycobacterium phage Mesh1, complete genome	40777-40803	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT952849	Mycobacterium phage Windsor, complete genome	40465-40491	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH576954	Mycobacterium phage HSavage, complete genome	40768-40794	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112555	Mycobacterium phage Zelda, complete genome	40810-40836	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_028803	Mycobacterium phage OSmaximus, complete genome	40940-40966	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279904	Mycobacterium phage RedMaple, complete genome	40906-40932	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KR029087	Mycobacterium phage PDRPxv, complete genome	40540-40566	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	40904-40930	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_005259	Mycobacterium phage PG1, complete genome	40909-40935	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112552	Mycobacterium phage Spartan300, complete genome	40761-40787	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX702319	Mycobacterium phage Pinkman, complete genome	40323-40349	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919523	Mycobacterium phage Mikota, complete genome	40748-40774	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KU867907	Mycobacterium phage Potter, complete genome	40479-40505	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH590588	Mycobacterium phage Vaticameos, complete genome	38450-38476	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279885	Mycobacterium phage Surely, complete genome	40772-40798	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279870	Mycobacterium phage Omniscient, complete genome	40775-40801	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN638752	Mycobacterium phage Murdoc, complete genome	40755-40781	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG962375	Mycobacterium phage ProfessorX, complete genome	40756-40782	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG925348	Mycobacterium phage Megatron, complete genome	40898-40924	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH077582	Mycobacterium phage Olive, complete genome	40756-40782	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF155947	Mycobacterium phage LemonSlice, complete genome	40467-40493	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KP027209	Mycobacterium phage Sigman, complete genome	40889-40915	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH450122	Mycobacterium phage KingTut, complete genome	36143-36169	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279859	Mycobacterium phage Kwadwo, complete genome	40455-40481	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112546	Mycobacterium phage LuckyMarjie, complete genome	40470-40496	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX620786	Mycobacterium phage Lego3393, complete genome	40910-40936	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112544	Mycobacterium phage Keitherie, complete genome	40819-40845	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KP027197	Mycobacterium phage FluffyNinja, complete genome	40903-40929	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH651177	Mycobacterium phage KlimbOn, complete genome	40757-40783	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279877	Mycobacterium phage Roscoe, complete genome	41001-41027	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN698989	Mycobacterium phage JacAttac, complete genome	40889-40915	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH479918	Mycobacterium phage Labeouficaum, complete genome	40325-40351	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112553	Mycobacterium Phage Squiggle, complete genome	40485-40511	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_028907	Mycobacterium phage Kikipoo, complete genome	40907-40933	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279850	Mycobacterium phage Durga, complete genome	40917-40943	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279897	Mycobacterium phage Bishoperium, complete genome	40463-40489	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN585965	Mycobacterium phage Duggie, complete genome	40481-40507	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT310868	Mycobacterium phage Telesworld, complete genome	40464-40490	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279865	Mycobacterium phage Mecca, complete genome	40468-40494	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KC576784	Mycobacterium phage ShiVal, complete genome	40765-40791	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH479916	Mycobacterium phage GeneCoco, complete genome	40773-40799	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN444868	Mycobacterium phage Prickles, complete genome	40755-40781	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KY385383	Mycobacterium phage Maskar, complete genome	40451-40477	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH371117	Mycobacterium phage Kahve, complete genome	40473-40499	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH399773	Mycobacterium phage Craff, complete genome	40902-40928	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	GU247133	Mycobacterium phage Fang, complete genome	40910-40936	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_008197	Mycobacterium phage Orion, complete genome	40896-40922	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH479921	Mycobacterium phage Placalicious, complete genome	40461-40487	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT897901	Mycobacterium phage Adriana, complete genome	40892-40918	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN369744	Mycobacterium phage Beaglebox, complete genome	40469-40495	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919530	Mycobacterium phage Sheila, complete genome	40804-40830	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG925356	Mycobacterium phage OliverWalter, complete genome	40778-40804	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JX649098	Mycobacterium phage Nacho, complete genome	40901-40927	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT889369	Mycobacterium phage Inchworm, complete genome	40889-40915	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KP027208	Mycobacterium phage Pipsqueak, complete genome	40768-40794	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919519	Mycobacterium phage Longacauda, complete genome	40463-40489	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF704109	Mycobacterium phage Oosterbaan, complete sequence	40763-40789	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX369585	Mycobacterium phage PhatCats2014, complete genome	40913-40939	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK310139	Mycobacterium phage Emiris, complete genome	40885-40911	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KJ194580	Mycobacterium phage Badfish, complete genome	40917-40943	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KX576647	Mycobacterium phage CharlieGBrown, complete genome	40336-40362	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN369738	Mycobacterium phage Hocus, complete genome	40465-40491	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279889	Mycobacterium phage Valjean, complete genome	40764-40790	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH399775	Mycobacterium phage Gareth, complete genome	40458-40484	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	40763-40789	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279895	Mycobacterium phage Zaider, complete genome	40993-41019	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MN585967	Mycobacterium phage Kloppinator, complete genome	41182-41208	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK279858	Mycobacterium phage JakeO, complete genome	40484-40510	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_028681	Mycobacterium phage Pops, complete genome	40779-40805	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH744417	Mycobacterium phage Grand2040, complete genome	40476-40502	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JX649097	Mycobacterium phage Piglet, complete genome	40874-40900	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MG925350	Mycobacterium phage Mosaic, complete genome	40462-40488	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH479914	Mycobacterium phage FugateOSU, complete genome	40464-40490	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH825702	Mycobacterium phage Hamish, complete genome	40754-40780	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF704091	Mycobacterium phage ABU, complete sequence	40894-40920	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919528	Mycobacterium phage Phunky, complete genome	40761-40787	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_028690	Mycobacterium phage Eremos, complete genome	40758-40784	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	40751-40777	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JN192463	Mycobacterium phage Oline, complete genome	40329-40355	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NC_021310	Mycobacterium phage Newman, complete genome	40760-40786	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MK112542	Mycobacterium phage Jillium, complete genome	40478-40504	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MT310867	Mycobacterium phage Chaelin, complete genome	40461-40487	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KJ194583	Mycobacterium phage Numberten, complete genome	40767-40793	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH590594	Mycobacterium phage PinheadLarry, complete genome	40474-40500	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	KJ174157	Mycobacterium phage Soto, complete genome	40776-40802	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH399780	Mycobacterium phage Mutante, complete genome	40474-40500	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	JF704099	Mycobacterium phage KLucky39, complete sequence	40763-40789	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MH779516	Mycobacterium phage Waterdiva, complete genome	40761-40787	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	MF919507	Mycobacterium phage Horchata, complete genome	40756-40782	5	0.815
NZ_CP009128_2	2.4\|589249\|27\|NZ_CP009128\|CRT	589249-589275	27	NZ_CP045374	Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence	161364-161390	5	0.815
NZ_CP009128_2	2.3\|589203\|26\|NZ_CP009128\|CRT	589203-589228	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977344	6	0.769

1. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.846

cggtcgaccgccgcggggccagagta	CRISPR spacer
cggtcgaccgcatcggggccagaaca	Protospacer
***********  **********..*

2. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.846

cggtcgaccgccgcggggccagagta	CRISPR spacer
cggtcgaccgcatcggggccagaaca	Protospacer
***********  **********..*

3. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

4. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

5. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

6. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

7. spacer 2.1|589110|26|NZ_CP009128|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ttgtcgaccgtcgcggtgccagagtt	Protospacer
. ********.***** ********

8. spacer 2.2|589156|27|NZ_CP009128|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggccgaccacggcatgggatcggagt	CRISPR spacer
cggccgaccgcggcctgggatcgggtt	Protospacer
.********.**** *********. *

9. spacer 2.3|589203|26|NZ_CP009128|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

10. spacer 2.3|589203|26|NZ_CP009128|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

11. spacer 2.3|589203|26|NZ_CP009128|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

12. spacer 2.3|589203|26|NZ_CP009128|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

13. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

14. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

15. spacer 2.4|589249|27|NZ_CP009128|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

16. spacer 2.4|589249|27|NZ_CP009128|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

17. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

18. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

19. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

20. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

21. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

22. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

23. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

24. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

25. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

26. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

27. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

28. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

29. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

30. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

31. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH513973 (Mycobacterium phage Kwksand96, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

32. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

33. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

34. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

35. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

36. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

37. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

38. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

39. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

40. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

41. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

42. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

43. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

44. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

45. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

46. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

47. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH371107 (Mycobacterium phage Doddsville, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

48. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

49. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

50. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

51. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

52. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

53. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

54. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

55. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

56. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

57. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

58. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

59. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

60. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

61. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

62. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

63. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

64. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

65. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

66. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

67. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

68. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

69. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

70. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

71. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

72. spacer 2.4|589249|27|NZ_CP009128|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

73. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH051264 (Mycobacterium phage Cobra, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

74. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

75. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

76. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

77. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

78. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

79. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

80. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

81. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KY385382 (Mycobacterium phage ImtiyazSitla, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

82. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

83. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

84. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279891 (Mycobacterium phage Wallhey, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

85. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

86. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

87. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

88. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

89. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgattt	Protospacer
******.******* ********.  *

90. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

91. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

92. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

93. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

94. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

95. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN945903 (Mycobacterium phage Jiminy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

96. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KM363597 (Mycobacteriophage Zonia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

97. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

98. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

99. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

100. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

101. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

102. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

103. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KR029086 (Mycobacterium phage PDRPv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

104. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KY385380 (Mycobacterium phage Ashraf, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

105. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

106. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

107. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

108. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

109. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

110. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

111. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KR029087 (Mycobacterium phage PDRPxv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

112. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

113. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

114. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

115. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX702319 (Mycobacterium phage Pinkman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

116. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

117. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

118. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

119. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

120. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

121. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

122. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

123. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

124. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

125. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

126. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

127. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

128. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

129. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

130. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

131. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

132. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

133. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

134. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

135. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

136. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH479918 (Mycobacterium phage Labeouficaum, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

137. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

138. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

139. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279850 (Mycobacterium phage Durga, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

140. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

141. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN585965 (Mycobacterium phage Duggie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

142. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

143. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

144. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

145. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH479916 (Mycobacterium phage GeneCoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

146. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

147. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KY385383 (Mycobacterium phage Maskar, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

148. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

149. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

150. spacer 2.4|589249|27|NZ_CP009128|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

151. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

152. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

153. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

154. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN369744 (Mycobacterium phage Beaglebox, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

155. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

156. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

157. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

158. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT889369 (Mycobacterium phage Inchworm, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

159. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

160. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919519 (Mycobacterium phage Longacauda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

161. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

162. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

163. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

164. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

165. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KX576647 (Mycobacterium phage CharlieGBrown, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

166. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN369738 (Mycobacterium phage Hocus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

167. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

168. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

169. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

170. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

171. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

172. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK279858 (Mycobacterium phage JakeO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

173. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

174. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

175. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

176. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

177. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

178. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

179. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

180. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

181. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

182. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

183. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JN192463 (Mycobacterium phage Oline, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

184. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

185. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

186. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

187. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

188. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

189. spacer 2.4|589249|27|NZ_CP009128|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

190. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

191. spacer 2.4|589249|27|NZ_CP009128|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

192. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

193. spacer 2.4|589249|27|NZ_CP009128|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

194. spacer 2.4|589249|27|NZ_CP009128|CRT matches to NZ_CP045374 (Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
cggccatccacggcatgggagcggcgc	Protospacer
.***** ************* *** *.

195. spacer 2.3|589203|26|NZ_CP009128|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.769

cgatcgaccgccgcggggccagagta	CRISPR spacer
tgatcgaccgcagcggggccagtccg	Protospacer
.********** **********  ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6010

Tetraselmis_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195204.1\|273_2283_-	potassium efflux system protein	NA	NA	NA	NA
WP_004530936.1\|2410_3394_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.7e-42	37.5
WP_004200146.1\|3393_3933_+	HAD family hydrolase	E3T535	Cafeteria_roenbergensis_virus	8.4e-12	28.0
WP_004522855.1\|3938_4553_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_004195213.1\|4571_5237_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_004195214.1\|5233_6010_+	LPS export ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.1e-18	28.1

DBSCAN-SWA_2

10120 : 11014

Thermobifida_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530937.1\|10120_11014_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.4e-05	30.8

DBSCAN-SWA_3

17629 : 22250

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195243.1\|17629_18586_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	5.3e-41	35.5
WP_004200150.1\|18749_19364_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_004530939.1\|19477_20083_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_004530940.1\|20171_21242_+	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_004195247.1\|21420_21687_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-20	56.3
WP_004195249.1\|21749_22250_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.9e-30	44.7

DBSCAN-SWA_4

36767 : 38637

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004553800.1\|36767_37337_-	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	1.9e-09	27.4
WP_004522872.1\|37701_38637_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.6e-37	36.4

DBSCAN-SWA_5

43696 : 51328

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537837.1\|43696_46198_+	family 20 glycosylhydrolase	A0A076G5S5	Staphylococcus_phage	7.7e-07	31.9
WP_004522878.1\|46866_48627_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_004530947.1\|48739_51328_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.2e-08	27.1

DBSCAN-SWA_6

56414 : 58181

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526041.1\|56414_58181_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.5e-09	34.2

DBSCAN-SWA_7

64355 : 65924

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537833.1\|64355_65924_+	acyl-CoA ligase (AMP-forming), exosortase A system-associated	A0A2K9KZV5	Tupanvirus	2.4e-14	22.4

DBSCAN-SWA_8

71777 : 75910

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526032.1\|71777_72821_+	ATP-binding cassette domain-containing protein	A0A2R8FFL6	Cedratvirus	1.4e-07	29.2
WP_004537829.1\|72813_73905_+	ABC transporter permease	NA	NA	NA	NA
WP_004522894.1\|73979_74513_+	hypothetical protein	NA	NA	NA	NA
WP_004195305.1\|74557_75910_+	diaminobutyrate--2-oxoglutarate transaminase family protein	A0A1V0SKB7	Klosneuvirus	1.6e-19	25.3

DBSCAN-SWA_9

79566 : 85910

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526030.1\|79566_82785_-	error-prone DNA polymerase	A0A1C9LWI9	Streptomyces_phage	1.3e-102	28.7
WP_004550915.1\|82790_84266_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_004522898.1\|84198_84909_-	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_004195287.1\|85115_85910_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	6.6e-05	27.8

DBSCAN-SWA_10

89305 : 90946

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017844051.1\|89305_90946_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.7e-11	43.6

DBSCAN-SWA_11

98134 : 99742

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197996.1\|98134_99742_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	2.6e-08	35.8

DBSCAN-SWA_12

104887 : 107454

Red_sea_bream_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198002.1\|104887_105421_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	7.0e-35	49.7
WP_004526020.1\|105573_106572_-	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_004198004.1\|106597_107077_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_004200200.1\|107193_107454_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	3.4e-11	46.8

DBSCAN-SWA_13

111731 : 113504

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004553810.1\|111731_113504_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	4.3e-12	27.9

DBSCAN-SWA_14

148944 : 150258

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537812.1\|148944_150258_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.1e-65	39.8

DBSCAN-SWA_15

154971 : 155814

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190185.1\|154971_155814_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.4e-21	33.8

DBSCAN-SWA_16

162921 : 163407

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189202.1\|162921_163407_-	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	2.3e-16	35.9

DBSCAN-SWA_17

172178 : 173258

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004204527.1\|172178_173258_+	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	8.4e-11	49.2

DBSCAN-SWA_18

185356 : 187003

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189357.1\|185356_187003_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	1.5e-19	26.1

DBSCAN-SWA_19

192539 : 193217

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534292.1\|192539_193217_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	6.7e-06	31.5

DBSCAN-SWA_20

197119 : 198304

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525972.1\|197119_198304_+	8-amino-7-oxononanoate synthase	G9E4Q1	Emiliania_huxleyi_virus	3.9e-17	24.1

DBSCAN-SWA_21

236132 : 239230

Klosneuvirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522997.1\|236132_237068_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	4.1e-38	32.4
WP_004525946.1\|237123_237630_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_004535937.1\|237626_237959_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_004538232.1\|238009_239230_-\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	4.6e-239	99.5

DBSCAN-SWA_22

248434 : 251709

Burkholderia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085955848.1\|248434_249594_-\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3
WP_004189860.1\|250149_251709_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-13	35.4

DBSCAN-SWA_23

258915 : 263728

Escherichia_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189298.1\|258915_259911_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.7e-106	70.5
WP_004531007.1\|260470_261832_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A2K9L277	Tupanvirus	4.6e-30	33.3
WP_004189813.1\|261895_263728_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-141	47.0

DBSCAN-SWA_24

274071 : 280754

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525924.1\|274071_276600_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.1e-65	32.3
WP_004189576.1\|277231_277432_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_004537780.1\|277801_278509_-	hypothetical protein	NA	NA	NA	NA
WP_004197840.1\|278616_279120_-	hypothetical protein	NA	NA	NA	NA
WP_004189990.1\|279413_280754_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	1.8e-55	82.5

DBSCAN-SWA_25

299122 : 300430

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197818.1\|299122_300430_-	permease	Q9KX94	Enterobacteria_phage	5.3e-161	70.7

DBSCAN-SWA_26

316987 : 321973

Sinorhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525896.1\|316987_318229_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.8e-81	42.8
WP_004197238.1\|318225_318873_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_004197236.1\|318936_319896_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_004525894.1\|320017_321973_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	5.6e-13	33.1

DBSCAN-SWA_27

330005 : 332011

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004523051.1\|330005_331022_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-17	28.4
WP_004525887.1\|331018_332011_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-18	31.8

DBSCAN-SWA_28

336203 : 337496

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004523057.1\|336203_337496_-	MFS transporter	Q6JIH2	Burkholderia_virus	8.6e-95	45.5

DBSCAN-SWA_29

359994 : 361638

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198976.1\|359994_361638_-	GMC family oxidoreductase	A0A2I2L3D3	Orpheovirus	2.9e-31	27.0

DBSCAN-SWA_30

373634 : 378606

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199069.1\|373634_374822_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.2e-121	60.7
WP_004525868.1\|375087_375972_+	lauroyl acyltransferase	NA	NA	NA	NA
WP_004537753.1\|376012_376882_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_004199066.1\|376929_377643_+	DUF484 family protein	NA	NA	NA	NA
WP_004523080.1\|377673_378606_+	tyrosine recombinase XerC	G1JX48	Mycobacterium_phage	2.4e-14	28.0

DBSCAN-SWA_31

382971 : 385781

Erwinia_phage(50.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198316.1\|382971_384315_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.7e-40	28.8
WP_085955194.1\|384412_385781_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.6e-75	54.0

DBSCAN-SWA_32

396983 : 399164

Moumouvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537751.1\|396983_398048_+	NAD(P)-dependent alcohol dehydrogenase	M1PHA2	Moumouvirus	1.3e-80	44.6
WP_004190029.1\|398393_399164_-	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	3.4e-30	33.8

DBSCAN-SWA_33

412776 : 414709

Vibrio_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189793.1\|412776_413229_-	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	7.6e-14	30.8
WP_004534354.1\|413248_413881_-	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	7.3e-07	31.5
WP_004537747.1\|413974_414709_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.8e-50	42.5

DBSCAN-SWA_34

422480 : 428669

Prochlorococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537742.1\|422480_423464_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.3e-07	38.0
WP_004525852.1\|423495_423999_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	2.1e-12	34.3
WP_004553745.1\|424227_425418_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.0e-21	39.2
WP_004190199.1\|425477_425849_+	thioredoxin family protein	NA	NA	NA	NA
WP_004537740.1\|426059_428669_+	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	2.2e-17	25.6

DBSCAN-SWA_35

436093 : 440434

Burkholderia_virus(33.33%)

portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024431929.1\|436093_437185_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	2.4e-191	91.7
WP_161605795.1\|437769_438081_-	hypothetical protein	NA	NA	NA	NA
WP_004525842.1\|438435_439311_-	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	1.6e-73	47.3
WP_004523110.1\|439321_440434_-	histone deacetylase	A0A2K9KZC4	Tupanvirus	3.2e-37	30.8

DBSCAN-SWA_36

444746 : 450013

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004531075.1\|444746_446195_+	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	2.9e-30	33.5
WP_004535409.1\|446208_447822_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_004545654.1\|447980_448922_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004523120.1\|448918_450013_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.0e-19	37.4

DBSCAN-SWA_37

460747 : 467684

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198815.1\|460747_461017_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.1e-16	53.6
WP_038716494.1\|461096_461564_-	ribonuclease P protein component	NA	NA	NA	NA
WP_004198824.1\|461580_461715_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_076805040.1\|462007_463762_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_004196275.1\|463924_465028_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.7e-46	34.0
WP_004196276.1\|465215_467684_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.3e-114	34.4

DBSCAN-SWA_38

488149 : 490702

Klosneuvirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524564.1\|488149_489820_+\|holin	glucose-methanol-choline (GMC) oxidoreductase	A0A1V0SI18	Klosneuvirus	6.0e-56	31.1
WP_004198379.1\|489904_490702_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.3e-12	28.8

DBSCAN-SWA_39

496922 : 498749

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525788.1\|496922_497645_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	7.1e-06	27.2
WP_004538585.1\|498017_498749_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.6e-05	25.3

DBSCAN-SWA_40

501868 : 506954

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538586.1\|501868_504898_-	DEAD/DEAH box helicase family protein	A0A2K5B256	Erysipelothrix_phage	3.4e-182	38.8
WP_038716771.1\|504938_506954_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	1.3e-84	33.4

DBSCAN-SWA_41

511871 : 512669

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199877.1\|511871_512669_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-30	35.3

DBSCAN-SWA_42

541079 : 543605

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524535.1\|541079_541565_+	lytic transglycosylase domain-containing protein	A0A0A8J856	Ralstonia_phage	9.3e-10	43.2
WP_038716767.1\|541883_543224_+	GTP-binding protein	NA	NA	NA	NA
WP_004195781.1\|543326_543605_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	8.7e-21	61.8

DBSCAN-SWA_43

561983 : 565700

Catovirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538595.1\|561983_563669_+\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	1.4e-52	29.1
WP_004195806.1\|564168_564948_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-13	25.0
WP_004195807.1\|564944_565700_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	8.2e-05	24.3

DBSCAN-SWA_44

573457 : 580576

Cedratvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538597.1\|573457_575242_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A1M7XV31	Cedratvirus	3.5e-14	29.5
WP_004524515.1\|575244_576000_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-10	24.1
WP_004538599.1\|576161_578135_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_004202905.1\|578131_578830_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_004195817.1\|578882_579653_+	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	1.4e-23	33.0
WP_004195818.1\|579688_580576_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.4e-16	34.6

DBSCAN-SWA_45

589945 : 591676

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004546057.1\|589945_591676_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	3.2e-28	29.6

DBSCAN-SWA_46

603361 : 604909

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525747.1\|603361_604909_-	AMP-binding protein	Q75ZG1	Hepacivirus	3.4e-29	26.4

DBSCAN-SWA_47

612366 : 614865

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538608.1\|612366_614865_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.2e-130	43.5

DBSCAN-SWA_48

635437 : 638365

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533494.1\|635437_638365_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	6.2e-258	51.0

DBSCAN-SWA_49

645282 : 660447

Shigella_phage(18.18%)

integrase

attL 642687:642704|attR 659296:659313

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
642687:642704	attL	NA	NA	NA	NA
WP_004524472.1\|645282_647370_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	1.9e-99	35.8
WP_004202928.1\|647692_648592_-	cytochrome c	NA	NA	NA	NA
WP_076804979.1\|649423_649603_-	hypothetical protein	NA	NA	NA	NA
WP_004538613.1\|649774_650362_+\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	1.4e-44	50.6
WP_009932253.1\|650413_650734_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	1.0e-12	58.6
WP_009922658.1\|650741_651059_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.2e-15	57.0
WP_004530410.1\|651058_651976_+	DUF4935 domain-containing protein	A4PE40	Ralstonia_virus	4.0e-46	40.6
WP_009922654.1\|652229_652772_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.3e-48	56.4
WP_009932249.1\|653029_653482_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.3e-31	58.8
WP_004525722.1\|653481_654561_+	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	2.2e-160	99.0
WP_004525721.1\|654717_654966_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.0e-41	97.6
WP_004195754.1\|655866_656511_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	5.7e-07	30.4
WP_009956055.1\|656699_658361_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_004198237.1\|658508_658643_-	hypothetical protein	NA	NA	NA	NA
WP_004525719.1\|658641_660447_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.0e-10	68.4
659296:659313	attR	NA	NA	NA	NA

DBSCAN-SWA_50

674212 : 675361

Stenotrophomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198210.1\|674212_675361_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2D2W2B8	Stenotrophomonas_phage	1.7e-09	26.1

DBSCAN-SWA_51

694483 : 696517

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038716569.1\|694483_696517_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-13	42.6

DBSCAN-SWA_52

699617 : 700013

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185006.1\|699617_700013_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	2.7e-07	32.8

DBSCAN-SWA_53

711132 : 712554

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198634.1\|711132_712554_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	7.6e-44	30.1

DBSCAN-SWA_54

724632 : 728758

Agrobacterium_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195773.1\|724632_725289_-	hypothetical protein	A0A2L0UZL4	Agrobacterium_phage	1.1e-32	38.2
WP_004525684.1\|725285_725930_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_009971172.1\|726530_727166_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	5.6e-23	64.3
WP_004538372.1\|727294_728758_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	6.8e-80	38.6

DBSCAN-SWA_55

742748 : 743969

Burkholderia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038741701.1\|742748_743969_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	3.9e-238	99.3

DBSCAN-SWA_56

751135 : 751822

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197905.1\|751135_751822_-	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	1.2e-15	28.1

DBSCAN-SWA_57

776729 : 777920

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198356.1\|776729_777920_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	27.9

DBSCAN-SWA_58

781909 : 797017

Cafeteria_roenbergensis_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198365.1\|781909_786016_+	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	4.6e-25	21.4
WP_004521902.1\|786037_790276_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	2.3e-72	27.9
WP_004198363.1\|790476_792324_+	DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	3.1e-74	41.7
WP_004521903.1\|792539_792920_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_004198359.1\|793090_793561_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_004198357.1\|793682_795785_+	elongation factor G	E4ZFJ7	Streptococcus_phage	9.8e-56	26.9
WP_004198356.1\|795826_797017_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	27.9

DBSCAN-SWA_59

838136 : 840025

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527898.1\|838136_839219_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	7.3e-23	34.4
WP_004196745.1\|839263_840025_+	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	2.8e-13	27.0

DBSCAN-SWA_60

856734 : 857553

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199931.1\|856734_857553_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-20	29.4

DBSCAN-SWA_61

861205 : 862132

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521934.1\|861205_862132_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-21	29.7

DBSCAN-SWA_62

866759 : 867830

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199913.1\|866759_867830_+	histidinol-phosphate transaminase	A0A1X7BZP2	Faustovirus	2.1e-14	26.6

DBSCAN-SWA_63

874102 : 876434

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199900.1\|874102_874885_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	8.7e-26	29.7
WP_004521939.1\|875225_876434_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	8.5e-12	31.9

DBSCAN-SWA_64

880980 : 902053

Pseudomonas_phage(20.0%)

transposase,protease,plate,integrase

attL 873571:873587|attR 891713:891729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
873571:873587	attL	NA	NA	NA	NA
WP_004199890.1\|880980_881502_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
WP_076802946.1\|884350_884611_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	2.1e-16	68.1
WP_122887193.1\|884743_885864_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-48	39.1
WP_004535005.1\|886147_887218_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_009932052.1\|887224_888025_-	hypothetical protein	NA	NA	NA	NA
WP_004539222.1\|888459_888798_+	DUF4102 domain-containing protein	Q8W6M6	Sinorhizobium_phage	2.4e-17	49.0
WP_004521948.1\|889292_890078_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004521949.1\|890074_891421_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004521950.1\|891529_892144_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
891713:891729	attR	NA	NA	NA	NA
WP_004531875.1\|892518_893190_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004521952.1\|893226_893745_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004521953.1\|893761_895252_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004527837.1\|895324_895828_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004204912.1\|895885_896368_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004539223.1\|896447_898286_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004200010.1\|898249_899350_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004202807.1\|899383_902053_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	3.8e-89	32.0

DBSCAN-SWA_65

913157 : 915419

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521963.1\|913157_915419_-	peptidase domain-containing ABC transporter	A0A2R8FG22	Brazilian_cedratvirus	2.3e-10	31.9

DBSCAN-SWA_66

918942 : 921099

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017881272.1\|918942_921099_-	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.9e-46	27.1

DBSCAN-SWA_67

932668 : 932872

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196837.1\|932668_932872_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.3e-21	73.1

DBSCAN-SWA_68

938272 : 946718

Pseudomonas_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527811.1\|938272_939355_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_004539234.1\|939421_940720_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_004200645.1\|941011_941323_+	hypothetical protein	NA	NA	NA	NA
WP_004198580.1\|941319_941574_+	hypothetical protein	NA	NA	NA	NA
WP_004527809.1\|941592_943407_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	7.2e-172	49.7
WP_004186966.1\|943543_944095_+	cysteine hydrolase	NA	NA	NA	NA
WP_004186915.1\|944091_944715_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_004186903.1\|945050_946718_-	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	5.8e-43	27.9

DBSCAN-SWA_69

960915 : 966392

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004539241.1\|960915_961704_-	uracil-DNA glycosylase	A0A060Q589	Fruit_bat_alphaherpesvirus	1.4e-52	51.1
WP_004539242.1\|961745_962387_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_004522001.1\|962397_963183_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	8.4e-53	47.9
WP_004186823.1\|963245_964277_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.6e-80	47.0
WP_004186792.1\|964294_964885_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.4e-68	60.0
WP_004186866.1\|964898_966392_-	anthranilate synthase component I	A0A0B5J984	Pandoravirus	3.5e-39	30.5

DBSCAN-SWA_70

985733 : 989622

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538786.1\|985733_987809_+	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	1.9e-56	26.9
WP_004527788.1\|987948_989622_+	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.5e-35	26.8

DBSCAN-SWA_71

1009911 : 1010418

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522021.1\|1009911_1010418_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.3e-25	51.7

DBSCAN-SWA_72

1025675 : 1029999

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527775.1\|1025675_1026668_-	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	8.3e-05	23.2
WP_004194344.1\|1026889_1027201_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_004194025.1\|1027229_1027493_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_004194312.1\|1027677_1028796_+	GTPase ObgE	NA	NA	NA	NA
WP_004194262.1\|1028880_1029999_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.8e-62	43.5

DBSCAN-SWA_73

1034280 : 1034832

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194377.1\|1034280_1034832_-	hypoxanthine-guanine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	7.8e-05	32.5

DBSCAN-SWA_74

1038675 : 1043242

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194230.1\|1038675_1041663_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	1.2e-168	43.7
WP_071810953.1\|1041811_1041967_+	hypothetical protein	NA	NA	NA	NA
WP_004194129.1\|1042030_1043242_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	9.7e-32	27.7

DBSCAN-SWA_75

1064399 : 1067904

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194100.1\|1064399_1065179_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	3.0e-10	43.0
WP_004522055.1\|1065308_1066304_+	arabinose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004522056.1\|1066392_1067904_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	1.3e-14	28.5

DBSCAN-SWA_76

1072194 : 1072695

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194139.1\|1072194_1072695_-	CinA family protein	B5TK85	Pseudomonas_phage	1.7e-30	49.0

DBSCAN-SWA_77

1079365 : 1079782

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194044.1\|1079365_1079782_-	glyoxalase	A0A2K9L1J4	Tupanvirus	2.7e-10	30.0

DBSCAN-SWA_78

1087181 : 1088117

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004535483.1\|1087181_1088117_+	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	2.2e-15	24.9

DBSCAN-SWA_79

1096570 : 1102300

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004535294.1\|1096570_1099165_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	2.5e-178	40.3
WP_004194132.1\|1099206_1099758_+	lipoprotein	NA	NA	NA	NA
WP_004194041.1\|1099803_1100892_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_004194412.1\|1100923_1102300_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.4e-79	44.4

DBSCAN-SWA_80

1109313 : 1110702

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522085.1\|1109313_1110702_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.5e-102	44.8

DBSCAN-SWA_81

1117942 : 1119644

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194225.1\|1117942_1118668_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-30	38.9
WP_004522089.1\|1118777_1119032_-	hypothetical protein	NA	NA	NA	NA
WP_004538753.1\|1119326_1119644_-	co-chaperone GroES	A0A221S322	uncultured_virus	8.7e-17	42.6

DBSCAN-SWA_82

1128384 : 1128753

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194247.1\|1128384_1128753_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.7e-30	58.3

DBSCAN-SWA_83

1137676 : 1142058

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194268.1\|1137676_1138747_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	3.5e-09	32.5
WP_004194029.1\|1138928_1139510_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_004196340.1\|1139583_1140126_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_004538750.1\|1140492_1142058_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.4e-67	46.7

DBSCAN-SWA_84

1169085 : 1174134

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522118.1\|1169085_1170036_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.5e-40	35.1
WP_004550004.1\|1170051_1172076_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_004194088.1\|1172183_1172510_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.7e-12	42.2
WP_129195169.1\|1172523_1172907_-	hypothetical protein	NA	NA	NA	NA
WP_004538741.1\|1172940_1174134_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	7.2e-88	46.6

DBSCAN-SWA_85

1178491 : 1179451

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522122.1\|1178491_1179451_+	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	4.5e-08	25.2

DBSCAN-SWA_86

1182594 : 1183083

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527704.1\|1182594_1183083_+	non-specific DNA-binding protein DpsA	A0A2H4N7L5	Lake_Baikal_phage	1.7e-19	36.2

DBSCAN-SWA_87

1191277 : 1195156

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004202168.1\|1191277_1192048_+	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	1.9e-12	26.2
WP_004522131.1\|1192056_1192854_+	phosphonate C-P lyase system protein PhnL	A0A285PWH2	Cedratvirus	3.6e-11	29.8
WP_004194422.1\|1192865_1193999_+	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_004538735.1\|1194232_1195156_+	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-22	36.1

DBSCAN-SWA_88

1203274 : 1210822

Pandoravirus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522137.1\|1203274_1204684_-	FAD-binding protein	S4VRT3	Pandoravirus	4.6e-09	31.4
WP_004201622.1\|1204847_1205420_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_004522138.1\|1205531_1206740_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_004550019.1\|1206935_1208009_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	1.4e-79	47.6
WP_004194245.1\|1208197_1208419_-	hypothetical protein	NA	NA	NA	NA
WP_004194084.1\|1208418_1209915_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_004522140.1\|1209994_1210822_-	carbon-nitrogen hydrolase family protein	M1I6H3	Paramecium_bursaria_Chlorella_virus	9.6e-15	28.0

DBSCAN-SWA_89

1225482 : 1241291

Hokovirus(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194034.1\|1225482_1227435_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004522147.1\|1227701_1228832_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.6
WP_004538732.1\|1228865_1230872_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	8.2e-52	34.5
WP_004194137.1\|1231055_1231871_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004532195.1\|1231935_1232619_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_004194373.1\|1232615_1233143_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004522151.1\|1233179_1234727_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2
WP_004194213.1\|1234723_1235410_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_004196484.1\|1235431_1236157_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_004527676.1\|1236455_1237511_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SEW4	Cyanophage	6.4e-72	44.4
WP_004538730.1\|1237846_1238248_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_004538729.1\|1238265_1239240_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_004194266.1\|1239236_1241291_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.9e-76	31.7

DBSCAN-SWA_90

1244521 : 1245949

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522157.1\|1244521_1245949_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.6e-54	30.2

DBSCAN-SWA_91

1253272 : 1253929

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194035.1\|1253272_1253929_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	8.7e-11	31.1

DBSCAN-SWA_92

1260523 : 1264714

Synechococcus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194206.1\|1260523_1261366_+	sugar nucleotide-binding protein	A0A222YYW2	Synechococcus_phage	1.7e-38	35.0
WP_004194087.1\|1261375_1262389_+	GDP-mannose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	7.2e-97	52.6
WP_004194045.1\|1262404_1263445_+	dehydrogenase	A0A222YW25	Synechococcus_phage	1.7e-61	40.5
WP_004538724.1\|1263441_1264020_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	2.5e-17	37.2
WP_004522168.1\|1264021_1264714_+	NTP transferase domain-containing protein	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	7.5e-05	28.8

DBSCAN-SWA_93

1295917 : 1299489

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538715.1\|1295917_1296763_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.8e-46	40.0
WP_004538714.1\|1296759_1297311_+	HAD-IIIA family hydrolase	E3T535	Cafeteria_roenbergensis_virus	2.9e-15	32.5
WP_004538713.1\|1297414_1298350_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	3.2e-35	33.7
WP_004522195.1\|1298604_1299489_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-69	46.2

DBSCAN-SWA_94

1305607 : 1314260

Burkholderia_phage(25.0%)

capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538708.1\|1305607_1306999_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.7e-91	47.1
WP_038716593.1\|1307026_1307515_+	hypothetical protein	NA	NA	NA	NA
WP_051177532.1\|1307511_1307961_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_004538705.1\|1308295_1308982_+	hypothetical protein	NA	NA	NA	NA
WP_038716591.1\|1309139_1309328_+	HNH endonuclease	Q38456	Bacillus_phage	3.5e-13	62.7
WP_004538704.1\|1309565_1310027_+\|terminase	phage terminase small subunit P27 family	A0A1X9I6K0	Streptococcus_phage	9.7e-25	40.4
WP_038716590.1\|1310226_1310553_+	hypothetical protein	NA	NA	NA	NA
WP_038716588.1\|1310827_1311526_-	hypothetical protein	NA	NA	NA	NA
WP_123875384.1\|1311539_1312532_-	hypothetical protein	NA	NA	NA	NA
WP_004538699.1\|1312955_1314260_-\|capsid	phage major capsid protein	I3ULZ9	Rhodobacter_phage	4.4e-06	25.1

DBSCAN-SWA_95

1325912 : 1327160

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186490.1\|1325912_1327160_+	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	4.1e-94	50.4

DBSCAN-SWA_96

1348946 : 1349951

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522216.1\|1348946_1349951_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	3.3e-62	44.7

DBSCAN-SWA_97

1357049 : 1366317

Acinetobacter_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538679.1\|1357049_1358567_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	3.0e-131	52.2
WP_004522221.1\|1358595_1360959_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	1.4e-236	56.5
WP_004527624.1\|1361342_1362125_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004522224.1\|1362309_1362714_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_004538677.1\|1363204_1365484_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.3e-08	32.4
WP_004538676.1\|1365525_1366317_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.8e-09	26.8

DBSCAN-SWA_98

1378834 : 1380277

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534039.1\|1378834_1380277_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	2.8e-54	36.6

DBSCAN-SWA_99

1392978 : 1393986

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004200388.1\|1392978_1393986_-	NAD(P)-dependent alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.9e-05	24.1

DBSCAN-SWA_100

1397635 : 1399617

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186661.1\|1397635_1397929_+	co-chaperone GroES	A0A221S4A8	uncultured_virus	9.5e-18	42.6
WP_004538665.1\|1397976_1399617_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	9.3e-171	62.6

DBSCAN-SWA_101

1404562 : 1405594

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534003.1\|1404562_1405594_+	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.1e-27	33.0

DBSCAN-SWA_102

1409202 : 1421748

Enterobacteria_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186461.1\|1409202_1410264_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.7e-85	47.5
WP_004202440.1\|1410275_1411169_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.4e-96	57.7
WP_004185665.1\|1411153_1411705_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.4e-48	52.5
WP_004186608.1\|1411701_1412598_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	7.4e-21	34.7
WP_004186421.1\|1412624_1413458_+	ABC transporter permease	NA	NA	NA	NA
WP_004538663.1\|1413447_1414857_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_004194788.1\|1414853_1416092_+	acyltransferase	A9YX16	Burkholderia_phage	4.0e-17	30.2
WP_004186496.1\|1416091_1417183_+	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	7.9e-17	25.2
WP_004186722.1\|1417242_1418127_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_004522252.1\|1418130_1419855_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004534033.1\|1419906_1421748_+	glycosyltransferase	A0A1V0SAH6	Catovirus	6.2e-06	31.9

DBSCAN-SWA_103

1428070 : 1429093

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527590.1\|1428070_1429093_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.2e-83	47.2

DBSCAN-SWA_104

1432620 : 1434039

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522260.1\|1432620_1434039_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	6.6e-56	32.5

DBSCAN-SWA_105

1443567 : 1445128

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522269.1\|1443567_1444260_-	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	1.0e-14	25.8
WP_004538656.1\|1444264_1445128_-	urea ABC transporter ATP-binding protein UrtD	A0A1M7XV31	Cedratvirus	2.4e-08	23.1

DBSCAN-SWA_106

1468891 : 1473619

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538649.1\|1468891_1470163_+	hypothetical protein	S5M4R0	Bacillus_phage	5.4e-09	25.8
WP_004532255.1\|1470406_1471135_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	8.6e-52	44.4
WP_004522282.1\|1471402_1472623_-	hypothetical protein	NA	NA	NA	NA
WP_004522284.1\|1473232_1473619_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	4.9e-22	48.5

DBSCAN-SWA_107

1484413 : 1488380

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186056.1\|1484413_1484935_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2I2L4Y7	Orpheovirus	5.6e-13	36.8
WP_038717030.1\|1485014_1486151_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.7e-49	36.2
WP_004185756.1\|1486614_1487229_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.0e-26	36.2
WP_004527563.1\|1487243_1488380_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.3e-41	33.0

DBSCAN-SWA_108

1491398 : 1492634

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538642.1\|1491398_1492634_+	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	5.8e-24	25.8

DBSCAN-SWA_109

1499786 : 1501256

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186165.1\|1499786_1501256_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	1.8e-72	34.6

DBSCAN-SWA_110

1505004 : 1515537

Bacillus_virus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527557.1\|1505004_1506123_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.9e-22	34.5
WP_004522307.1\|1506355_1506976_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_004532267.1\|1507001_1507739_-	DNA mismatch repair protein MutS	NA	NA	NA	NA
WP_004186294.1\|1507904_1508867_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.5e-62	44.2
WP_004186104.1\|1509194_1511501_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	6.5e-85	50.1
WP_004185701.1\|1511558_1512275_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_004535822.1\|1512461_1513772_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	7.9e-80	40.0
WP_004550097.1\|1513811_1514078_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_004538636.1\|1514235_1515537_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.1e-93	44.0

DBSCAN-SWA_111

1527015 : 1527225

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534014.1\|1527015_1527225_-	hypothetical protein	A0A077KET4	Ralstonia_phage	1.2e-11	62.7

DBSCAN-SWA_112

1531625 : 1535009

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185877.1\|1531625_1532309_+	guanylate kinase	A0A218KC48	Bacillus_phage	7.4e-13	33.5
WP_004185855.1\|1532369_1532573_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_004194871.1\|1532639_1535009_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	2.0e-12	34.8

DBSCAN-SWA_113

1538659 : 1540154

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522324.1\|1538659_1538863_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-19	74.2
WP_004537702.1\|1539008_1540154_+	DNA polymerase III subunit epsilon	I6R9X8	Croceibacter_phage	1.1e-13	31.0

DBSCAN-SWA_114

1549343 : 1550360

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189384.1\|1549343_1550360_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	5.4e-52	36.4

DBSCAN-SWA_115

1563087 : 1564110

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189595.1\|1563087_1564110_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.1e-44	37.8

DBSCAN-SWA_116

1569079 : 1572608

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188918.1\|1569079_1570375_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.2e-65	37.5
WP_004537705.1\|1570763_1572608_-	tetratricopeptide repeat protein	F2Y1J7	Organic_Lake_phycodnavirus	1.3e-11	32.2

DBSCAN-SWA_117

1585954 : 1590506

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527513.1\|1585954_1588555_+	DNA gyrase subunit A	A0A172JHV7	Bacillus_phage	1.2e-100	29.8
WP_004189806.1\|1588653_1589250_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_004189993.1\|1589423_1590506_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	8.5e-88	47.2

DBSCAN-SWA_118

1596697 : 1610671

Bacillus_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189865.1\|1596697_1597021_+	integration host factor subunit beta	A7KV42	Bacillus_phage	4.7e-10	38.9
WP_011205251.1\|1597139_1598603_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	4.0e-80	38.8
WP_004195986.1\|1598838_1599132_+	LapA family protein	NA	NA	NA	NA
WP_004188993.1\|1599184_1600354_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_004537711.1\|1600474_1601875_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	4.2e-79	38.5
WP_009921652.1\|1601906_1602830_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.1
WP_004537712.1\|1602888_1603881_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004189725.1\|1603952_1604270_+	competence protein ComE	NA	NA	NA	NA
WP_004550116.1\|1604622_1605525_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.3e-53	39.9
WP_004537714.1\|1605751_1607041_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004533906.1\|1607219_1608143_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_004533881.1\|1608485_1609328_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	2.1e-17	26.6
WP_004190044.1\|1609636_1610671_+	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.1

DBSCAN-SWA_119

1630016 : 1630622

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189767.1\|1630016_1630622_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	4.2e-28	40.4

DBSCAN-SWA_120

1633763 : 1635858

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191998.1\|1633763_1635227_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004189313.1\|1635354_1635858_-	dihydrofolate reductase	A0A0A0PL85	Bacillus_phage	9.6e-26	40.4

DBSCAN-SWA_121

1641769 : 1642741

Yersinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189921.1\|1641769_1642741_+	thymidylate synthase	A0A1V0DY05	Yersinia_phage	2.9e-47	36.1

DBSCAN-SWA_122

1655881 : 1660441

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192078.1\|1655881_1657081_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.6e-55	34.3
WP_004192015.1\|1657225_1657888_+	lactate utilization protein C	NA	NA	NA	NA
WP_004527476.1\|1657943_1659386_+	sodium:proton antiporter	NA	NA	NA	NA
WP_004550133.1\|1659451_1660441_+	D-glycerate dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	8.2e-13	26.2

DBSCAN-SWA_123

1679194 : 1690929

Trichoplusia_ni_ascovirus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004532086.1\|1679194_1679944_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	9.9e-19	30.9
WP_004197638.1\|1680087_1680327_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.6e-10	47.1
WP_004193086.1\|1680483_1681722_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_004192146.1\|1681733_1682207_+	hypothetical protein	NA	NA	NA	NA
WP_004193971.1\|1682312_1682912_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	3.8e-05	27.3
WP_004524614.1\|1682995_1683598_+	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_004524615.1\|1683603_1684656_+	sigma E factor regulatory protein	NA	NA	NA	NA
WP_004192020.1\|1684672_1686181_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.8e-20	27.7
WP_004524616.1\|1686177_1686432_+	glutaredoxin family protein	NA	NA	NA	NA
WP_004193305.1\|1686672_1688466_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.1e-22	23.5
WP_004193513.1\|1688481_1689375_+	signal peptidase I	NA	NA	NA	NA
WP_004532088.1\|1689525_1690929_+	ribonuclease III	G8DDA3	Micromonas_pusilla_virus	4.9e-19	30.3

DBSCAN-SWA_124

1711701 : 1713567

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192713.1\|1711701_1713567_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-38	27.1

DBSCAN-SWA_125

1735261 : 1736056

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524643.1\|1735261_1736056_+	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	1.6e-06	24.9

DBSCAN-SWA_126

1755507 : 1756749

environmental_halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538092.1\|1755507_1756749_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	2.3e-76	39.1

DBSCAN-SWA_127

1762468 : 1764391

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038717745.1\|1762468_1764391_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-10	48.8

DBSCAN-SWA_128

1773701 : 1775453

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192163.1\|1773701_1775453_-	ribonucleoside triphosphate reductase	D9ZNH0	Clostridium_phage	2.2e-133	43.4

DBSCAN-SWA_129

1783659 : 1785120

Bandra_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533992.1\|1783659_1785120_+	deoxyribodipyrimidine photo-lyase	A0A2K9V7Z5	Bandra_megavirus	2.3e-43	28.3

DBSCAN-SWA_130

1791199 : 1792723

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527399.1\|1791199_1792723_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.6e-76	39.0

DBSCAN-SWA_131

1818251 : 1819244

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192001.1\|1818251_1819244_+	beta-propeller fold lactonase family protein	A0A2H4JCI3	uncultured_Caudovirales_phage	3.5e-11	59.6

DBSCAN-SWA_132

1833272 : 1834826

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524710.1\|1833272_1834826_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	2.9e-20	46.5

DBSCAN-SWA_133

1843662 : 1847344

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533932.1\|1843662_1845762_-	M3 family metallopeptidase	A0A1V0SD92	Indivirus	9.8e-40	21.6
WP_004524716.1\|1846314_1846530_+	hypothetical protein	NA	NA	NA	NA
WP_004536093.1\|1846486_1847344_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.4e-37	39.9

DBSCAN-SWA_134

1855858 : 1857628

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527370.1\|1855858_1857628_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.3e-34	23.9

DBSCAN-SWA_135

1866602 : 1880581

Lake_Baikal_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192918.1\|1866602_1867010_+	Fe-S cluster assembly scaffold IscU	A0A2H4N7M4	Lake_Baikal_phage	1.2e-50	78.0
WP_004191333.1\|1867092_1867416_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	8.9e-25	51.4
WP_004202016.1\|1867528_1868056_+	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_004527365.1\|1868113_1869982_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.6e-102	41.6
WP_004193872.1\|1870074_1870416_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_004192531.1\|1870434_1870644_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_004193508.1\|1871070_1871796_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_004527364.1\|1872147_1873674_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	4.7e-84	35.6
WP_004532142.1\|1873767_1874872_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_004191649.1\|1875232_1876927_-	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	1.1e-28	27.3
WP_004193226.1\|1876942_1878019_-	hypothetical protein	NA	NA	NA	NA
WP_004532144.1\|1878585_1879839_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_004195923.1\|1879831_1880581_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	2.2e-34	38.3

DBSCAN-SWA_136

1885075 : 1888975

Only_Syngen_Nebraska_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192790.1\|1885075_1886737_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.9e-150	52.0
WP_004193658.1\|1886733_1887588_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.3e-48	40.9
WP_004192585.1\|1887691_1888975_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	6.4e-151	62.6

DBSCAN-SWA_137

1900302 : 1901079

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193059.1\|1900302_1901079_+	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	3.3e-09	26.6

DBSCAN-SWA_138

1904871 : 1907688

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527350.1\|1904871_1907688_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	4.4e-27	24.1

DBSCAN-SWA_139

1913585 : 1917141

Indivirus(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193779.1\|1913585_1914077_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	4.2e-10	33.3
WP_004191635.1\|1914157_1914733_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	5.3e-12	39.3
WP_004195907.1\|1914789_1915512_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004192752.1\|1915743_1917141_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.8e-42	33.8

DBSCAN-SWA_140

1923409 : 1936376

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538131.1\|1923409_1928677_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	6.9e-58	22.6
WP_004538132.1\|1928688_1931484_+	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	7.9e-37	25.8
WP_122633383.1\|1932686_1936376_+	SAM-dependent DNA methyltransferase	A0A1B1IUC6	uncultured_Mediterranean_phage	1.9e-30	23.6

DBSCAN-SWA_141

1943277 : 1944437

Burkholderia_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085955848.1\|1943277_1944437_-\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3

DBSCAN-SWA_142

1955963 : 1962308

Burkholderia_virus(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045596585.1\|1955963_1957502_-	DNA cytosine methyltransferase	Q6V7R9	Burkholderia_virus	8.1e-108	45.8
WP_004538149.1\|1957901_1959932_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.2e-29	26.9
WP_038717430.1\|1960208_1961069_+	hypothetical protein	NA	NA	NA	NA
WP_085955848.1\|1961149_1962308_+\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3

DBSCAN-SWA_143

1973786 : 1977443

Burkholderia_virus(50.0%)

integrase

attL 1966962:1966977|attR 1981268:1981283

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1966962:1966977	attL	NA	NA	NA	NA
WP_004538160.1\|1973786_1974308_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.2e-42	52.6
WP_038716735.1\|1974304_1975036_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	1.2e-61	51.7
WP_004538162.1\|1975041_1976124_+	DUF3396 domain-containing protein	E5E3X8	Burkholderia_phage	4.3e-108	54.4
WP_004538163.1\|1976204_1977443_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.1e-110	51.3
1981268:1981283	attR	NA	NA	NA	NA

DBSCAN-SWA_144

1983103 : 1986250

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527336.1\|1983103_1986250_-	MMPL family transporter	S5VTK5	Leptospira_phage	1.2e-52	21.9

DBSCAN-SWA_145

1990479 : 1992318

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004547842.1\|1990479_1992318_+	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	1.9e-34	23.9

DBSCAN-SWA_146

1995409 : 2004349

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538167.1\|1995409_2004349_+	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	4.3e-60	25.1

DBSCAN-SWA_147

2008844 : 2014030

Yellowstone_lake_phycodnavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527325.1\|2008844_2009669_+	transketolase	A0A0P0YMZ3	Yellowstone_lake_phycodnavirus	1.9e-15	35.8
WP_004527324.1\|2009665_2010577_+	transketolase	NA	NA	NA	NA
WP_004538169.1\|2010573_2011716_+	hypothetical protein	NA	NA	NA	NA
WP_024431898.1\|2011767_2012895_+	acyltransferase	A0A1R3Y5Q6	Salmonella_virus	1.0e-06	24.9
WP_004538171.1\|2012935_2014030_+	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	8.4e-75	43.0

DBSCAN-SWA_148

2017286 : 2018351

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527319.1\|2017286_2018351_+	cysteine synthase family protein	A0A1W6JHY1	Lactococcus_phage	8.0e-22	31.2

DBSCAN-SWA_149

2035171 : 2038870

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527309.1\|2035171_2036821_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-21	33.7
WP_004193992.1\|2036956_2037661_+	C40 family peptidase	A0A217EQL1	Bacillus_phage	1.3e-20	39.4
WP_004192881.1\|2037826_2038870_-	patatin-like phospholipase family protein	A0A1V0SKV5	Klosneuvirus	6.4e-08	27.2

DBSCAN-SWA_150

2051606 : 2053157

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192408.1\|2051606_2053157_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.2e-43	29.5

DBSCAN-SWA_151

2063574 : 2066140

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534913.1\|2063574_2065515_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.1e-59	30.5
WP_004192400.1\|2065660_2066140_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	8.2e-27	39.9

DBSCAN-SWA_152

2079198 : 2081804

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527294.1\|2079198_2081274_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	5.9e-146	44.6
WP_004193946.1\|2081270_2081804_+	peptide deformylase	A0A0E3FIY1	Synechococcus_phage	2.3e-09	32.9

DBSCAN-SWA_153

2091195 : 2091978

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527291.1\|2091195_2091978_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	7.2e-20	39.6

DBSCAN-SWA_154

2102086 : 2102731

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538183.1\|2102086_2102731_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	2.5e-26	42.0

DBSCAN-SWA_155

2108832 : 2113444

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193522.1\|2108832_2111232_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	9.8e-169	36.1
WP_004192504.1\|2111359_2111794_+	hypothetical protein	NA	NA	NA	NA
WP_004192895.1\|2111873_2112821_+	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_004197080.1\|2112997_2113444_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.2e-26	42.8

DBSCAN-SWA_156

2119009 : 2123919

Klosneuvirus(33.33%)

integrase

attL 2110684:2110698|attR 2126383:2126397

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2110684:2110698	attL	NA	NA	NA	NA
WP_004192833.1\|2119009_2120470_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.5e-92	38.7
WP_004527277.1\|2120476_2121130_+	hypothetical protein	NA	NA	NA	NA
WP_004538186.1\|2121257_2122877_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.9e-15	29.1
WP_080292623.1\|2123259_2123919_+\|integrase	integrase arm-type DNA-binding domain-containing protein	T1S9J3	Salmonella_phage	2.8e-49	48.4
2126383:2126397	attR	NA	NA	NA	NA

DBSCAN-SWA_157

2132806 : 2133403

Pandoravirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538193.1\|2132806_2133403_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	1.0e-05	30.2

DBSCAN-SWA_158

2168636 : 2169362

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199523.1\|2168636_2169362_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	8.1e-34	36.7

DBSCAN-SWA_159

2174365 : 2182559

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196630.1\|2174365_2174629_+	hypothetical protein	Q8W6S4	Burkholderia_virus	2.2e-26	85.5
WP_076833215.1\|2174612_2174798_+	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2
WP_038728419.1\|2174818_2175541_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	1.9e-30	39.9
WP_053293552.1\|2175547_2176150_-	hypothetical protein	NA	NA	NA	NA
WP_004538208.1\|2176491_2176998_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.0e-19	40.1
WP_004538209.1\|2176994_2177420_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.8e-15	49.4
WP_038717461.1\|2177700_2178096_-	hypothetical protein	NA	NA	NA	NA
WP_004531416.1\|2178349_2178577_+	hypothetical protein	Q8W6S4	Burkholderia_virus	3.8e-22	75.8
WP_004527234.1\|2178612_2178846_-	hypothetical protein	A4PE26	Ralstonia_virus	4.3e-13	60.6
WP_004550288.1\|2178921_2179383_-	avidin	NA	NA	NA	NA
WP_045586613.1\|2179936_2180326_+	hypothetical protein	NA	NA	NA	NA
WP_004527233.1\|2180322_2180505_+	hypothetical protein	NA	NA	NA	NA
WP_004193371.1\|2180631_2181255_-	phospholipase D family protein	NA	NA	NA	NA
WP_004527232.1\|2181449_2182559_-	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	3.1e-37	31.6

DBSCAN-SWA_160

2191499 : 2196198

Agrobacterium_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193408.1\|2191499_2192153_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.1e-53	56.5
WP_004521258.1\|2192313_2193585_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	59.0
WP_004193454.1\|2193780_2196198_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.9e-222	52.8

DBSCAN-SWA_161

2203501 : 2204218

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534450.1\|2203501_2204218_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.2e-35	40.2

DBSCAN-SWA_162

2209517 : 2218015

Burkholderia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538217.1\|2209517_2213588_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	2.9e-237	100.0
WP_004527207.1\|2213592_2214126_+	N-acetyltransferase	A9YX37	Burkholderia_phage	3.6e-15	100.0
WP_004527206.1\|2214223_2215003_-	exported isomerase	NA	NA	NA	NA
WP_004199503.1\|2215027_2215342_-	BolA family transcriptional regulator	NA	NA	NA	NA
WP_004192037.1\|2215344_2215875_-	septation protein A	NA	NA	NA	NA
WP_004527204.1\|2215967_2216399_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_004538218.1\|2216449_2218015_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	5.2e-54	31.6

DBSCAN-SWA_163

2222152 : 2222791

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521275.1\|2222152_2222791_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	1.8e-21	35.6

DBSCAN-SWA_164

2227606 : 2233093

Acanthamoeba_polyphaga_lentillevirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521279.1\|2227606_2228566_+	alpha/beta hydrolase	J3IZC7	Acanthamoeba_polyphaga_lentillevirus	7.2e-30	30.3
WP_004192469.1\|2228929_2229370_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004191929.1\|2229405_2230257_-	NRDE family protein	A0A0M3ZEJ9	Turkeypox_virus	7.1e-21	28.5
WP_004193428.1\|2230327_2231374_-	folate-binding protein YgfZ	NA	NA	NA	NA
WP_004191597.1\|2231452_2232472_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_004521281.1\|2232472_2233093_+	dTMP kinase	A0A1L2BX49	Bacteriophage	2.7e-30	41.1

DBSCAN-SWA_165

2238250 : 2239429

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527195.1\|2238250_2239429_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	1.1e-69	40.6

DBSCAN-SWA_166

2247734 : 2249510

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527189.1\|2247734_2249510_-	glyoxylate carboligase	E4WLQ6	Ostreococcus_tauri_virus	6.1e-43	27.9

DBSCAN-SWA_167

2255964 : 2262466

Burkholderia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192724.1\|2255964_2257347_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.2e-139	58.5
WP_004193838.1\|2257485_2258112_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_004193771.1\|2258122_2259133_+	inorganic phosphate transporter	NA	NA	NA	NA
WP_038717451.1\|2259368_2260592_-	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	3.0e-12	34.1
WP_038717447.1\|2260831_2262466_-	PhoH family protein	A0A2I7SAD7	Vibrio_phage	6.2e-74	38.5

DBSCAN-SWA_168

2266414 : 2267422

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191549.1\|2266414_2267422_-	glycosyltransferase	B9UDL7	Salmonella_phage	4.3e-33	29.9

DBSCAN-SWA_169

2280394 : 2282992

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527174.1\|2280394_2282992_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	8.2e-121	36.8

DBSCAN-SWA_170

2294293 : 2308684

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191795.1\|2294293_2294620_-	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	4.0e-17	43.0
WP_004193273.1\|2295286_2297764_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	8.6e-43	37.0
WP_004192342.1\|2297860_2298187_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_038707995.1\|2298224_2298821_+	recombination protein RecR	NA	NA	NA	NA
WP_004538227.1\|2298890_2300096_+	CoA transferase	NA	NA	NA	NA
WP_004521326.1\|2300200_2300962_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.9e-62	52.7
WP_004538228.1\|2300958_2301927_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.6e-35	48.9
WP_004192107.1\|2301938_2302829_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	3.3e-05	34.3
WP_004193640.1\|2302840_2303920_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.9e-32	35.4
WP_004191371.1\|2303927_2304704_+	3'-5' exonuclease	NA	NA	NA	NA
WP_004192869.1\|2304902_2305763_-	hypothetical protein	NA	NA	NA	NA
WP_004192701.1\|2305840_2307238_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.3e-27	25.4
WP_004521332.1\|2307311_2308010_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_004193561.1\|2308258_2308684_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.6e-21	42.1

DBSCAN-SWA_171

2322865 : 2328309

Powai_lake_megavirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193462.1\|2322865_2324212_+	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	1.5e-70	36.8
WP_004527158.1\|2324218_2324812_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_004540160.1\|2324881_2326102_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	1.9e-240	99.8
WP_004527157.1\|2326257_2326452_-	hypothetical protein	NA	NA	NA	NA
WP_004521342.1\|2326416_2328309_+	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	5.7e-79	32.7

DBSCAN-SWA_172

2332144 : 2334403

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534786.1\|2332144_2334403_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.4e-78	30.1

DBSCAN-SWA_173

2352914 : 2353610

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192911.1\|2352914_2353610_-	ATP-binding cassette domain-containing protein	F2Y302	Organic_Lake_phycodnavirus	8.9e-06	29.3

DBSCAN-SWA_174

2356675 : 2358268

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538238.1\|2356675_2358268_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	3.1e-54	26.8

DBSCAN-SWA_175

2366532 : 2368619

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527138.1\|2366532_2367693_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.0e-23	34.0
WP_004521363.1\|2367689_2368619_+	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	3.7e-07	22.8

DBSCAN-SWA_176

2380603 : 2383774

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538243.1\|2380603_2383774_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	1.3e-06	17.6

DBSCAN-SWA_177

2393877 : 2394855

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521382.1\|2393877_2394855_+	D-glycerate dehydrogenase	M1I1Q8	Acanthocystis_turfacea_Chlorella_virus	1.2e-16	25.8

DBSCAN-SWA_178

2401370 : 2404379

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017882262.1\|2401370_2404379_+	amino acid adenylation domain-containing protein	A0A2K9L3I8	Tupanvirus	4.8e-40	26.5

DBSCAN-SWA_179

2420878 : 2421793

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538251.1\|2420878_2421793_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.9e-30	36.6

DBSCAN-SWA_180

2426940 : 2430446

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538252.1\|2426940_2427945_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.5e-17	32.7
WP_004527100.1\|2427941_2428682_+	ABC transporter permease	NA	NA	NA	NA
WP_004531360.1\|2428856_2430446_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-09	37.1

DBSCAN-SWA_181

2458305 : 2461554

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004531338.1\|2458305_2461554_+	response regulator	A0A2K9L5I4	Tupanvirus	9.6e-26	32.3

DBSCAN-SWA_182

2483801 : 2486093

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534959.1\|2483801_2486093_+	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	1.6e-19	28.9

DBSCAN-SWA_183

2493918 : 2494524

Freshwater_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038717281.1\|2493918_2494524_+	adenylyl-sulfate kinase	A0A1B0XTK9	Freshwater_phage	4.1e-07	36.0

DBSCAN-SWA_184

2504125 : 2505448

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521480.1\|2504125_2505448_-	MFS transporter	Q6JIH2	Burkholderia_virus	9.1e-84	42.2

DBSCAN-SWA_185

2518833 : 2519214

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521494.1\|2518833_2519214_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.4e-15	42.9

DBSCAN-SWA_186

2522761 : 2526779

Shigella_phage(50.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521497.1\|2522761_2523376_+	recombinase family protein	A0A0C4UR34	Shigella_phage	1.2e-38	48.7
WP_017880574.1\|2523643_2524042_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_004527018.1\|2524620_2524899_+	DUF2946 family protein	NA	NA	NA	NA
WP_004531304.1\|2526185_2526779_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	4.0e-39	57.1

DBSCAN-SWA_187

2544252 : 2564895

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538287.1\|2544252_2545974_-	carbamoyltransferase	E3SL71	Synechococcus_phage	9.2e-52	32.0
WP_038717273.1\|2546064_2564895_-	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	3.7e-114	22.9

DBSCAN-SWA_188

2578058 : 2579051

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009930227.1\|2578058_2579051_-	histidinol-phosphate aminotransferase family protein	A0A0H3TLT9	Faustovirus	9.8e-06	25.9

DBSCAN-SWA_189

2587717 : 2589460

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521529.1\|2587717_2589460_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-10	56.0

DBSCAN-SWA_190

2594490 : 2598713

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198168.1\|2594490_2595261_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.8e-45	40.6
WP_004538298.1\|2595622_2596561_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004521532.1\|2596557_2597778_+	ABC transporter permease	NA	NA	NA	NA
WP_004192711.1\|2597774_2598713_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.5e-19	30.6

DBSCAN-SWA_191

2625323 : 2626685

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521554.1\|2625323_2626685_+	chitinase	M1HTM3	Paramecium_bursaria_Chlorella_virus	1.1e-39	37.5

DBSCAN-SWA_192

2646316 : 2663771

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041286123.1\|2646316_2651515_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.2e-48	22.9
WP_038717090.1\|2651563_2661442_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	3.3e-61	29.3
WP_004552852.1\|2662025_2663771_+	cyclic peptide export ABC transporter	G9BWD6	Planktothrix_phage	4.5e-14	24.5

DBSCAN-SWA_193

2669124 : 2670015

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526941.1\|2669124_2670015_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.5e-09	31.2

DBSCAN-SWA_194

2677824 : 2679432

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004535351.1\|2677824_2679432_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	30.8

DBSCAN-SWA_195

2684775 : 2686536

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538313.1\|2684775_2686536_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	4.9e-08	23.9

DBSCAN-SWA_196

2695105 : 2702036

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526920.1\|2695105_2698237_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.3e-51	21.4
WP_004538316.1\|2698253_2699453_-	MexX/AxyX family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_041286125.1\|2699596_2700268_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_017843866.1\|2700620_2702036_+	peptidoglycan DD-metalloendopeptidase family protein	G9FHH0	Rhodococcus_phage	2.2e-11	40.4

DBSCAN-SWA_197

2717590 : 2738192

Bacillus_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538321.1\|2717590_2718421_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-30	40.4
WP_052112444.1\|2718515_2718884_-	hypothetical protein	NA	NA	NA	NA
WP_004193173.1\|2718936_2719983_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004521606.1\|2720235_2721540_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-44	30.0
WP_004192871.1\|2722024_2723707_-	SpoVR family protein	NA	NA	NA	NA
WP_004538324.1\|2723706_2724972_-	YeaH/YhbH family protein	A0A219UQP6	Bacillus_phage	1.9e-09	37.2
WP_004192719.1\|2725095_2727018_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_038717086.1\|2727910_2729776_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-11	41.5
WP_004521612.1\|2729988_2730963_-	ribokinase	NA	NA	NA	NA
WP_004521613.1\|2730959_2731991_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.5e-37	32.9
WP_004534781.1\|2732020_2733034_-	ABC transporter permease	NA	NA	NA	NA
WP_004521615.1\|2733104_2734676_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-08	24.5
WP_004531229.1\|2734818_2735781_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004193901.1\|2736140_2737067_-	CysB family HTH-type transcriptional regulator	NA	NA	NA	NA
WP_004192434.1\|2737136_2738192_-	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-28	34.6

DBSCAN-SWA_198

2741590 : 2745455

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191638.1\|2741590_2742238_+	transcriptional repressor LexA	A0A218MND2	uncultured_virus	1.2e-09	37.3
WP_004192710.1\|2742300_2742627_+	hypothetical protein	NA	NA	NA	NA
WP_004521621.1\|2742660_2743395_+	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_004526895.1\|2743819_2744311_-	universal stress protein	NA	NA	NA	NA
WP_004538328.1\|2744540_2745455_+	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-27	27.8

DBSCAN-SWA_199

2757015 : 2758023

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004531221.1\|2757015_2758023_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.0e-27	36.0

DBSCAN-SWA_200

2762444 : 2762783

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191709.1\|2762444_2762783_-	multidrug efflux SMR transporter	E5EPE2	Acinetobacter_phage	8.7e-07	33.6

DBSCAN-SWA_201

2772524 : 2779559

Rhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004266752.1\|2772524_2773424_-	N-acetylmuramoyl-L-alanine amidase	A0A076YN96	Rhizobium_phage	3.6e-07	30.0
WP_004192030.1\|2773486_2773786_-	hypothetical protein	NA	NA	NA	NA
WP_004191786.1\|2773797_2774541_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_004550537.1\|2774672_2777111_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.5e-68	32.6
WP_004538333.1\|2777846_2779559_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.3e-13	27.3

DBSCAN-SWA_202

2791321 : 2793094

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199468.1\|2791321_2793094_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	6.6e-37	29.9

DBSCAN-SWA_203

2817472 : 2818903

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534933.1\|2817472_2818903_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-42	28.0

DBSCAN-SWA_204

2832409 : 2835337

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526850.1\|2832409_2835337_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	6.8e-23	25.3

DBSCAN-SWA_205

2839394 : 2842047

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038716956.1\|2839394_2840726_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.1e-23	35.1
WP_004193481.1\|2841144_2842047_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.5e-10	23.6

DBSCAN-SWA_206

2850532 : 2851717

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526843.1\|2850532_2851717_+	acyltransferase	A0A166XZF2	Gordonia_phage	5.2e-14	28.6

DBSCAN-SWA_207

2854921 : 2862342

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526840.1\|2854921_2855326_-	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	2.8e-12	41.1
WP_004526839.1\|2855398_2857831_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_004534778.1\|2857918_2858932_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	3.5e-27	39.3
WP_004192938.1\|2859080_2859440_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_004191477.1\|2859470_2859668_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_071810680.1\|2859860_2860385_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.1e-11	28.7
WP_004191232.1\|2860434_2862342_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.7e-123	37.5

DBSCAN-SWA_208

2881635 : 2882745

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534774.1\|2881635_2882745_-	chorismate synthase	A0A291AU41	Pandoravirus	1.1e-82	43.7

DBSCAN-SWA_209

2890286 : 2891258

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538354.1\|2890286_2891258_+	ser/threonine protein phosphatase	A0A291ATQ8	Pandoravirus	9.5e-22	32.0

DBSCAN-SWA_210

2898131 : 2908862

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004531196.1\|2898131_2899808_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-15	31.2
WP_004192717.1\|2900159_2901410_+	MFS transporter	NA	NA	NA	NA
WP_004193777.1\|2901738_2902527_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_004538357.1\|2902523_2904887_-	UvrD-helicase domain-containing protein	S5M596	Bacillus_phage	6.4e-72	30.7
WP_004531195.1\|2905026_2907894_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.1e-146	39.3
WP_004192544.1\|2907980_2908862_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.9e-69	47.9

DBSCAN-SWA_211

2920978 : 2921779

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193469.1\|2920978_2921779_+	sugar ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.1e-11	26.2

DBSCAN-SWA_212

2927625 : 2930639

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521714.1\|2927625_2928330_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.7e-08	29.1
WP_041286127.1\|2928326_2930639_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FFL6	Cedratvirus	1.4e-07	26.9

DBSCAN-SWA_213

2935817 : 2937374

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004550588.1\|2935817_2937374_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	3.8e-12	25.1

DBSCAN-SWA_214

2940942 : 2983389

Klosneuvirus(16.67%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004204967.1\|2940942_2943567_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.5e-80	39.2
WP_004531186.1\|2944250_2945471_+	CoA transferase	NA	NA	NA	NA
WP_004534928.1\|2945810_2946020_-	hypothetical protein	NA	NA	NA	NA
WP_004193654.1\|2946299_2948009_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	8.8e-188	57.5
WP_004538368.1\|2948366_2948849_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	7.5e-20	41.3
WP_004193860.1\|2948867_2949254_-	hypothetical protein	NA	NA	NA	NA
WP_004531183.1\|2949541_2951641_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_004521727.1\|2951566_2951746_+	hypothetical protein	NA	NA	NA	NA
WP_004521728.1\|2951742_2952603_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_004538370.1\|2952646_2954053_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_038716931.1\|2954286_2955870_+	acid phosphatase	NA	NA	NA	NA
WP_004538372.1\|2955981_2957445_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	6.8e-80	38.6
WP_004538373.1\|2957659_2958853_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_004531180.1\|2959476_2960664_+	HlyD family secretion protein	NA	NA	NA	NA
WP_004538374.1\|2960836_2962456_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004538375.1\|2962457_2964167_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004192810.1\|2964470_2965103_-	response regulator transcription factor	NA	NA	NA	NA
WP_004526787.1\|2965103_2967185_-	response regulator	A0A1V0SGR3	Hokovirus	3.9e-12	26.3
WP_004521738.1\|2967595_2968561_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004538377.1\|2968576_2970988_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_004526784.1\|2971032_2971872_-	molecular chaperone	NA	NA	NA	NA
WP_004526783.1\|2971889_2972414_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|2972490_2973051_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004538378.1\|2973103_2973649_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004534686.1\|2973635_2973824_-	hypothetical protein	NA	NA	NA	NA
WP_076812081.1\|2973909_2974089_-	hypothetical protein	NA	NA	NA	NA
WP_162474212.1\|2974107_2974284_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|2974468_2975362_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004538381.1\|2975778_2977065_+	MFS transporter	NA	NA	NA	NA
WP_004531169.1\|2977109_2978093_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004193855.1\|2978560_2978842_+	H-NS histone family protein	NA	NA	NA	NA
WP_004191144.1\|2979094_2979364_-	hypothetical protein	NA	NA	NA	NA
WP_038716951.1\|2981831_2982752_-	hypothetical protein	NA	NA	NA	NA
WP_154316409.1\|2982869_2983034_-	hypothetical protein	NA	NA	NA	NA
WP_009980631.1\|2983062_2983389_-\|transposase	transposase	S5WIU1	Leptospira_phage	4.4e-24	57.5

DBSCAN-SWA_215

2987732 : 2987900

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009927769.1\|2987732_2987900_+	hypothetical protein	A0A0P0ZBS5	Stx2-converting_phage	1.9e-07	51.7

DBSCAN-SWA_216

2994885 : 2997720

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521761.1\|2994885_2997720_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.4e-20	25.9

DBSCAN-SWA_217

3007831 : 3010639

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538397.1\|3007831_3010639_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.0e-28	24.8

DBSCAN-SWA_218

3021992 : 3027587

uncultured_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526736.1\|3021992_3023522_-	hypothetical protein	D6PFH9	uncultured_phage	1.6e-15	25.4
WP_004521783.1\|3023523_3024234_-	OmpA family protein	NA	NA	NA	NA
WP_004552911.1\|3024314_3027587_-	hypothetical protein	A0A2C9CZB7	Yersinia_phage	1.4e-05	33.0

DBSCAN-SWA_219

3062569 : 3071344

Ralstonia_virus(33.33%)

integrase

attL 3054465:3054480|attR 3066156:3066171

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3054465:3054480	attL	NA	NA	NA	NA
WP_004526711.1\|3062569_3062992_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	8.3e-15	47.0
WP_004526710.1\|3062994_3063498_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.9e-19	39.4
WP_014696823.1\|3063839_3064442_+	hypothetical protein	NA	NA	NA	NA
WP_004521809.1\|3064450_3065164_+	hypothetical protein	A4PE26	Ralstonia_virus	1.5e-32	43.3
WP_071810706.1\|3065341_3065770_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5NNJ1	Burkholderia_phage	4.6e-21	47.4
WP_004521810.1\|3066078_3066909_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
3066156:3066171	attR	NA	NA	NA	NA
WP_004521811.1\|3067456_3068365_+	aldose 1-epimerase	NA	NA	NA	NA
WP_004192768.1\|3068661_3069363_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	9.9e-13	44.8
WP_004531123.1\|3069440_3069614_-	hypothetical protein	NA	NA	NA	NA
WP_004192280.1\|3069625_3069739_-	hypothetical protein	NA	NA	NA	NA
WP_004526693.1\|3069718_3071344_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.3e-68	35.4

DBSCAN-SWA_220

3085557 : 3096976

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526577.1\|3085557_3086868_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.4e-36	36.4
WP_004192125.1\|3086937_3087639_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	5.1e-33	36.9
WP_004193271.1\|3087667_3088372_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_004193614.1\|3088391_3089240_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	2.1e-17	34.8
WP_004521821.1\|3089255_3090149_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_004193912.1\|3090145_3091132_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_004199345.1\|3091238_3092267_-	phosphate ABC transporter substrate-binding protein PstS	A0A1D7SRJ6	Cyanophage	2.5e-44	35.6
WP_004550648.1\|3092702_3094061_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_004538420.1\|3094086_3094977_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	4.8e-20	31.2
WP_004191694.1\|3095089_3096976_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	5.6e-111	40.8

DBSCAN-SWA_221

3103722 : 3104868

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198695.1\|3103722_3104868_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.2e-46	34.0

DBSCAN-SWA_222

3109154 : 3116482

Bacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538424.1\|3109154_3110747_-	transglycosylase SLT domain-containing protein	U5PVY0	Bacillus_phage	2.2e-07	37.2
WP_004526568.1\|3110899_3111706_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_004192921.1\|3111726_3112539_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004193456.1\|3112535_3112982_+	ribonuclease HI	J9Q745	Salmonella_phage	1.2e-43	53.1
WP_004531112.1\|3113039_3113762_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.7e-39	40.0
WP_004193459.1\|3114127_3114460_-	YnfA family protein	A0A218MNG8	uncultured_virus	2.0e-24	57.6
WP_024431860.1\|3114994_3116482_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	6.7e-59	33.0

DBSCAN-SWA_223

3135041 : 3135443

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526549.1\|3135041_3135443_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	9.4e-08	33.6

DBSCAN-SWA_224

3147066 : 3151464

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521848.1\|3147066_3148968_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	6.6e-136	43.0
WP_004521850.1\|3149126_3149621_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_004526540.1\|3149922_3151464_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.3e-16	26.7

DBSCAN-SWA_225

3154772 : 3156137

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538441.1\|3154772_3156137_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.1e-21	36.1

DBSCAN-SWA_226

3165447 : 3166476

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538444.1\|3165447_3166476_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.5e-21	31.2

DBSCAN-SWA_227

3183437 : 3189943

Virus_Rctr197k(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038716513.1\|3183437_3186134_-	AAA family ATPase	A0A1P8DII4	Virus_Rctr197k	4.1e-14	36.3
WP_004538450.1\|3186130_3189943_-	exodeoxyribonuclease V subunit beta	G3MA40	Bacillus_virus	3.6e-08	29.7

DBSCAN-SWA_228

3201005 : 3201776

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004266874.1\|3201005_3201776_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-25	36.8

DBSCAN-SWA_229

3236441 : 3237716

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526475.1\|3236441_3237716_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	9.7e-83	42.7

DBSCAN-SWA_230

3267646 : 3268237

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185716.1\|3267646_3268237_-	NUDIX hydrolase	A0A2K9VDH1	Lactobacillus_phage	3.0e-10	36.7

DBSCAN-SWA_231

3294054 : 3307943

Micromonas_sp._RCC1109_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522419.1\|3294054_3295602_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	2.1e-07	27.0
WP_004522420.1\|3295960_3296833_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_004531897.1\|3296849_3297500_-	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	5.4e-13	29.8
WP_004185539.1\|3297621_3298638_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_004186134.1\|3298720_3299212_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_004522422.1\|3299323_3301087_-	acetolactate synthase 3 catalytic subunit	E5EQ70	Micromonas_sp._RCC1109_virus	6.5e-53	29.2
WP_004186304.1\|3301482_3302043_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_004185907.1\|3302039_3302462_+	DUF3619 family protein	NA	NA	NA	NA
WP_004526454.1\|3302492_3303248_+	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_004538570.1\|3303254_3303764_+	RDD family protein	NA	NA	NA	NA
WP_004196438.1\|3303854_3304793_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	7.2e-67	48.5
WP_004185574.1\|3304814_3305849_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_004522425.1\|3305857_3306403_+	diacylglycerol kinase	NA	NA	NA	NA
WP_004203514.1\|3306639_3307359_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004185518.1\|3307355_3307943_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	5.8e-14	34.0

DBSCAN-SWA_232

3311824 : 3315768

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011204962.1\|3311824_3313141_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.5e-62	37.8
WP_004522430.1\|3313388_3314783_-	amidase	NA	NA	NA	NA
WP_004533660.1\|3315126_3315768_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.1e-13	31.8

DBSCAN-SWA_233

3322481 : 3328429

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526440.1\|3322481_3325463_-	DUF4118 domain-containing protein	A0A1V0SGX0	Hokovirus	1.6e-06	23.7
WP_004186443.1\|3325747_3326329_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_004522436.1\|3326341_3328429_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.3e-20	25.7

DBSCAN-SWA_234

3342940 : 3344329

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538565.1\|3342940_3344329_+	purine permease	H9YQ34	environmental_Halophage	1.6e-25	50.8

DBSCAN-SWA_235

3356504 : 3357269

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538561.1\|3356504_3357269_+	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	6.4e-05	34.2

DBSCAN-SWA_236

3363911 : 3369266

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186431.1\|3363911_3365702_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	1.2e-49	28.1
WP_004535801.1\|3365741_3369266_-	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	9.3e-184	35.9

DBSCAN-SWA_237

3372280 : 3373729

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194757.1\|3372280_3373729_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.3e-54	35.6

DBSCAN-SWA_238

3377760 : 3383133

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041286132.1\|3377760_3383133_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	9.8e-84	49.3

DBSCAN-SWA_239

3398542 : 3399496

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533671.1\|3398542_3399496_+	transaldolase	A0A0E3F5V4	Synechococcus_phage	4.3e-11	29.6

DBSCAN-SWA_240

3404673 : 3406572

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522478.1\|3404673_3406572_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	5.1e-120	38.3

DBSCAN-SWA_241

3412893 : 3420963

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004555413.1\|3412893_3415254_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-15	35.1
WP_004531925.1\|3415385_3416594_+	chromate transporter	NA	NA	NA	NA
WP_004538549.1\|3417021_3418047_-	histone deacetylase family protein	A0A0N9QAS6	Chrysochromulina_ericina_virus	2.0e-17	28.4
WP_004531928.1\|3418385_3419648_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_004526397.1\|3419649_3420963_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.3e-39	31.5

DBSCAN-SWA_242

3425152 : 3431664

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522490.1\|3425152_3427471_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.8e-80	34.5
WP_004185934.1\|3427529_3429512_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.4e-91	34.1
WP_009952743.1\|3429717_3431664_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.2e-45	27.8

DBSCAN-SWA_243

3442492 : 3505288

uncultured_Caudovirales_phage(31.43%)

terminase,plate,capsid,head,tail,protease,portal,integrase

attL 3477348:3477364|attR 3503016:3503032

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538544.1\|3442492_3443164_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	2.9e-110	81.4
WP_038716627.1\|3443243_3443711_+	hypothetical protein	C7BGE3	Burkholderia_phage	2.1e-51	63.0
WP_080292633.1\|3443707_3443989_+	hypothetical protein	NA	NA	NA	NA
WP_004538541.1\|3444048_3444474_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.6e-13	46.0
WP_080292632.1\|3444470_3444980_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	9.4e-21	41.3
WP_004538539.1\|3444972_3445446_+	hypothetical protein	NA	NA	NA	NA
WP_004547844.1\|3445402_3445921_+	hypothetical protein	NA	NA	NA	NA
WP_038741524.1\|3445917_3446661_+	hypothetical protein	A4PE26	Ralstonia_virus	8.0e-37	43.3
WP_038741522.1\|3446696_3447113_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.3e-55	50.4
WP_080292630.1\|3447380_3447836_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_144411680.1\|3447853_3448507_+	hypothetical protein	NA	NA	NA	NA
WP_004538533.1\|3448836_3449625_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	3.0e-151	96.9
WP_004538532.1\|3449767_3450313_-	lysozyme	Q8W6S5	Burkholderia_virus	5.4e-75	87.8
WP_038741520.1\|3450312_3450810_-	lysozyme	A4JX20	Burkholderia_virus	4.5e-68	80.6
WP_004533694.1\|3450802_3450997_-	hypothetical protein	NA	NA	NA	NA
WP_004538530.1\|3451072_3452125_-	phage late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	8.6e-77	43.6
WP_004538529.1\|3452134_3452341_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	5.3e-15	59.7
WP_004538528.1\|3452315_3453197_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.4e-32	37.2
WP_038716612.1\|3453205_3455614_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.4e-61	32.7
WP_004538526.1\|3455701_3456004_-\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	4.3e-05	35.9
WP_143293909.1\|3456250_3457510_-	hypothetical protein	NA	NA	NA	NA
WP_004538524.1\|3457859_3458363_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	3.3e-42	51.9
WP_004538523.1\|3458373_3459543_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	6.9e-160	72.2
WP_004538522.1\|3459606_3460293_-\|tail	tail assembly chaperone	E5E3Q6	Burkholderia_phage	2.0e-58	58.6
WP_004538521.1\|3460305_3462111_-\|tail	tail fiber protein	A4JWS9	Burkholderia_virus	1.5e-150	66.3
WP_004538520.1\|3462098_3462674_-\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	2.1e-32	49.0
WP_004538519.1\|3462666_3463560_-\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	1.7e-49	41.4
WP_004538518.1\|3463556_3463901_-	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.3e-23	50.0
WP_004538517.1\|3463897_3464095_-	hypothetical protein	NA	NA	NA	NA
WP_004538516.1\|3464157_3464838_-\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	1.5e-18	34.4
WP_004538515.1\|3464840_3465374_-	hypothetical protein	Q9JML9	Wolbachia_phage	5.2e-22	40.3
WP_004538514.1\|3465363_3465894_-	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.8e-11	29.9
WP_004538513.1\|3465895_3466186_-	hypothetical protein	NA	NA	NA	NA
WP_004538512.1\|3466189_3467185_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.3e-108	58.5
WP_004538511.1\|3467250_3467595_-\|head	head decoration protein	NA	NA	NA	NA
WP_004538510.1\|3467621_3468722_-	peptidase S14	A0A2H4JDI2	uncultured_Caudovirales_phage	2.8e-46	35.8
WP_004538509.1\|3468718_3470212_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	3.2e-133	51.5
WP_004538508.1\|3470208_3470415_-	hypothetical protein	NA	NA	NA	NA
WP_080231288.1\|3470425_3472414_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	1.1e-178	52.9
WP_080231287.1\|3472376_3472946_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_144241902.1\|3473098_3473530_-	hypothetical protein	NA	NA	NA	NA
WP_004538506.1\|3473698_3474547_-	DUF4747 family protein	NA	NA	NA	NA
WP_004538505.1\|3474927_3475515_-	hypothetical protein	NA	NA	NA	NA
WP_004538504.1\|3475740_3478233_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	1.6e-97	41.3
3477348:3477364	attL	NA	NA	NA	NA
WP_004538503.1\|3478352_3478823_-	hypothetical protein	NA	NA	NA	NA
WP_038716608.1\|3479196_3479658_-	hypothetical protein	NA	NA	NA	NA
WP_004538501.1\|3479656_3480112_+	hypothetical protein	NA	NA	NA	NA
WP_080231289.1\|3480119_3480452_-	hypothetical protein	NA	NA	NA	NA
WP_038716606.1\|3480465_3480993_-	hypothetical protein	C7BGG0	Burkholderia_phage	3.3e-29	47.1
WP_004538499.1\|3481068_3481254_-	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	1.7e-09	59.3
WP_144411681.1\|3481318_3481873_+	hypothetical protein	NA	NA	NA	NA
WP_038741518.1\|3482189_3482408_+	hypothetical protein	NA	NA	NA	NA
WP_004538497.1\|3482462_3482798_+	hypothetical protein	NA	NA	NA	NA
WP_038716605.1\|3482794_3483400_+	hypothetical protein	NA	NA	NA	NA
WP_004538495.1\|3483396_3483846_+	hypothetical protein	NA	NA	NA	NA
WP_038716603.1\|3483845_3485165_+	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_004538494.1\|3485278_3485608_+	hypothetical protein	NA	NA	NA	NA
WP_004538493.1\|3485616_3486393_+	hypothetical protein	Q6J1P0	Burkholderia_virus	3.2e-20	56.2
WP_009964477.1\|3486389_3486620_+	hypothetical protein	NA	NA	NA	NA
WP_038741516.1\|3486652_3487753_-\|integrase	site-specific integrase	A0A2D1GMX8	Marinobacter_phage	1.5e-44	31.0
WP_009970293.1\|3488207_3488612_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	4.5e-10	48.2
WP_051177548.1\|3488545_3490303_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_020850843.1\|3490327_3490552_-	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_004543927.1\|3490570_3490750_-	hypothetical protein	NA	NA	NA	NA
WP_143285126.1\|3490851_3491142_-	hypothetical protein	NA	NA	NA	NA
WP_045596639.1\|3491138_3500462_-	contact-dependent inhibition toxin BcpA	A0A0R6PJK4	Moraxella_phage	2.9e-35	34.4
WP_038717116.1\|3502132_3502609_-	hypothetical protein	NA	NA	NA	NA
WP_004200110.1\|3503065_3503290_+	hypothetical protein	NA	NA	NA	NA
3503016:3503032	attR	NA	NA	NA	NA
WP_038717114.1\|3503514_3504651_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_004522511.1\|3504748_3505288_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA

DBSCAN-SWA_244

3511358 : 3511961

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522515.1\|3511358_3511961_-	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	3.3e-25	62.8

DBSCAN-SWA_245

3515429 : 3516770

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192968.1\|3515429_3516770_-	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-32	37.7

DBSCAN-SWA_246

3520714 : 3521440

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522521.1\|3520714_3521440_-	response regulator	W8CYM9	Bacillus_phage	9.2e-30	35.0

DBSCAN-SWA_247

3526077 : 3535130

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038708144.1\|3526077_3526857_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-17	31.3
WP_004191758.1\|3527751_3528840_+	porin	NA	NA	NA	NA
WP_004193987.1\|3529310_3529649_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_004543855.1\|3529709_3531410_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	7.6e-91	36.8
WP_004538480.1\|3531530_3532709_+	N-acetyltransferase	NA	NA	NA	NA
WP_004555959.1\|3532930_3533137_-	beta-glucosidase	NA	NA	NA	NA
WP_009929418.1\|3533339_3533729_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004531966.1\|3533707_3534544_+	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	2.0e-07	43.1
WP_004522531.1\|3534602_3535130_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.0e-51	53.8

DBSCAN-SWA_248

3560049 : 3560619

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192666.1\|3560049_3560619_-	dCTP deaminase	S5VM63	Pseudomonas_phage	1.3e-71	70.6

DBSCAN-SWA_249

3563990 : 3566168

Indivirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538477.1\|3563990_3566168_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	1.2e-51	28.7

DBSCAN-SWA_250

3577916 : 3578540

Vibrio_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193001.1\|3577916_3578540_-	ParA family protein	A2I303	Vibrio_virus	4.7e-14	34.1

DBSCAN-SWA_251

3588320 : 3592285

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192006.1\|3588320_3589151_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-10	25.1
WP_004192857.1\|3589147_3590149_-	iron ABC transporter permease	NA	NA	NA	NA
WP_004538470.1\|3590227_3592285_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	5.3e-06	30.3

DBSCAN-SWA_252

3601325 : 3602837

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522572.1\|3601325_3602837_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	3.3e-53	41.0

DBSCAN-SWA_253

3606671 : 3607988

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522575.1\|3606671_3607988_-	sulfate adenylyltransferase	A0A1V0SA87	Catovirus	3.0e-18	25.5

DBSCAN-SWA_254

3613847 : 3618538

Stenotrophomonas_phage(50.0%)

integrase

attL 3606732:3606746|attR 3617084:3617098

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3606732:3606746	attL	NA	NA	NA	NA
WP_025987569.1\|3613847_3615062_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	3.1e-110	50.8
WP_028358603.1\|3615685_3618538_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	2.5e-70	35.4
3617084:3617098	attR	NA	NA	NA	NA

DBSCAN-SWA_255

3622082 : 3622274

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063840181.1\|3622082_3622274_-	AlpA family phage regulatory protein	A0A2L0V109	Agrobacterium_phage	1.7e-07	50.9

DBSCAN-SWA_256

3627747 : 3628323

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522586.1\|3627747_3628323_+	recombinase family protein	A0A219Y912	Aeromonas_phage	8.4e-26	43.2

DBSCAN-SWA_257

3639867 : 3643387

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526293.1\|3639867_3641052_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-24	27.3
WP_004543851.1\|3641068_3641527_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_004536444.1\|3641699_3642368_-	DUF2278 family protein	NA	NA	NA	NA
WP_004185649.1\|3642670_3643387_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-14	26.4

DBSCAN-SWA_258

3658641 : 3665654

Prochlorococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526287.1\|3658641_3659304_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.8e-25	40.0
WP_004535897.1\|3659428_3660421_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_004552976.1\|3660533_3663371_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	9.1e-81	26.0
WP_004186086.1\|3663370_3663871_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_004186216.1\|3663932_3665144_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.0e-41	31.9
WP_004186718.1\|3665207_3665654_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	7.9e-48	64.4

DBSCAN-SWA_259

3668936 : 3679900

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196461.1\|3668936_3671237_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1
WP_004194131.1\|3671233_3671548_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|3672080_3672284_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_004536101.1\|3672413_3674024_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_004189626.1\|3674036_3674219_+	hypothetical protein	NA	NA	NA	NA
WP_004189552.1\|3674191_3675451_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189780.1\|3675718_3676297_+	pseudouridine synthase	NA	NA	NA	NA
WP_071810810.1\|3676559_3676778_+	hypothetical protein	NA	NA	NA	NA
WP_004526282.1\|3676969_3677479_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	4.2e-13	42.2
WP_004197486.1\|3677785_3679900_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7

DBSCAN-SWA_260

3683307 : 3684153

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537955.1\|3683307_3684153_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.4e-23	29.9

DBSCAN-SWA_261

3698612 : 3700770

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185841.1\|3698612_3699191_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.1e-44	44.7
WP_004536170.1\|3699387_3700770_-	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	1.0e-29	27.2

DBSCAN-SWA_262

3704395 : 3705859

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538372.1\|3704395_3705859_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	6.8e-80	38.6

DBSCAN-SWA_263

3711152 : 3712082

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190177.1\|3711152_3712082_+	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	4.1e-22	26.7

DBSCAN-SWA_264

3715509 : 3728873

Catovirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190045.1\|3715509_3717075_+	AMP-binding protein	A0A1V0SBX8	Catovirus	5.1e-17	26.9
WP_004537942.1\|3717359_3718361_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.8e-24	28.9
WP_004522636.1\|3718360_3718828_-	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_004530849.1\|3718897_3720127_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_004189096.1\|3720144_3720699_+\|tRNA	bifunctional tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE/phosphotransferase	NA	NA	NA	NA
WP_004189918.1\|3720680_3722237_+	N-acetylmuramoyl-L-alanine amidase	Q5YA51	Bacillus_phage	2.0e-13	27.9
WP_004537941.1\|3722755_3723640_-	EamA family transporter	NA	NA	NA	NA
WP_004537940.1\|3723820_3724702_+	pirin family protein	NA	NA	NA	NA
WP_004522640.1\|3724755_3725604_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	1.1e-13	37.8
WP_004537939.1\|3725876_3726743_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.0e-15	33.1
WP_004522643.1\|3726876_3727521_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_004189668.1\|3727652_3728873_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	2.9e-44	32.3

DBSCAN-SWA_265

3752858 : 3754730

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199035.1\|3752858_3753971_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.8e-24	34.1
WP_004530859.1\|3754031_3754730_-	HAD-IA family hydrolase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.8e-06	42.9

DBSCAN-SWA_266

3763185 : 3766955

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189439.1\|3763185_3764046_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-13	26.2
WP_004200770.1\|3764038_3764830_+	metal ABC transporter permease	NA	NA	NA	NA
WP_004522664.1\|3764974_3765835_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_004537928.1\|3765848_3766955_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	3.6e-33	29.8

DBSCAN-SWA_267

3770290 : 3776995

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530867.1\|3770290_3771664_+	purine permease	Q9KX94	Enterobacteria_phage	3.3e-28	30.7
WP_004522668.1\|3772246_3773791_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004537926.1\|3773794_3776995_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.8e-51	23.5

DBSCAN-SWA_268

3781469 : 3784733

uncultured_Mediterranean_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526224.1\|3781469_3782957_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.0e-26	32.1
WP_041286149.1\|3783013_3783283_-	hypothetical protein	NA	NA	NA	NA
WP_004526222.1\|3783416_3784733_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.9e-20	29.6

DBSCAN-SWA_269

3789960 : 3796390

Pandoravirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537921.1\|3789960_3790986_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	1.5e-41	40.2
WP_004522681.1\|3790997_3792194_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_004188932.1\|3792273_3792792_-	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_004537919.1\|3792827_3793718_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	3.3e-53	37.8
WP_004190157.1\|3793907_3794972_-	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_038731572.1\|3795169_3796390_-\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	1.0e-238	99.5

DBSCAN-SWA_270

3813018 : 3813732

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526210.1\|3813018_3813732_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	6.9e-38	48.7

DBSCAN-SWA_271

3818039 : 3821637

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189458.1\|3818039_3819110_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.5e-116	65.8
WP_004526208.1\|3819313_3820057_+	response regulator transcription factor	NA	NA	NA	NA
WP_004537911.1\|3820080_3821637_+	GHKL domain-containing protein	A0A1V0SGX0	Hokovirus	5.3e-06	25.2

DBSCAN-SWA_272

3838033 : 3839842

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530884.1\|3838033_3839842_+	response regulator	A0A1V0SGX0	Hokovirus	1.4e-26	26.9

DBSCAN-SWA_273

3869369 : 3870686

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526164.1\|3869369_3870686_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-31	35.8

DBSCAN-SWA_274

3877025 : 3883575

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526156.1\|3877025_3878777_+	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.1e-44	50.9
WP_004526155.1\|3878944_3879526_-	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_004189020.1\|3880187_3881633_+	response regulator	NA	NA	NA	NA
WP_004537891.1\|3881682_3883575_+	signal transduction histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	9.9e-07	34.5

DBSCAN-SWA_275

3892095 : 3893553

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197309.1\|3892095_3893553_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.0e-52	33.2

DBSCAN-SWA_276

3897297 : 3898077

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189076.1\|3897297_3898077_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	8.7e-26	30.2

DBSCAN-SWA_277

3902453 : 3903170

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189870.1\|3902453_3903170_+	aquaporin family protein	M1HJ77	Paramecium_bursaria_Chlorella_virus	4.0e-25	33.6

DBSCAN-SWA_278

3907283 : 3908816

Mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534139.1\|3907283_3908816_+	asparagine synthetase B	A0A1X9VNR2	Mimivirus	3.3e-37	30.2

DBSCAN-SWA_279

3911906 : 3912629

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526141.1\|3911906_3912629_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.2e-40	44.2

DBSCAN-SWA_280

3917981 : 3919046

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522785.1\|3917981_3919046_+	PhoH family protein	H6X2N1	Pseudomonas_phage	4.2e-47	48.9

DBSCAN-SWA_281

3940398 : 3942270

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534228.1\|3940398_3942270_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	4.1e-45	28.3

DBSCAN-SWA_282

3954111 : 3959673

Tupanvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189849.1\|3954111_3955914_-\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	5.7e-20	31.3
WP_004189093.1\|3955970_3956621_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.4e-13	28.8
WP_004522802.1\|3956688_3957030_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_004522803.1\|3957130_3957910_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004189815.1\|3958095_3959673_-	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2P0VMP1	Tetraselmis_virus	3.6e-26	26.7

DBSCAN-SWA_283

3969246 : 3970071

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526121.1\|3969246_3970071_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	5.8e-36	34.8

DBSCAN-SWA_284

4001976 : 4003569

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537860.1\|4001976_4003569_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.6e-42	27.5

DBSCAN-SWA_285

4013181 : 4017258

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038716896.1\|4013181_4017258_-	TOMM system kinase/cyclase fusion protein	A0A2R8FF19	Brazilian_cedratvirus	5.6e-15	27.6

DBSCAN-SWA_286

4021106 : 4022327

Burkholderia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041286139.1\|4021106_4022327_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	1.7e-238	99.3

DBSCAN-SWA_287

4048982 : 4056406

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530930.1\|4048982_4049540_-	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	2.6e-48	87.7
WP_004195190.1\|4049653_4050841_-	MFS transporter	NA	NA	NA	NA
WP_004537849.1\|4051054_4053922_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.3e-305	55.0
WP_004526065.1\|4054140_4055226_+	membrane protein	NA	NA	NA	NA
WP_004522850.1\|4055524_4056406_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	4.3e-13	35.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009127_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009127_1

405824-405969

Orphan

Consensus_repeat	Method
GCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGCTCGATCGCCGAAG	PILER-CR
CGGAATGCCCGATCATCGGGATGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009127_1

>merge|NZ_CP009127|1|405824-405969|PILER-CR,CRISPRCasFinder
TCGTCGGGATGCTCGATTGCCGCAGTCACCCTCCGCCGGGGCTCCGTCGTCGGAATGCCCGATCATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGCTCGATCGCCG

>NZ_CP009127|1|1|405824-405969|PILER-CR
TCGTCGGGATGCTCGATTGCCGCAGTCACCCTCCGCCGGGGCTCCGTCGTCGGAA	TGCCCGAT
CATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAAT	ACCCGATCA
TCGGGATGCTCGATCGCCG

>NZ_CP009127|1|1|405874-405959|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGC	CTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGC
CGGAATACCCGATCATCGGGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009127.1\|WP_004538004.1\|413306_415169_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP009127.1\|WP_004532550.1\|402328_404602_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP009127.1\|WP_004188282.1\|392823_393867_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP009127.1\|WP_004532595.1\|409942_411754_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP009127.1\|WP_004529498.1\|417247_417682_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP009127.1\|WP_004200700.1\|397132_398248_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP009127.1\|WP_004530664.1\|415290_415620_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004200705.1\|416526_417180_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP009127.1\|WP_004536946.1\|400146_402045_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP009127.1\|WP_004532579.1\|395783_396386_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004530663.1\|415623_416073_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP009127.1\|WP_038716541.1\|398545_399481_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP009127.1\|WP_004523279.1\|412278_413310_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP009127.1\|WP_004188244.1\|418087_419218_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP009127.1\|WP_004523292.1\|393872_395105_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	unknown	unknown	gnl\|CDD\|223997
NZ_CP009127.1\|WP_004532563.1\|406545_407811_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP009127.1\|WP_004538003.1\|408026_409868_+\|ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|180772
NZ_CP009127.1\|WP_004538001.1\|399496_400087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004196898.1\|396357_396798_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP009127.1\|WP_004187469.1\|404734_405130_-\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|224648

Protein	Function_ID	Function_description	E-value
NZ_CP009127.1\|WP_004538004.1\|413306_415169_+\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.27089e-105
NZ_CP009127.1\|WP_004188282.1\|392823_393867_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
NZ_CP009127.1\|WP_004532550.1\|402328_404602_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	7.68683e-57
NZ_CP009127.1\|WP_004200705.1\|416526_417180_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	6.31252e-20
NZ_CP009127.1\|WP_004529498.1\|417247_417682_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	9.00264e-33
NZ_CP009127.1\|WP_004200700.1\|397132_398248_-\|hypothetical-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.16274e-11
NZ_CP009127.1\|WP_038716541.1\|398545_399481_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.81428e-62
NZ_CP009127.1\|WP_004532563.1\|406545_407811_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	1.43745e-113
NZ_CP009127.1\|WP_004530663.1\|415623_416073_-\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.14402e-50
NZ_CP009127.1\|WP_004536946.1\|400146_402045_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	4.48837e-35
NZ_CP009127.1\|WP_004523279.1\|412278_413310_+\|hypothetical-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	3.7258e-30
NZ_CP009127.1\|WP_004188244.1\|418087_419218_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	2.53339e-55
NZ_CP009127.1\|WP_004523292.1\|393872_395105_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	gnl\|CDD\|223997	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion].	5.32689e-143
NZ_CP009127.1\|WP_004187469.1\|404734_405130_-\|conjugal-transfer-protein-TraR	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14
NZ_CP009127.1\|WP_004538003.1\|408026_409868_+\|ribonucleotide-reductase	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0
NZ_CP009127.1\|WP_004196898.1\|396357_396798_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	3.1145e-25
NZ_CP009127.1\|WP_004532595.1\|409942_411754_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	3.75845e-75

>NZ_CP009127.1|WP_004187469.1|404734_405130_-|conjugal-transfer-protein-TraR
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP009127.1|WP_004532550.1|402328_404602_-|FAD-dependent-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKTKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
>NZ_CP009127.1|WP_004536946.1|400146_402045_+|GMC-family-oxidoreductase
MLGATRSTLWGSRERPRIAAARAPGAVASRMREEARECAGPRGAGRAPHRATAAGGKTGRRTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETPVAA
>NZ_CP009127.1|WP_004538001.1|399496_400087_+|hypothetical-protein
MCRARGIGRQARGNATAPSPIAAAAIGARPRSAPRGPRISDAGRLAAARSAFAMHQERRKRNADRHGTHPYDADSRAAPREAPRFEHEPKKQRDAAQHEVDRDRAAREIHERIEHKARPDVRRAERPISQDVAQTPIGAAGAISPSTAHSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP009127.1|WP_038716541.1|398545_399481_+|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVGLTHRAIIGCDEHAPA
>NZ_CP009127.1|WP_004200700.1|397132_398248_-|hypothetical-protein
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRVERESAYSLTLLKRRLEAARDA
>NZ_CP009127.1|WP_004196898.1|396357_396798_+|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPAKIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP009127.1|WP_004532579.1|395783_396386_+|hypothetical-protein
MNSILAPDNAPPAPANRTSPLMSALARAVVTAPLPGSDRAAEASTRVSTMRAQSASAIRVRSCRRSRSSRHGLPESPACRRKSPARPRSRRAPRPLADHTRMRFSPPRLGVRTARPPPAGRSKPARGASAIRLRVQRRSSRLTMTLINVIVIARAPQTAIVAHRGIGPRAIGRLTARRRAARPSTLETRPSYETATHRNR
>NZ_CP009127.1|WP_004523292.1|393872_395105_-|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha
MSQYGPLRLHVPEPTGRPGCKTDFSYLRLSPAGKVRKPPIDVAPADTSDLAYGLVRVLDEHGRAVGPWAPDLDPDILRKGIRAMLKTRIFDARMQIAQRQKKISFYMQCLGEEAIAVAHTLALERGDMCFPTYRQQGILMVREYPLVDMMCQLMSNERDPLKGRQLPVMYSTRDAGFFSISGNLATQFIQAVGWAMASAIKGDTRIASAWIGDGATAEADFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGATFAGRGVGCGIASLRVDGNDFLAVYAASRWAAERARRNLGPTLIEWVTYRAGPHSTSDDPTKYRPGDDWTNFPLGDPLERLKRHMIGIGVWSEQDHEDTKAALEAEVLAAQKEAERYGTLADEHVPNVASIFEDVYKEMPAHLRRQRQQLGV
>NZ_CP009127.1|WP_004188282.1|392823_393867_-|alpha-ketoacid-dehydrogenase-subunit-beta
MTTASKEGPAASPMTMIQALRSAMDVMLERDGNVVVFGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPINEGGIVGAAVGMGAYGLRPVCEIQFADYFYPASDQIVSEAARLRYRSAAEFIAPLTIRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLISAIENDDPVIFLEPKRLYNGPFDGHHERPVTPWSKHPASLVPDGYYTVPLDSAAIVRAGGDVTVLTYGTTVHVSLAAAEETGIDAEVIDLRSLWPLDLDTIVESVRRTGRCVVVHEATRTCGFGAELIALVQEHCFHWLEAPVERVTGWDTPYPHAQEWAYFPGPNRVGDALRRAMEN
>NZ_CP009127.1|WP_004532563.1|406545_407811_+|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGARPAGWPTWGPMARAADAVPAPPPFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPLEAGAFGLDDYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRRAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPQRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGPRWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP009127.1|WP_004538003.1|408026_409868_+|ribonucleotide-reductase
MRTINKRTRTIAHADSFVRMIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDEARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHTAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPGLVFVDAIDAADPLRGRERIGATSPCGAQPLPPYGSAMLGAIDLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRTGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP009127.1|WP_004532595.1|409942_411754_+|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRPPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAVRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACEAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLERALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDHSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP009127.1|WP_004523279.1|412278_413310_+|hypothetical-protein
METSPLKTTTPEAIPPFDPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGFAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAELIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDFATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP009127.1|WP_004538004.1|413306_415169_+|STAS-domain-containing-protein
MTERERAARGRNDARRGGGDSGGDDEAWRRWLPGIATLRAYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLGTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVAYAHVAYAHVANAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLVAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVQGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEADAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARR
>NZ_CP009127.1|WP_004530664.1|415290_415620_-|hypothetical-protein
MLSSRLVSSRLAPCCVYIDIQGEGDVDVDAEGNGNGNIDVIDSKRCEPSGVEPVERAVRRPRYRAQSGCLSGIHRNGIVMPDPMPPTNRFDRLRASAVIVDRMKPRRSP
>NZ_CP009127.1|WP_004530663.1|415623_416073_-|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKDVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP009127.1|WP_004200705.1|416526_417180_+|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDIYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLAEALSLNEDELPILAQTVGKPAAHP
>NZ_CP009127.1|WP_004529498.1|417247_417682_-|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP009127.1|WP_004188244.1|418087_419218_-|porin
MMNAKSIAAAALAVAQAGLAHAQSSVTLYGALDAGVLWQNTSAASFSPTAPNTGAVVRFKDGGVYSSLWGIKGTEDLGGGYRVNFRLQGAFDGGTGKFGLSDAPGAVAAFNQIATLGVSGPFGTFNAGRQIVPMIYAMADTDVRAARFFGSVLTAWLGLNTAAGWPGNSTNAPIGALYDSDALVYQSPAFGGASLALEYAPGGVPGGVQRGARASIVLKYASNALNLAAVYYNGHDTNPAPGASATGLDNNRFVYVGAQYKLKDVAVSASYGNGRNPARGDRVNLDMFAFGLGYRVSPFFRVSSGVYYLKDRNRSANRSTSIVLGADYELSKHTTLYAQGGRVDNRGTMAQMLAYGQPVAPGLATTAAMLGMRHSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009127_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009127_2

1947853-1948017

Orphan

Consensus_repeat	Method
GCGAGCGCGGCGAGCGCGGCCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP009127_2

>merge|NZ_CP009127|2|1947853-1948017|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGACAGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCGGCGAGCGCGGCCGCGCGATGGGCGCCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCGGCGAGCACGGCCGCG

>NZ_CP009127|2|2|1947853-1948017|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGAC	AGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCG
GCGAGCGCGGCCGCGCGATGGGCG	CCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCG
GCGAGCACGGCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009127.1\|WP_004202588.1\|1955164_1956634_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP009127.1\|WP_004197868.1\|1959762_1960452_-\|heavy-metal-response-regulator-transcription-factor-IrlR	unknown	unknown	gnl\|CDD\|130454
NZ_CP009127.1\|WP_004528277.1\|1941245_1941605_+\|lipoprotein	unknown	unknown	gnl\|CDD\|226765
NZ_CP009127.1\|WP_004537036.1\|1943739_1946385_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP009127.1\|WP_004539128.1\|1957093_1957342_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004524116.1\|1942102_1942612_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP009127.1\|WP_162187260.1\|1953065_1953584_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004524118.1\|1946596_1947577_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119321
NZ_CP009127.1\|WP_004199294.1\|1938813_1939335_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123
NZ_CP009127.1\|WP_004546480.1\|1941850_1942081_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004184766.1\|1958371_1959766_-\|heavy-metal-sensor-histidine-kinase-IrlS	unknown	unknown	gnl\|CDD\|273593
NZ_CP009127.1\|WP_004539125.1\|1950495_1951506_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528
NZ_CP009127.1\|WP_004524130.1\|1957995_1958268_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP009127.1\|WP_038802364.1\|1948651_1950499_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP009127.1\|WP_004524117.1\|1942608_1943613_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP009127.1\|WP_004539126.1\|1953685_1954945_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173852
NZ_CP009127.1\|WP_004206353.1\|1952223_1952916_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP009127.1\|WP_004528273.1\|1936947_1937961_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP009127.1\|WP_004528275.1\|1939331_1940156_+\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP009127.1\|WP_004528276.1\|1940219_1941206_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274

Protein	Function_ID	Function_description	E-value
NZ_CP009127.1\|WP_004202588.1\|1955164_1956634_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.5363e-36
NZ_CP009127.1\|WP_004197868.1\|1959762_1960452_-\|heavy-metal-response-regulator-transcription-factor-IrlR	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	2.40938e-111
NZ_CP009127.1\|WP_004528277.1\|1941245_1941605_+\|lipoprotein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	2.7211e-31
NZ_CP009127.1\|WP_004537036.1\|1943739_1946385_+\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	6.96412e-87
NZ_CP009127.1\|WP_004539125.1\|1950495_1951506_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	1.50787e-120
NZ_CP009127.1\|WP_004524118.1\|1946596_1947577_-\|ABC-transporter-permease	gnl\|CDD\|119321	cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to generate the transmembrane pore.	3.78293e-52
NZ_CP009127.1\|WP_004199294.1\|1938813_1939335_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	2.21088e-40
NZ_CP009127.1\|WP_004184766.1\|1958371_1959766_-\|heavy-metal-sensor-histidine-kinase-IrlS	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_CP009127.1\|WP_004524116.1\|1942102_1942612_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	7.12237e-71
NZ_CP009127.1\|WP_004524130.1\|1957995_1958268_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	9.38719e-09
NZ_CP009127.1\|WP_038802364.1\|1948651_1950499_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.92635e-174
NZ_CP009127.1\|WP_004524117.1\|1942608_1943613_+\|FecR-family-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	2.1512e-74
NZ_CP009127.1\|WP_004539126.1\|1953685_1954945_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173852	cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C. DszC is a flavin reductase dependent enzyme, which catalyzes the first two steps of DBT desulfurization in mesophilic bacteria. DszC converts DBT to DBT-sulfoxide, which is then converted to DBT-sulfone. Bacteria with this enzyme are candidates for the removal of organic sulfur compounds from fossil fuels, which pollute the environment. An equivalent enzyme tdsC, is found in thermophilic bacteria. This alignment also contains a closely related uncharacterized subgroup.	7.67689e-138
NZ_CP009127.1\|WP_004206353.1\|1952223_1952916_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	8.15398e-14
NZ_CP009127.1\|WP_004528273.1\|1936947_1937961_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	5.29361e-24
NZ_CP009127.1\|WP_004528275.1\|1939331_1940156_+\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	1.07062e-18
NZ_CP009127.1\|WP_004528276.1\|1940219_1941206_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	9.82698e-29

>NZ_CP009127.1|WP_004524118.1|1946596_1947577_-|ABC-transporter-permease
MRDATDRLSRFAALGALAAVLAFFAVAAPGFATLANVERVLVNNFALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALGAANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWLGVAAPLWIVAALAGALHVALERSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASALVYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFVANGLLLIGWNFYWQQVASGALVFAVLALGSGVGRERRARDAGQSG
>NZ_CP009127.1|WP_004537036.1|1943739_1946385_+|TonB-dependent-receptor
MDSICNRRPRRAHAGVCADTANAPAGLPEAAQPAARLGAGRPRDAAAPRCARQATSHTSHASHTLHAPCMPQFAPRRVVARVAAAALFSACAAPGVSGAAEPAAATRGYDIPAGPLDAALTRFGREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGTGLVALRQPSGGYTLARLPGPAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGLRSDAPLAEVPQAVAIVAQQVLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGDNRDGSVMRNGMPIVQGRSLNATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLARRHAISALGSTYGGGRNGGELTFDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPSLAWYGRDTQMVLSYEYRRFLMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLAQLAIDHQLAPDWKVHVGYSYNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYGIAYVDGRVTLAGMRHDVQFGVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVSASDSDQSDTLHTASLFFQDSIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKWLPRAGIVYKWNDALSLYGSYTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDMPGGLAGTLAFFDIDKKHVLVSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIASYAYIDAKTTEDPLYAGNRLWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPGDSANSFTLPAYATADAFATYDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDARQVSLLTTLQF
>NZ_CP009127.1|WP_004524117.1|1942608_1943613_+|FecR-family-protein
MSGAKPAGGPPAVPERVARRAVQWWVELGAAPASDATRARLARWRAEHPAHDAAWRHIEAVNGRLGHVASALSARAARAALLPPRSRGRRAALKALAVLLFAGGGAWTGQAYLPWRAWGADVRTALGERRTITLADGTTVVLNTDTAIDIRFDDATRGVRLLRGEIMVTSGRDAARAVPRALVIATAHGDVRPVGTRFSVRERGDATRVDVFDGAVRIAPRRAVGRAPLITAGHGADFTRDALAGPPRVLGASAGAWVDGILVASNLRLADLLAEIDRYRPGRVRCDAAVANLRVSGTYPLDDTDRILDTLRETLPVDVEYLSRYWVTVVAARD
>NZ_CP009127.1|WP_004524116.1|1942102_1942612_+|sigma-70-family-RNA-polymerase-sigma-factor
MPANTLRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTFIRLLARDEPIDAAEPRAFLTTVAQRVLYNHWRRERLERAYLDALAQWPEAVAPSPETRAVLFETLVEVDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQCYFAIAA
>NZ_CP009127.1|WP_004546480.1|1941850_1942081_+|hypothetical-protein
MHAADAAAVATFRLSAGSASRVPRVPAVPARRFGEAAGPRAPPKRRGAPRTVRTHSPSGYKYVYNNHSHLQNSIPA
>NZ_CP009127.1|WP_004528277.1|1941245_1941605_+|lipoprotein
MIRNVLIALVCAAPVAALAEPPKAAGGMIVDDDGMTLYTFDRDTMPGKSACTGGCTANWPAALADAYDKPGGDLGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQHTGDGFGGMWHVARP
>NZ_CP009127.1|WP_004528276.1|1940219_1941206_+|YceI-family-protein
MDAAGSFASFAATLACALSAWLAPSAGIAQTAWPPDAPRVAGASGPPRTPGLARTPAAVTDAPGAATAGALAASPPAATRYRLDPRHSGVTFRVDNFWHAHLTMRFARMRAELSHVGDDRLASRVDVTVDAASLGANVPFVAALVKGSAMLDVARYPEIRFVGTRFERTGATTGVLTGELTIRAMTRPITLAVRFDAGRQLEPDTGARAEREGDESGESGESNPAERRAGQGRRAAELRDGRPRDAGPGVADSRDAMRRETDSGSAHRGAEPPERIARAAPDAARPLAFVADGHFSRTAFGLSRWLPAVGDDVRLRIRAEFVRARADP
>NZ_CP009127.1|WP_004528275.1|1939331_1940156_+|anti-sigma-factor
MSDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDPRAAGIAAHYRAQRAALRALFADPVAPRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGWLGGALAPRFAPSAALQWVAPAAAQRAFARDADLAYALYAPDARHPVEIAAGRDGAPLAWLSARVGRRIAAPSLREYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREAAVRPWRDGGRHTFYWVSERTAYALSGQLDEGRLRTIAADVCGELGGHPQRWR
>NZ_CP009127.1|WP_004199294.1|1938813_1939335_+|sigma-70-family-RNA-polymerase-sigma-factor
MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRAFRPDSNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRMLYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPPLSLTAARHHR
>NZ_CP009127.1|WP_004528273.1|1936947_1937961_-|AraC-family-transcriptional-regulator
MPERSDRLDFYIRDEAARRAITEPHRHAYFQIQFNLGGDTEQRIGGFTRAFPRGALAFVLPYREHLIAHPPGAHFVVINFSQTFLRADLDVDPLDLEDVCAQRAPELAPFRFQEHLDFILTGAAFDDARRLAQRMLEANRARTFGSVPLLRGYLLQLIGLVCTQYAGPLTKLAQSGAHRTGRRDAFARVLRHVRANLTNDALTLAGTARAACLSPNYLAHLIRKETGSTFTDLVTARRIALAQSLLAHTTRRIADIAHAVGFRDEGYFSRRFRACVGVSPKEYRDANGAPGPADALDSADALDSVDTAGPRAAPGGGETRGAAGAKSPARAAAKPRA
>NZ_CP009127.1|WP_038802364.1|1948651_1950499_-|sugar-ABC-transporter-ATP-binding-protein
MKAALTTAAASAAAAPDAAGAPLALDVRRVVKRFGGVAALRGASLAVTRGTVHGLIGQNGAGKSTLVKLLAGLHAPDEGEITVGGVPFASGGGGSRASAGAARRHSTGIGFIHQERLLPATFTVAEALFFPHPPTLGGRASRLARLLPLDVRRMRRDCRAVLHTQFGLDLAPDRLIGELSVAEQQIVQITRALLGRHEILVFDEPSAALVSSEVDRLLRTIERLRANGHTILYVSHYLDEIARVCDRVSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPAAAPSAAAARAAARAAARADARADARVSARADAWGDDPHRAPAGADPARRGARAAPGAIALEARDLALPGRFGPLSLAVRRGEIVGLTGGLGSGGKDVIRALFGLARGVRGSIAVDGRPARVRRPHDAVAHGIALVPENRAAHGVALTLPVRENVVLADLSSVSRFGLVHGRREADVARALIRRLDIRPARPDLPARFLSGGNQQKVALAKWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDALARAGAAVLLFSSDLTELLDVTDRVYVMARGEIVAQCASAETTTRDVLAWATLARDARPGGGAGAHDAAARTGTPGAAGAAGAASSAAKVAT
>NZ_CP009127.1|WP_004539125.1|1950495_1951506_-|sugar-ABC-transporter-substrate-binding-protein
MLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITAAGTDHYWDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIVQIQTLIAQQPDAIIEQLGTASVLEPWLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLVFNGFYGVPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKGAISAIWAAWDIPQVGATQAVDAAGRREIRTYAVDGSPEAVALVRNPTSSAAAVVAQQPALIGRTAVRNVARYLAGDRSLPAYTFVPSVLVTKDDAGVARPALGQTPAAAGLARR
>NZ_CP009127.1|WP_004206353.1|1952223_1952916_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MATTRRHATATALAAAARPCAAPHADSFLGILIEVFARVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPLALFFSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRGIVSRGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSEDAAYRAYRRSVRYRVIPGLF
>NZ_CP009127.1|WP_162187260.1|1953065_1953584_+|hypothetical-protein
MRRGDSRRPHAGNARVAAAGDGVVFELASHGLHTGFTRASHGLGAARCGGPAPPGPRGRGDIAAEDPVNQRGEGDCRPASSWRPARAPADPGRSGSTITVSLAASGKQSVEYGNNQNPSLNGRVISPSTNGAFASGSPSKTTRGSTWDRVLNIHHTLTFSGAGGLNVAGPQT
>NZ_CP009127.1|WP_004539126.1|1953685_1954945_-|acyl-CoA-dehydrogenase
MSHAPADPTRSTGADYASLAARFRPIFARIAEGAIERDRTRALPHEPIRWLKEAGFGALRVPVHAGGAGASVPQLVQLLIELAAADSNLPQALRGHFAFVEDWLNAPPDAARRAWFDRFASGQLVGNAWTEVGDVALGEVRTKVAKRDGGWVVNGEKYYSTGAIFADWIDVYAQRTDDGGPVIAAVAARQDGVILGDDWDGFGQATTGSGTTRFVDARVDEANVIDFARRFKYQTAFYQLFHLATLAGIGRAVERDASALVRGRRRVYSHGNAPRVSDDAQILQVVGEISAWAYAAEAIALRAAQPSQRAYEARGGGDAAAEHDANVAAEIESAQGQLVVSELVLRAATHLFDALGASATRATNALDRHWRNARTVASHNPLVYKARIVGDRAVNGTEPPYVWQIGAGPGGPREPEQAA
>NZ_CP009127.1|WP_004202588.1|1955164_1956634_-|MFS-transporter
MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGVFLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVFMADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKASRLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAVPALAIIAVRGRYMNESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLVASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYRLPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYPALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAAIRFEPTARDVDVDIDAGSRAQGDRARVRAAA
>NZ_CP009127.1|WP_004539128.1|1957093_1957342_-|hypothetical-protein
MKAPIIAIAFGIALAACAPLRQDSRSGEAGPPIAAPNRGGGNTPPSGARRAANEVVDYAGRPCVNQTLYVKTHPCIFPRLQR
>NZ_CP009127.1|WP_004524130.1|1957995_1958268_+|DUF4148-domain-containing-protein
MNTKTTIVWATAAALTALALSPAAFAQGKTRDEVRQELIRAQHEGVVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTVAR
>NZ_CP009127.1|WP_004184766.1|1958371_1959766_-|heavy-metal-sensor-histidine-kinase-IrlS
MIRRLLPRTLRARLTALIILSTAATLALSGVALYSALHNRLVGMSSYEMSATLAAMRTHLANVANVDDIPRKSDLWIDQLHGHQNLDLAIYDTDGRLRFATRGFVAPRPALGAPQTRVPASAAPAGATFSYLADDAPLRGGNPRTARIVVQYDGKNDHALLRAYAYTVVVIEVLAVVLTAALAYGIAMLGLSPLRRLVARAEQMSSSRLAQPLPELDTSGELKEMEHAFNAMLKRLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQVALSKPRTADEYRDVIESSIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLDAAAQAERVAGYYEPMAEDAEVSIVVRGKAEVRADALLYHRALSNLISNALNHAPRGSTITIECAQAADAATISVSDTGRGIEAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTCGVDSEPHVRTTFWLKFPAHAA
>NZ_CP009127.1|WP_004197868.1|1959762_1960452_-|heavy-metal-response-regulator-transcription-factor-IrlR
MRILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEYDLIILDVMLPGHDGWTVLERLRRAHSTPVLFLTARDDVGDRVKGLELGADDYVVKPFDFVELVARVRSILRRGQARESTVLRIADLELDLTRRKATRQGDVVLLTAKEFALLWLLMRREGEILPRATIASQVWDMNFNSDTNVVDAAIRRLRSKIDDAYEPKLIHTVRGMGYVLEVRSASAPSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009127_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009127_3

3211117-3211209

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009127_3

>merge|NZ_CP009127|3|3211117-3211209|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP009127|3|2|3211117-3211209|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009127.1\|WP_004529182.1\|3212671_3213163_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP009127.1\|WP_004524995.1\|3195534_3196608_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP009127.1\|WP_004524985.1\|3212370_3212679_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP009127.1\|WP_004187346.1\|3211672_3212374_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP009127.1\|WP_004533188.1\|3201129_3202965_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP009127.1\|WP_004198321.1\|3206585_3207611_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP009127.1\|WP_004529181.1\|3208686_3210681_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP009127.1\|WP_004539325.1\|3205438_3205948_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_044363669.1\|3206005_3206509_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009127.1\|WP_004530245.1\|3199855_3200980_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP009127.1\|WP_004533337.1\|3207841_3208690_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP009127.1\|WP_004524990.1\|3203332_3204898_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP009127.1\|WP_004187193.1\|3211427_3211676_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067
NZ_CP009127.1\|WP_004188221.1\|3213159_3213615_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057
NZ_CP009127.1\|WP_004539328.1\|3196604_3199853_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054

Protein	Function_ID	Function_description	E-value
NZ_CP009127.1\|WP_004529182.1\|3212671_3213163_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	6.86601e-17
NZ_CP009127.1\|WP_004524995.1\|3195534_3196608_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	1.83012e-39
NZ_CP009127.1\|WP_004524985.1\|3212370_3212679_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	4.12229e-10
NZ_CP009127.1\|WP_004187346.1\|3211672_3212374_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP009127.1\|WP_004533188.1\|3201129_3202965_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	3.7779e-132
NZ_CP009127.1\|WP_004198321.1\|3206585_3207611_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP009127.1\|WP_004529181.1\|3208686_3210681_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP009127.1\|WP_004530245.1\|3199855_3200980_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	4.38049e-26
NZ_CP009127.1\|WP_004533337.1\|3207841_3208690_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	4.46992e-34
NZ_CP009127.1\|WP_004524990.1\|3203332_3204898_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79
NZ_CP009127.1\|WP_004187193.1\|3211427_3211676_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37
NZ_CP009127.1\|WP_004188221.1\|3213159_3213615_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63
NZ_CP009127.1\|WP_004539328.1\|3196604_3199853_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.40767e-92

>NZ_CP009127.1|WP_004529181.1|3208686_3210681_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSREVSPEASREVSREVSCEVSHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPRPDARGDAARTAPSPQGGADANVDAEAEARHKR
>NZ_CP009127.1|WP_004533337.1|3207841_3208690_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGDTAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAARLEVTERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP009127.1|WP_004198321.1|3206585_3207611_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP009127.1|WP_044363669.1|3206005_3206509_-|hypothetical-protein
MRGAGRASPSRARRYENVSKEPNTHREARAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDMHPGDVTPVHVSRPVQFAVPAHEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPPPVGDDMQDLIH
>NZ_CP009127.1|WP_004539325.1|3205438_3205948_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNSELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP009127.1|WP_004524990.1|3203332_3204898_-|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP009127.1|WP_004533188.1|3201129_3202965_+|response-regulator
MHVEVFAQHSSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLDAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRAKTAAARVQR
>NZ_CP009127.1|WP_004530245.1|3199855_3200980_+|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFVLDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP009127.1|WP_004539328.1|3196604_3199853_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQGGAGGRPGAGERAAGESLAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSDVGSDVGSDVASEAGPEAGLAASAESGAERAREPAADITADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPPSHAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAASVPVILGATILLLKKQER
>NZ_CP009127.1|WP_004524995.1|3195534_3196608_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MIQVTRKQIVAAAAVVVVALGAYYGWTLLRHQGPGDGFASGNGRIEATEIDVATKLPGRIDAILVDEGDFVKAGQPLANMQIQVLRAQYDEATAQRQRALNTAAGVQSQVAQRKSDKAAAQAMVVLRESELDAAERRLARSQTLSREGASSLQELDDDRARARSAQAAVSAAAAQVAAAQAAIEATEAQLVAAHSAVTAADATVARVQADIDDSQLASPRDGRVQYRVAQPGEVLPAGGKVLNLVDLSDVYMTFFLPETVVGRVALGADARIILDAAPNYVIPATVSFVSSTAQFTPKTVETANERQKLMFRVKARIDRELLQKHLKLVKTGLPGVAWVRVDPSKPWPAQLMVKVPQ
>NZ_CP009127.1|WP_004187193.1|3211427_3211676_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP009127.1|WP_004187346.1|3211672_3212374_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP009127.1|WP_004524985.1|3212370_3212679_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFVAGACHFVSLGWNSRLFVAGRAGVALALQLARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP009127.1|WP_004529182.1|3212671_3213163_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREARDDAARGDARHAGAGAAPDDPRGAARRDPPPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP009127.1|WP_004188221.1|3213159_3213615_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

129177 : 190329

Streptococcus_phage(25.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004539275.1\|129177_129906_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-21	31.2
WP_004552566.1\|130086_130740_-	glutathione S-transferase	NA	NA	NA	NA
WP_004539274.1\|130765_132199_-	amidohydrolase family protein	NA	NA	NA	NA
WP_004539273.1\|132418_133147_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-22	31.2
WP_076823033.1\|133200_133503_-	hypothetical protein	NA	NA	NA	NA
WP_038717128.1\|133572_135333_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_004544755.1\|135758_136058_-	hypothetical protein	NA	NA	NA	NA
WP_004539270.1\|136069_145321_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_071811406.1\|145472_145670_-	hypothetical protein	NA	NA	NA	NA
WP_004533385.1\|145670_145934_-	putative Immunity protein 75	NA	NA	NA	NA
WP_004539269.1\|146525_151184_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	8.3e-23	34.9
WP_004524859.1\|151170_152439_-	hypothetical protein	NA	NA	NA	NA
WP_004539268.1\|158116_158584_+	decarboxylase	NA	NA	NA	NA
WP_004539267.1\|158739_159765_+	hypothetical protein	NA	NA	NA	NA
WP_004539266.1\|160328_160928_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_004524853.1\|160952_161363_-	RidA family protein	NA	NA	NA	NA
WP_004539265.1\|162792_163140_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.3e-39	71.0
WP_004539264.1\|163136_163544_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	2.4e-11	36.5
WP_004539263.1\|163976_166010_-	hypothetical protein	NA	NA	NA	NA
WP_038717645.1\|166250_168422_-	alpha-galactosidase	NA	NA	NA	NA
WP_004524829.1\|168426_169278_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004524828.1\|169278_170202_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_004524827.1\|170264_171506_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004524825.1\|171541_172786_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_038717659.1\|172828_173467_-	hypothetical protein	NA	NA	NA	NA
WP_143284288.1\|174301_174889_-	hypothetical protein	NA	NA	NA	NA
WP_004536893.1\|175239_176394_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_004524822.1\|178155_178896_+	hypothetical protein	NA	NA	NA	NA
WP_004539259.1\|180844_181555_-	hypothetical protein	NA	NA	NA	NA
WP_004203275.1\|181570_183775_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-46	29.9
WP_004539258.1\|183771_186438_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.4e-78	30.7
WP_122633429.1\|186450_187896_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004529322.1\|187892_189764_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004196148.1\|189768_190329_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_2

1076986 : 1086293

Burkholderia_virus(57.14%)

integrase,transposase

attL 1071916:1071932|attR 1098101:1098117

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1071916:1071932	attL	NA	NA	NA	NA
WP_004188376.1\|1076986_1078969_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.8e-83	44.8
WP_004545569.1\|1079066_1079447_+	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_004529901.1\|1079440_1081456_+	cation acetate symporter	NA	NA	NA	NA
WP_004538073.1\|1081751_1082951_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A4JX31	Burkholderia_virus	3.3e-226	99.7
WP_009971437.1\|1082947_1083085_-	hypothetical protein	Q8W6Q6	Burkholderia_virus	2.9e-17	97.8
WP_004542548.1\|1083352_1083934_+	hypothetical protein	A9YX38	Burkholderia_phage	2.2e-21	100.0
WP_004552392.1\|1084164_1084383_-	hypothetical protein	Q6JIH9	Burkholderia_virus	9.8e-36	98.6
WP_004538072.1\|1084430_1084652_-	hypothetical protein	NA	NA	NA	NA
WP_004537565.1\|1084928_1085204_-	bacteriophage protein Gp49	Q6JIH4	Burkholderia_virus	5.2e-42	95.6
WP_009971435.1\|1085755_1086025_+	BrnT family toxin	NA	NA	NA	NA
WP_004525420.1\|1086008_1086293_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	1.4e-10	50.0
1098101:1098117	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1238945 : 1310461

Vibrio_phage(25.0%)

plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525541.1\|1238945_1239713_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_004206084.1\|1239751_1240753_-	HpnL family protein	NA	NA	NA	NA
WP_004538026.1\|1240749_1241523_-	hypothetical protein	NA	NA	NA	NA
WP_004188272.1\|1241519_1242209_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_004188420.1\|1242573_1244088_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_004530037.1\|1245797_1246736_+	hypothetical protein	NA	NA	NA	NA
WP_004202234.1\|1246769_1247318_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190846.1\|1247320_1248826_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530039.1\|1248969_1249497_+	hypothetical protein	NA	NA	NA	NA
WP_004190879.1\|1249576_1250008_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_004196180.1\|1250021_1251884_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190851.1\|1251880_1252870_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004525547.1\|1252872_1255743_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	2.4e-60	27.2
WP_004535223.1\|1258191_1260480_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_009933072.1\|1260483_1262700_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_004525550.1\|1262699_1263770_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004525551.1\|1263772_1264489_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004190606.1\|1264531_1264921_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004530042.1\|1264926_1265520_+	type VI secretion lipoprotein TssJ	NA	NA	NA	NA
WP_004525552.1\|1265516_1266878_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004525553.1\|1266960_1268619_+	OmpA family protein	NA	NA	NA	NA
WP_004525554.1\|1268615_1272119_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190863.1\|1272177_1272537_+	hypothetical protein	NA	NA	NA	NA
WP_004190471.1\|1272559_1272985_+	hypothetical protein	NA	NA	NA	NA
WP_004536812.1\|1273305_1273581_+	hypothetical protein	NA	NA	NA	NA
WP_004524288.1\|1274131_1275031_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_004542286.1\|1275072_1275363_-	hypothetical protein	NA	NA	NA	NA
WP_004524287.1\|1275252_1276572_+	glycosyltransferase	NA	NA	NA	NA
WP_004524286.1\|1276568_1278155_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_162474202.1\|1278245_1278389_+	hypothetical protein	NA	NA	NA	NA
WP_004535065.1\|1278455_1279451_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_004532079.1\|1279576_1279759_+	hypothetical protein	NA	NA	NA	NA
WP_004532078.1\|1279755_1281339_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004186853.1\|1281819_1283073_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024431747.1\|1283595_1285260_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	2.0e-56	31.4
WP_004530051.1\|1285392_1286958_-	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_004538946.1\|1287146_1288163_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004523135.1\|1288609_1289809_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_004198247.1\|1289986_1291012_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_160457400.1\|1291025_1291310_+	hypothetical protein	NA	NA	NA	NA
WP_004186965.1\|1291445_1292720_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	6.9e-105	54.1
WP_004535113.1\|1292792_1293764_+	membrane dipeptidase	NA	NA	NA	NA
WP_004186987.1\|1293914_1294448_+	4-vinyl reductase	NA	NA	NA	NA
WP_004538948.1\|1294508_1296572_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_004538949.1\|1296574_1298500_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_004202150.1\|1298504_1299677_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004530055.1\|1299673_1300459_+	drug:proton antiporter	NA	NA	NA	NA
WP_004535147.1\|1300510_1301752_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_038717590.1\|1301772_1302918_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004523141.1\|1303027_1303891_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004530057.1\|1304071_1305727_+	APC family permease	NA	NA	NA	NA
WP_004538951.1\|1305813_1306689_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_038717592.1\|1306832_1307711_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004186939.1\|1307873_1309427_+\|holin	choline-sulfatase	NA	NA	NA	NA
WP_004530058.1\|1309423_1310461_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_4

2102070 : 2167095

Leptospira_phage(100.0%)

integrase,transposase

attL 2095435:2095451|attR 2157724:2157740

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2095435:2095451	attL	NA	NA	NA	NA
WP_004528426.1\|2102070_2103444_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_004528430.1\|2105559_2105910_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.3e-15	38.5
WP_076841855.1\|2105885_2106428_-\|transposase	transposase	NA	NA	NA	NA
WP_009971876.1\|2106403_2106664_+\|transposase	transposase	NA	NA	NA	NA
WP_004539182.1\|2106911_2114165_-	toxin	NA	NA	NA	NA
WP_004539183.1\|2114394_2117253_-	RHS repeat protein	NA	NA	NA	NA
WP_045596434.1\|2117308_2121766_-	virulence protein	NA	NA	NA	NA
WP_004539185.1\|2121853_2124823_-	RHS repeat protein	NA	NA	NA	NA
WP_038717046.1\|2124846_2132403_-	hypothetical protein	NA	NA	NA	NA
WP_009972582.1\|2134288_2134744_+	transcriptional regulator	NA	NA	NA	NA
WP_004539188.1\|2134903_2135107_-\|transposase	transposase	NA	NA	NA	NA
WP_122887193.1\|2135211_2136331_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-48	39.1
WP_079999965.1\|2137286_2138240_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004539190.1\|2138603_2138777_-	hypothetical protein	NA	NA	NA	NA
WP_004539191.1\|2138840_2139035_-	hypothetical protein	NA	NA	NA	NA
WP_143289068.1\|2139851_2140109_+	hypothetical protein	NA	NA	NA	NA
WP_076849360.1\|2140277_2140919_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_076849362.1\|2141074_2141161_+	hypothetical protein	NA	NA	NA	NA
WP_004528452.1\|2142128_2142557_-	hypothetical protein	NA	NA	NA	NA
WP_004528453.1\|2142700_2143336_-	hypothetical protein	NA	NA	NA	NA
WP_076849357.1\|2143735_2143990_-	Com family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004539195.1\|2146364_2150951_+	insecticidal toxin complex	NA	NA	NA	NA
WP_004532472.1\|2151186_2158599_+	hypothetical protein	NA	NA	NA	NA
2157724:2157740	attR	NA	NA	NA	NA
WP_024431076.1\|2158639_2166016_+	toxin	NA	NA	NA	NA
WP_004539515.1\|2166012_2167095_-\|transposase	IS630 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009128

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection