CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP003811	Methylobacterium oryzae CBMB20 chromosome, complete genome	2 crisprs	cas3,WYL,DEDDh,RT,csa3	2	0	4	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP003811_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP003811_1

4143437-4143685

Orphan

Consensus_repeat	Method
TCGAGGGTGCCGTCGTTGTCCGGATCGGCC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP003811_1

>merge|NZ_CP003811|1|4143437-4143685|CRISPRCasFinder
TCGAGGGTGCCGTCGTTGTCCGGATCGGCCATCTTGAAGCGCTCGCCGACCGCCGCGAGGTACTCCTTCTTGTCGAGGGTGCCGTCGCTGTCCGGATCGGCCCGCTTCACGCCGGCCTGGCTGAGGCGGCCCTTCAGCTCGCGGGCGTCGAGGGTCCCGTCGGCGTCCTTCTCGAGACGATCGAAGGTCGCGGAGGCCACCGCCTCCACTTCCTTCATGTCGACGGTGCCGTCGTTATCGGTGTCGATC

>NZ_CP003811|1|1|4143437-4143685|CRISPRCasFinder
TCGAGGGTGCCGTCGTTGTCCGGATCGGCC	ATCTTGAAGCGCTCGCCGACCGCCGCGAGGTACTCCTTCTTG
TCGAGGGTGCCGTCGCTGTCCGGATCGGCC	CGCTTCACGCCGGCCTGGCTGAGGCGGCCCTTCAGCTCGCGGGCG
TCGAGGGTCCCGTCGGCGTCCTTCTCGAGA	CGATCGAAGGTCGCGGAGGCCACCGCCTCCACTTCCTTCATG
TCGACGGTGCCGTCGTTATCGGTGTCGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP003811.1\|WP_100794000.1\|4152204_4153338_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|239551
NZ_CP003811.1\|WP_043381144.1\|4141132_4141402_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043349964.1\|4149165_4150728_-\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
NZ_CP003811.1\|WP_043758922.1\|4133703_4135395_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP003811.1\|WP_043349954.1\|4145939_4147001_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841
NZ_CP003811.1\|WP_043761383.1\|4132262_4133495_+\|transglycosylase-SLT-domain-containing-protein	unknown	unknown	gnl\|CDD\|381617
NZ_CP003811.1\|WP_043381161.1\|4151264_4151894_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP003811.1\|WP_043758933.1\|4141814_4142612_+\|3-oxoadipate-enol-lactonase	unknown	unknown	gnl\|CDD\|131480
NZ_CP003811.1\|WP_043381159.1\|4150746_4150965_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|177518
NZ_CP003811.1\|WP_043758929.1\|4140166_4140595_-\|DUF1810-domain-containing-protein	unknown	unknown	gnl\|CDD\|378062
NZ_CP003811.1\|WP_043758923.1\|4135391_4136669_-\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP003811.1\|WP_043349956.1\|4147087_4147324_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043349961.1\|4148836_4149169_-\|chorismate-mutase	unknown	unknown	gnl\|CDD\|181719
NZ_CP003811.1\|WP_043381150.1\|4142685_4143012_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043758931.1\|4140696_4141080_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043758925.1\|4136860_4137532_+\|HdeD-family-acid-resistance-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP003811.1\|WP_043758927.1\|4137693_4140162_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP003811.1\|WP_043758936.1\|4147759_4148455_-\|ribosome-maturation-factor-RimM	unknown	unknown	gnl\|CDD\|234650
NZ_CP003811.1\|WP_020092607.1\|4148466_4148829_-\|30S-ribosomal-protein-S16	unknown	unknown	gnl\|CDD\|234588
NZ_CP003811.1\|WP_043758935.1\|4144172_4145792_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173860

Protein	Function_ID	Function_description	E-value
NZ_CP003811.1\|WP_100794000.1\|4152204_4153338_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|239551	cd03469, Rieske_RO_Alpha_N, Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the initial source of two electrons for dioxygen activation.	1.71934e-32
NZ_CP003811.1\|WP_043349964.1\|4149165_4150728_-\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
NZ_CP003811.1\|WP_043758922.1\|4133703_4135395_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.50717e-107
NZ_CP003811.1\|WP_043349954.1\|4145939_4147001_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.47251e-75
NZ_CP003811.1\|WP_043761383.1\|4132262_4133495_+\|transglycosylase-SLT-domain-containing-protein	gnl\|CDD\|381617	cd16896, LT_Slt70-like, uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	0.000195329
NZ_CP003811.1\|WP_043381161.1\|4151264_4151894_+\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	0.000120621
NZ_CP003811.1\|WP_043758933.1\|4141814_4142612_+\|3-oxoadipate-enol-lactonase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	1.37193e-90
NZ_CP003811.1\|WP_043758929.1\|4140166_4140595_-\|DUF1810-domain-containing-protein	gnl\|CDD\|378062	pfam08837, DUF1810, Protein of unknown function (DUF1810). This is a family of uncharacterized proteins. The structure of one of the members in this family has been solved and it adopts a mainly alpha helical structure.	7.92621e-89
NZ_CP003811.1\|WP_043758923.1\|4135391_4136669_-\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	8.65746e-93
NZ_CP003811.1\|WP_043349961.1\|4148836_4149169_-\|chorismate-mutase	gnl\|CDD\|181719	PRK09239, PRK09239, chorismate mutase; Provisional.	7.44693e-49
NZ_CP003811.1\|WP_043381159.1\|4150746_4150965_-\|glutathione-S-transferase	gnl\|CDD\|177518	PHA03073, PHA03073, late transcription factor VLTF-2; Provisional.	0.00540194
NZ_CP003811.1\|WP_043758925.1\|4136860_4137532_+\|HdeD-family-acid-resistance-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	1.26982e-23
NZ_CP003811.1\|WP_043758927.1\|4137693_4140162_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP003811.1\|WP_043758935.1\|4144172_4145792_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173860	cd08495, PBP2_NikA_DppA_OppA_like_8, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP003811.1\|WP_020092607.1\|4148466_4148829_-\|30S-ribosomal-protein-S16	gnl\|CDD\|234588	PRK00040, rpsP, 30S ribosomal protein S16; Reviewed.	1.55247e-40
NZ_CP003811.1\|WP_043758936.1\|4147759_4148455_-\|ribosome-maturation-factor-RimM	gnl\|CDD\|234650	PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional.	2.35039e-50

>NZ_CP003811.1|WP_043381150.1|4142685_4143012_-|hypothetical-protein
MRNDPPEDGANRFGLADLCAIAEAPHGDAARPSAEDAPALGAEGDGQAADAGAADLLGEIGDTLIVAYRLAVQDGDPTTVTLIRQALLHTGRRLARGMSPAEAGLSCH
>NZ_CP003811.1|WP_043758933.1|4141814_4142612_+|3-oxoadipate-enol-lactonase
MPQITIGGIGFYYLLEGPEGAPAVAFSNSLGATLEMWDALVPALTGRYRTLRYDTRGHGGSETRDQPITVTDLAGDLAGLLDALGIGRAHLVGLSLGGMTVQALASAEPERALSATLMATAAHMPSPQSWDERAATVRAQGLAAVVEATLGRWFTPGFAQRDPAAIQAIRERFVACDPAGYAVCCGAIGCMDLRPALSAITAPTLVIAGRDDPSTPPAMAEEICAGIAQAELLVLPHAAHLLAVERAEAVGGYLRAFLDRASRDA
>NZ_CP003811.1|WP_043381144.1|4141132_4141402_-|hypothetical-protein
MHDPSTGDAAIRPAEFWDTVAGLVTAKVEPVIGRGDRQRGPVIDYLRDLEALARRQCGSRETVQIIASGRRLLGDRSEIGPSDGPFTHA
>NZ_CP003811.1|WP_043758931.1|4140696_4141080_+|hypothetical-protein
MLGTLVAFMVANPAMSHALTATLETAGLAAALILLRSPRPEGIAALVVSTYYYGREAGQREHDIKHAGWDAVQAHLGAEFLYGWSLPNLQQWVAPTCAAWVVAGAIYLIRSRMARAAPFQPPRRGRP
>NZ_CP003811.1|WP_043758929.1|4140166_4140595_-|DUF1810-domain-containing-protein
MTDSHQLGRFVDAQEEIYECALAELRAGAKRSHWMWFVFPQIAGLGASPMAQRYAIGSLAEAEAYAAHPVLGARLRACTAAVNAVDGRSAHAIFGSPDDLKFRSSMTLFDRAAPEEPLFAAALARYFDGVPDPRTLAKVGAA
>NZ_CP003811.1|WP_043758927.1|4137693_4140162_+|PBP1A-family-penicillin-binding-protein
MTPDAPERAPADGPNPPKPAPAAESPDPRLAAREAGRAARDLARHLRTLVTAAGLGLARGGRAISARAAARARTRSASVERPADTGVPEVDGRGVERRGARTILGRRHPALLAAGLVILLPVLALAVYLFAALVTLPPLGGAVVETGQRAITVEADDGRVFATRGSFRGQKLTAADLPPHLAQAIVAIEDRRFYSHWGIDLRGLARAAWRNLRGGGVREGGSTITQQYVRLTSLNQEKTLWRKVQEAFLALRVESTMSKDAILLGYLDSAYFGAGAYGADAAARRYFGKPAKALNLPESAMLAGLVRAPSQLAPTRNLGGAKERADVVLQAMVETGAITQAEADAARKQSVTLKSPPEAPPGTNYFLDMIAGDVKRLAGTDGDMTVRSTLNLDLQSLAEGVVARRLDKDGARRKVGQAAMVVLSKEGAILAMVGGRDYEDSQFNRAVQAKRQPGSLFKLLVYLTAYEKGYTPESVMVDRPVQIGDWDPENDDGRYRGPVPLRTAFALSINTVAAQLGQDVGIPAVIATARKLGIQSDLPNVPSLVLGSGAVSLLEMARAYGSVLSGRTPLQAYGIQAIRGAAPQPLYVRADAAPGQTLAQGPRTMMLDSLQAVVESGTGRAARVPGQIIGGKTGTSQDFRDAWFVGMTPDLVVGIWVGNDDDSPMNRMFGGEMPAGIFHDFIQRASEKLAKGKPRPSAERAEPPRAPAPAPTVEPAAAGEVRGVPEVIDTGTLNLRGRVVRLLGVVGERGHLARQLASYLRRREVVCSGLSDGATARCRIEGDDLAGLILAAGGARATEDAPPDLLGAEEQARAERVGLWGR
>NZ_CP003811.1|WP_043758925.1|4136860_4137532_+|HdeD-family-acid-resistance-protein
MTHSPSPTPQSPGSGSGSPTSPTGIPLVGVARLDAMSAALARNWWLVALRGVIAILFGVIAFVAPGAFVLSLVLFFAAYMLADGIIAIVGAVRAAQRHERWGFLLLEGVVDIVVGVAAALVPAAAVWAFVLLLAVWALVTGGLMIAAAFRLHLHYGRWWLVLGGVVSILFGLALLINPGMSALVLTWWIGSYTFAFGILLLILAFQLRSRHGAAAEPGTPLGR
>NZ_CP003811.1|WP_043758923.1|4135391_4136669_-|HlyD-family-secretion-protein
MFDDQRPSSEGEARPHPADGRPAARERDVLDLGRAKPAGDVGAAQETGRKPGTEDAADDAEAQDGQSDDAAEDADDGEDDARRPNVLRRHPFAFLLGGLAVVALCVGVFFYWLLYMHPYESTDDAFVDARSIAIQPKVGGYLVDVPVTDNQHVEAGQILFQIFQRDYQIALDQAKAQIEADEAGIKNIDAQIQAQYANIDVSKAQVATAEAALKFAQEDAARYKDLAERGSGSIQQSQSATSTLQQRQASLQSAQASVVAAQKQIGALQAQKASTQAQLARDRAQVEQAELNLGYTTVRAVQAGRVVRLTGGIGQLAQAGQSLAMLVPDDIWVTANFKETQITDMRPDQPVDIEIDAYPGRKIQGTVASVQPGSGTAFSLLPAQNATGNYVKVTQRIPVKIVVKNWPTDVSIGPGMSIVPTVTVR
>NZ_CP003811.1|WP_043758922.1|4133703_4135395_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MSAMAGGTGAAASGRKPNTGKAQGSKTQGGKARGGTASAKAPGGHNPWLIAGVVALATFMEVLDTTIANVALRYISGGLAVGPDEAAWVVTSYLVANAITLTASSFLAKRYGRKAFFMWSVALFTVSSILCGFAWSLESLLLFRVLQGLGGGGMAPLAQSILADSFPPEKRGQAFALYGVAIVVAPVIGPTLGGWLSDNASWHWCFLINGPVGVIALGLMYWLIEDSAAAKKERRALVRKGIRFDIVGFVLVALFLGSLEVILDEGQRKDWFGTSTLMNVSGVLMAVSFVAMIPWLLTKKNPAVDLRLIGNRQFGSCFLVMMFTGAILIATTQFIPQITQEYYGYTATLSGLVLGPGGIVTVVMMFLTGRVSAYVQPKWLIAAGMTIVALGMVDLTRLDGSTTFSFFAWSRVYIGIGLPMVFLSITSASYEGIRKDQTDQASALINVARNVGGSMGVSLAQNILAYRSQFHQSRLVESVNPTAPAYQETMRQATQYFSEHGYAGVEAQSQATAWIGSVLSTQVAYWAYIDVFWVLGLVATCAVPLALSLKSVKLGGGAPAGGH
>NZ_CP003811.1|WP_043761383.1|4132262_4133495_+|transglycosylase-SLT-domain-containing-protein
MGVFPEPARRADDVSRLVPPTLNGTGHIEDEAVAWLPRAGRGTGRRSLRRTGLGRISGTLALGLVAGLGLPQAAFAPAYFAPAAQAHDRIDTSPRAAQVLAQTASQPAAPTVAPDEPVQNTWNGLPVPEQEPATTALIQEDLAALPRVTQEQGQDAVKFGERSVPRKVVDTIVKASDEAGVDPVYMMALADKESSFDTEAKAATSSAAGLFQFVARTWLEMIRDYGARYGLAEEAAAVKGRGAAITVTGSMRGRVLGLRNDPRVAALMAAELIKRDRERIEARVGRALTTTELYLAHFLGTASAGRFLSLSSEKPDEVAGREFRTAARANRSLFTAKTGGKRRSLTVAELHGRIDDMIDRRLTRYQGVAAVAEALDKGQSQNEIVSAEETAPVAGNRRVEVTEALPPDGV
>NZ_CP003811.1|WP_043758935.1|4144172_4145792_-|ABC-transporter-substrate-binding-protein
MDPIKPTRRSLMAGGVALAALGAAGRAGAQGAAPGTLTYGISMTDLPLTTGQPDRGAGGYQFTGLTLYDPLVAWELDVADRPGRMVPGLATAWEADPADPKVWTFHLREGVAFHDGSTFDADAVIWNFDKVLNKEAPHFDQRQAAQVRPRLPGVASYRKLDAKTVQVVTKTPDSLFPYQMLWFLISSPAQYEKVGKDWAKFAFDPSGTGPFRLGQLVPRVRLELLPNVGYWNPKRVPKLAKLTLTCVPEDLARVNALLSGSVDLIESPAPDAVPRLKAAGMRVVGNETPHVWNYHLSMLEGSPWRDLRLRKAANLAIDRAGVVELMGGLAQPAVGQVQESSPWFGKPSFKIKTDVDQARKLVEEAGYSVKNPVKATVLIPTGGTGQMLSLPINEFVQQSWAEVGIQVEFKTVELEVAYTAWRQGAADPSLKGVSAGNIAYVTSDPFYAILRFYDSRQIAPNGVNWSHYRNPEVDALCDQVKASLDVAEQNRLLARIHEIVVDDAVQVWVVHDTNPHALSPRVKSYIQAQHWFQDLATLA
>NZ_CP003811.1|WP_043349954.1|4145939_4147001_-|MBL-fold-metallo-hydrolase
MKRRSLLTVASAATVMTLGGVGYAAHRRGRNPYYRGPTSDHFDGLRFFLPEQATDKALSDVLRWQAKRQREPWPKSFPSPYPADRPPERVAGLRVVLIGHASYLVQVAGRNILIDPVFAKRASPVRFAGPKRVNPPGIAFADLPPIDAVLVTHNHYDHLDGPSLARIWQAHQPLIVAPLGNDTILRGYDDTMHVETRDWGQSVDLGDGLQVHLVPANHWSARGVNDRRMALWCAFVITSPRGVHYHVGDTGFGDGSLFSDIRARFGPPRLATLPIGAYEPRWFMQAQHVDPAEAVRAFALLGAEQALGHHWGTFQLTDEGVERPAEALTAALGGAGIAPGRFLALRPGQVWEV
>NZ_CP003811.1|WP_043349956.1|4147087_4147324_-|hypothetical-protein
MPRFFIDLHDGSQPIHDEVGFDLPDLPAARAKVTRIMSAIARDMLPDVERQDYVACVRDGVGKIVYRARLSLAAEMVE
>NZ_CP003811.1|WP_043758936.1|4147759_4148455_-|ribosome-maturation-factor-RimM
MARRPAGSTPRDGGRRGRTSSAIGKIAPDAATSPKAPAPKPAPLPVPPDPNLVLLGEFGRAHGLNGEVRLKSYTGDPRAIAGYGALLTADGRSLTLADVRLAPGSSPDMLIARVKGVSGRSAAEALNRVALFIPRDRLTAPEDDDEVYTADLIGATAVDEAGTLVGTIVAVPNYGGGDLLELRPTNGGATALLPFTKAFVPVLDMAQRRVTVAAPEDLFAPPGEKPADDPG
>NZ_CP003811.1|WP_020092607.1|4148466_4148829_-|30S-ribosomal-protein-S16
MALKIRLTRGGAKKRPYYRIVVADARAPRDGRFIDKVGAYDPMKAKDDPARIVLDNEKIQSWLAKGAQPTDRVLRFLDQAGLAKRPTRNNPQKAEPGEKAKERAAKRAEKAAAPAEDAAA
>NZ_CP003811.1|WP_043349961.1|4148836_4149169_-|chorismate-mutase
MSILSAQAVDPELARLRESIDNFDAALIHLLAERFRCTQRVGELKARKGIPPSDPDREARQVARLRKLAVEAKLDPDFAEKFLAFVVKEVIRHHQSIKADHESQIEQQRK
>NZ_CP003811.1|WP_043349964.1|4149165_4150728_-|signal-recognition-particle-protein
MFEGLSDRLSGILSGLTRRGALTEADVTAAMREVRRALLEADVALEVVRGFTDRVKEKAVGAVVLKSVTPGQMVVKIVNDELVAMLGTDAETVDLNAPAPVPILMVGLQGSGKTTTTAKIARRLSDREKRKVLLASLDTRRPAAMEQLAVLAKQVGVESLPIIAGQSAVQIAKRAMDAARLGGFDVVMLDTAGRTTVDEGLMAEAAEVKAATRPHEVLLVADALTGQDAVNTARAFDERLGVTGIVLTRMDGDSRGGAALSMRAVTGKPIKLVGVGEKVDALEEFHPARVANRILGMGDIVSLVEKAAETIDHEQALRTAEKMRKGKFDLEDLSMQLAQMEKMGGIGGLMGMLPGMGAIKKQVEGANLDEKMFKRQRAIISSMTPQERKNPDLLKNSRKKRIAAGSGVDVSEINKLLKMHRTMADMMKAMGQGKRGIGQALGSMFGLGGGGMGGGMPGLPPGMPEPTPEQIAQLEKQFGGKLPPMPPGLGGGGMPKLPGLPGLGGPKLPGLGGFMPGKKK
>NZ_CP003811.1|WP_043381159.1|4150746_4150965_-|glutathione-S-transferase
MTRDQEALNIEDAINETCPWSGKPISADSLTLYNGAVVGFCNPECRDKFASAVRGFEAALQARRVERAGLEQ
>NZ_CP003811.1|WP_043381161.1|4151264_4151894_+|hypothetical-protein
MSEPARSLSPTESGSFPATGPLRDWLAAMKAHAPTETHGDARPAEAQPEPKRVRGGEAAWSPRVVPAPEAPRVATEDPDIAELMAENLMLKAKLRVEAGRQDELQAILAEEIRTLREHIRDEIGSLEDLRAEQEEIRIEREEFRGERERFRIEREEMRAERDRALADRDALRSERLTLVGERDGLREERDLWRARTEALAQPLFQSQRR
>NZ_CP003811.1|WP_100794000.1|4152204_4153338_+|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MTGAPRSARTALNAPFANPQRPADEAALDPDAMRQPLGNAWYCVGQARSLGTAGSRTGLRAVELNGEQIVLGRAPDGTPFALRDRCPHRGMALSKGRFDGDTLMCPFHGWRFGTDGRCRDVPTLSEHDAADFSRIQVQRFPIRESAGFLWVNPHIGPATGTVPEVPTLDFAPAGSLVVELVVEASFDLTTLSLVDPGHVAFVHDSWWFRPSKQLREKVKTFQPVPHGFVMTSHATTTSSPVYRLLGGVPEVEIEFRLPGVRLERIRAGEKRVANYTFATPLTPDRTLLTNALYWSMPALNLLKPVARPLMRQFLTQDQQVLQHAQDGLDRKPTMVLFGQGDLPSQWYFRLKREALESARDGRPFVNPLERRELRWRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP003811_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP003811_2

4885704-4885924

Orphan

Consensus_repeat	Method
CATCGCGGGCGGNNTGNCCAACACCGGCA	CRT

4 spacers

The CRISPR arrays of NZ_CP003811_2

>merge|NZ_CP003811|2|4885704-4885924|CRT
GATCACCGGCGGGGTGGCCAACACCGGCAGCCTGGCCAACAGCGGCGCCCTCGCGGGCGGGCTGACCAACACCGGCACAGCCCTCAACACCGGCGCCATCGCGGGCGGCGTGGCCAACACCGGCAGCCTCGCCAGCAGCGGCACCATCGCGGGCGGCCTGACCAACACCGGTACAGCCCTGAACACCGGCGCCATCGCGGGCGGCCTGATCAACACCGGCA

>NZ_CP003811|2|1|4885704-4885924|CRT
GATCACCGGCGGGGTGGCCAACACCGGCA	GCCTGGCCAACAGCGGCGC
CCTCGCGGGCGGGCTGACCAACACCGGCA	CAGCCCTCAACACCGGCGC
CATCGCGGGCGGCGTGGCCAACACCGGCA	GCCTCGCCAGCAGCGGCAC
CATCGCGGGCGGCCTGACCAACACCGGTA	CAGCCCTGAACACCGGCGC
CATCGCGGGCGGCCTGATCAACACCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP003811.1\|WP_043348035.1\|4892740_4893199_-\|MucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|368446
NZ_CP003811.1\|WP_043348026.1\|4889048_4890539_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|226434
NZ_CP003811.1\|WP_164706361.1\|4894568_4894718_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043759535.1\|4888297_4888495_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043348032.1\|4891785_4892064_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043759537.1\|4888686_4889052_-\|response-regulator	unknown	unknown	gnl\|CDD\|381122
NZ_CP003811.1\|WP_043386613.1\|4882289_4883345_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|236612
NZ_CP003811.1\|WP_043759539.1\|4890871_4891441_-\|DUF3016-domain-containing-protein	unknown	unknown	gnl\|CDD\|378666
NZ_CP003811.1\|WP_043759541.1\|4893830_4894436_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|182070
NZ_CP003811.1\|WP_051044697.1\|4892093_4892357_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP003811.1\|WP_043759531.1\|4879706_4881086_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274819
NZ_CP003811.1\|WP_043759530.1\|4878468_4879707_+\|SfnB-family-sulfur-acquisition-oxidoreductase	unknown	unknown	gnl\|CDD\|274924
NZ_CP003811.1\|WP_043352327.1\|4872404_4873628_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP003811.1\|WP_043759529.1\|4877213_4878458_+\|SfnB-family-sulfur-acquisition-oxidoreductase	unknown	unknown	gnl\|CDD\|274924
NZ_CP003811.1\|WP_043386625.1\|4875210_4876380_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|236863
NZ_CP003811.1\|WP_043352329.1\|4871068_4872337_-\|arsenic-transporter	unknown	unknown	gnl\|CDD\|238538
NZ_CP003811.1\|WP_100794025.1\|4894822_4895353_-\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|379056
NZ_CP003811.1\|WP_043759532.1\|4881073_4882288_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270218
NZ_CP003811.1\|WP_043761500.1\|4874410_4875211_+\|dioxygenase	unknown	unknown	gnl\|CDD\|224381
NZ_CP003811.1\|WP_043352323.1\|4876470_4877124_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922

Protein	Function_ID	Function_description	E-value
NZ_CP003811.1\|WP_043348026.1\|4889048_4890539_-\|PAS-domain-containing-protein	gnl\|CDD\|226434	COG3920, COG3920, Signal transduction histidine kinase [Signal transduction mechanisms].	1.05924e-33
NZ_CP003811.1\|WP_043348035.1\|4892740_4893199_-\|MucR-family-transcriptional-regulator	gnl\|CDD\|368446	pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan.	6.4549e-56
NZ_CP003811.1\|WP_043759537.1\|4888686_4889052_-\|response-regulator	gnl\|CDD\|381122	cd17586, REC_PFxFATGY, phosphoacceptor receiver (REC) domain of PFxFATGY motif single-domain (stand-alone) response regulators. This subfamily is composed of stand-alone response regulators (RRs) containing the PFxFATG[G/Y] motif; RRs with such a motif are also called ''FAT GUY'' response regulators. Included in this subfamily are Sphingomonas melonis SdrG, Sinorhizobium meliloti Sma0114, and Erythrobacter litoralis EL_LovR. SdrG is involved in the control of the general stress response. Sma0114 is part of the Sma0113/Sma0114 two-component system (TCS) that is involved in catabolite repression and polyhydroxy butyrate synthesis. EL_LovR is involved in a light-regulated TCS. PFxFATG[G/Y] RRs are typically associated with histidine-tryptophan-glutamate (HWE) histidine kinases that constitute a subclass of the larger histidine kinase superfamily characterized by an altered ATP binding site, which lacks the F-box that is normally an integral component of the ATP lid. The PFxFATG[G/Y] motif is involved in conformational changes after phosphorylation that results in the activation of the RR. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.66363e-21
NZ_CP003811.1\|WP_043386613.1\|4882289_4883345_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|236612	PRK09685, PRK09685, DNA-binding transcriptional activator FeaR; Provisional.	1.73936e-24
NZ_CP003811.1\|WP_043759539.1\|4890871_4891441_-\|DUF3016-domain-containing-protein	gnl\|CDD\|378666	pfam11454, DUF3016, Protein of unknown function (DUF3016). This is a bacterial family of uncharacterized proteins.	7.47011e-50
NZ_CP003811.1\|WP_043759541.1\|4893830_4894436_-\|PAS-domain-containing-protein	gnl\|CDD\|182070	PRK09776, PRK09776, putative diguanylate cyclase; Provisional.	1.1046e-10
NZ_CP003811.1\|WP_043759531.1\|4879706_4881086_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP003811.1\|WP_043759530.1\|4878468_4879707_+\|SfnB-family-sulfur-acquisition-oxidoreductase	gnl\|CDD\|274924	TIGR04022, Acyl-CoA_dehydrogenase_type_2_domain, sulfur acquisition oxidoreductase, SfnB family. Members of this protein family belong to the greater family of acyl-CoA dehydrogenases. This family includes the sulfate starvation induced protein SfnB of Pseudomonas putida strain DS1, which is both encoded nearby to and phylogenetically closely correlated with the dimethyl sulphone monooxygenase SfnG. This family shows considerable sequence similarity to the Rhodococcus dibenzothiophene desulfurization enzyme DszC, although that enzyme falls outside of the scope of this family. [Central intermediary metabolism, Sulfur metabolism].	0
NZ_CP003811.1\|WP_043352327.1\|4872404_4873628_-\|metallophosphoesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	3.93773e-16
NZ_CP003811.1\|WP_043759529.1\|4877213_4878458_+\|SfnB-family-sulfur-acquisition-oxidoreductase	gnl\|CDD\|274924	TIGR04022, Acyl-CoA_dehydrogenase_type_2_domain, sulfur acquisition oxidoreductase, SfnB family. Members of this protein family belong to the greater family of acyl-CoA dehydrogenases. This family includes the sulfate starvation induced protein SfnB of Pseudomonas putida strain DS1, which is both encoded nearby to and phylogenetically closely correlated with the dimethyl sulphone monooxygenase SfnG. This family shows considerable sequence similarity to the Rhodococcus dibenzothiophene desulfurization enzyme DszC, although that enzyme falls outside of the scope of this family. [Central intermediary metabolism, Sulfur metabolism].	0
NZ_CP003811.1\|WP_043386625.1\|4875210_4876380_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|236863	PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional.	4.98401e-166
NZ_CP003811.1\|WP_043352329.1\|4871068_4872337_-\|arsenic-transporter	gnl\|CDD\|238538	cd01118, ArsB_permease, Anion permease ArsB. These permeases have been shown to export arsenate and antimonite in eubacteria and archaea. A typical ArsB permease contains 8-13 transmembrane helices and can function either independently as a chemiosmotic transporter or as a channel-forming subunit of an ATP-driven anion pump (ArsAB). The ArsAB complex is similar in many ways to ATP-binding cassette transporters, which have two groups of six transmembrane-spanning helical segments and two nucleotide-binding domains. The ArsB proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium, arsenate, sulfate, and organic anions across biological membranes in all three kingdoms of life.	5.83663e-120
NZ_CP003811.1\|WP_100794025.1\|4894822_4895353_-\|GAF-domain-containing-protein	gnl\|CDD\|379056	pfam13185, GAF_2, GAF domain.	2.5131e-08
NZ_CP003811.1\|WP_043759532.1\|4881073_4882288_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270218	cd00997, PBP2_GluR0, Bacterial GluR0 ligand-binding domain; the type 2 periplasmic binding protein fold. Glutamate receptor domain GluR0. These domains are found in the GluR0 proteins that have been shown to function as prokaryotic L-glutamate activated potassium channels, also known ionotropic glutamate receptors or iGluRs. In addition to two ligand binding core domains, iGluRs typically have a channel-like domain inserted in the middle of the GluR-like domain. The GluR0 proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.15672e-53
NZ_CP003811.1\|WP_043761500.1\|4874410_4875211_+\|dioxygenase	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	4.62535e-83
NZ_CP003811.1\|WP_043352323.1\|4876470_4877124_+\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	6.06299e-94

>NZ_CP003811.1|WP_043386613.1|4882289_4883345_-|helix-turn-helix-domain-containing-protein
MSSEERNRDPDVAPAGGAAPGGEVACLRFEPPGDPEALGRAWQDHLAPIFDVSFRPETDLTIPIAMRSYHLGDLLVGDVVAPAHTLVRTREMIGQQGLDHILLQFYRRGQSRVETDHGTGPVNEVQCIVFDLAQPVRIVAGAVDATNVVIPRALLEKQGCHPDALHGRPLDHDGDPFGRLVHNFVANVVACGDLLDRREALAASTAITQLCASWLRGQEEGRPSQNQDVRIRVRRLVEAELGNPKLTPALVAARLGLSRSTLYRLFAPNGIVAYIRDRRLMAAMRMLVRDDASKPLRISQVAFAVGFSDERTFRRAFKRRFGFIPSDASQRLDAHPDPAPGAVLRNWIESL
>NZ_CP003811.1|WP_043759532.1|4881073_4882288_-|transporter-substrate-binding-domain-containing-protein
MPRPFTGRRRAVAPAGVVAFCLCLAAAVPVAADPLRAETRDTARTASEGVSEGPPLALRTNDPETWRVATHPVPPLVMEAEGRLRGFSIDLWNAIARELGVRTAFVRVDDLPALFGAVSDGRADLAIAAVSITAERERRFDFSVTMLETGLRIAVPAAPDATGSATGRALRALLSDATFLQVLLGLAALILAVAALIWWLERRHPGGMAARARPAHGFAHVLWWALSSLAAQAEEMPRSPLARAITVVWLFTCIALVAWFTAGLTSTATVERLRGAINGPQDLPGKRVGTVAHTTSVAYLADHFATPVGFASLEEACAALQAGTVAAVVYDAPALSYYATQPGHAPLRLIGPAFNRQAYGILFAANDPRRKRVNQALLGLREDGRYDEIYSRWFGSESGEAQDR
>NZ_CP003811.1|WP_043759531.1|4879706_4881086_+|LLM-class-flavin-dependent-oxidoreductase
MAAQKKQILLNAFNMACVGHINHGLWTHPRDRSSAYNTLGYWTDQAKLLERGLFDGLFIADIIGVYDVYGDGIDVTAREAVQLPVNDPTVMIAAMAAVTEHLGFGVTINVHQEAPYTFARRLSTLDHLTGGRIGWNIVTGYLDSAHRAQSGGTLPAHDRRYDYADEYLEVLYRLWEGSWDDAAVRRDRAARVFSDPAHIRKVAHRGEFFAVDGYHLSEPSPQRTPVLYQAGASGRGRAFAGRHAECVFISARDTATARESVRAIRAEAVAAGRNPDDVKVFVGLAVIPGRTRAEAEAKRDEYLSYASPEAGLAHFSASTGIDFARYGLDEAIPYAPGNAIQSATAAAAKRGLTKRDLLAELQLGGRYPVLTGDAVAIADELQAWIEEGEVDGFNLSRIVVPESFSDFIDLVIPELQDRGLYKTAYAEGSLRAKLFGQGDRLPARHPAEAHRHRGAPQRS
>NZ_CP003811.1|WP_043759530.1|4878468_4879707_+|SfnB-family-sulfur-acquisition-oxidoreductase
MPLQPHETAFTQAPAPPRPVPVIADAAAALAIADTLAAAFAEAAVARDLERRLPVAEVERFSESGLWAITVPKAYGGPGLDSATVAQVIARIAAADGSLGQIPQNHFYALEVLRNGGTEAQKRDLYGRVLAGERFGNALAEIGARDHTRRTRLVRDPAGWFVEGRKYYCTGSLYAHRIPTLVEAEEAGRTATYLVFIPRDAPGVTLVDDWDGFGQRVTGSGSVLFERVAVEPRWVVPFQASLERPTAIGPFAQILHAGIDLGIGEGAFAATLPFVRDRARPWIDSGVTRAGEDPLTLHALGDVQVRLAAADALLTRAGRFVDAAQDAPDADNVAAASVAVAEARAASHRAGLLASNRLLELGGTSATDRAEALDRYWRNVRTHTLHDPVRWKYHWIGAYHLDGRLPPRHGAL
>NZ_CP003811.1|WP_043759529.1|4877213_4878458_+|SfnB-family-sulfur-acquisition-oxidoreductase
MSLDMDESVADGAAEPMPPPPSPPHRIGSDAEAIAAAQAVARIFAAGAAERDRDRRLPWGEIAAFTDSGLGGLTVPRAHGGAEVSYATLAEVFTILAAADGSAAQIPQNQFGVLALVAVAASPAQQARIYRDVLAGHRIGNAGPARNGKAITRVETRLTSGPAGPRLSGHRFYSTGALFAHWIPTRAVGPDGGPLLVFLRRDAPGVRVVDDWQGFGQRTTASGSVLFENAPVEADLTIDLAPLAGRPGLFGPISQLIHAAIDAGLARGAVAAALDFLRTRTRPYPFTAETVAEDPHILGEVGRLTVDLHAAEAVLARAGRTLDRIAAAPVTAQSAAEASVAVAQAKILTTEVALEASERLLELAGASATRDGYNLGRFWRDARVHTLHDPVRWKYHLLGNHALNGVLPARHQWN
>NZ_CP003811.1|WP_043352323.1|4876470_4877124_+|ABC-transporter-permease
MTPQMIDRLWQAFLDTGLMVGVSAGIAVLAGLPLALFLVISGPGGIVPAPAANRVVGAVVNGFRAVPFIVLLVALIPFTRLVAGTTIGVWAAIVPLAVSATPFFARIAEVSLREVDAGLIEAAQSIGCRRRHILAHVLLPEALPGIVAGFTITVVSMIGASAMAGAVGAGGLGDVAIRYGYQRFDTTVMMVVIAILIALVCVVQFAGDTAVRRLRAR
>NZ_CP003811.1|WP_043386625.1|4875210_4876380_+|ATP-binding-cassette-domain-containing-protein
MVGLVFDSLHTPGTPVATGRRSPGAAATAPGPAAGPAAAPGRRPGTVRFEAVSKTYPSAAGPVRALDSVDLAIPAGAIFGIIGRSGAGKSSLLRMVNRLEAPTSGRVLVDGAPVDALDTDGLVALRRRVGMIFQHFNLLAAKTVRQNVALPLTVAGVPRSAIGPRVAEALRLVGLEDKADTYPSRLSGGQKQRVGIARALVSDPEILLCDEATSALDPETTLAILDLLRDINRRLGITIILITHEMHVIREICSDVVVLERGRVVETGPVWRVFGAPEHPTTQALLEPLTRGLPPDLADRLQPLPTPGGSAILRITWAGQGTPDLSGLAVAAGTPVRLLQAGIERIQGHAVGRMLVAVPGADPDVEARLRALGGAVERLGYVAPEAEAG
>NZ_CP003811.1|WP_043761500.1|4874410_4875211_+|dioxygenase
MKILRLLAVAALCLGASSAGAEALRIGVVPGAYGDAVTVAAREAKAEGLDVKVVEFSDWTTPNVALDAGDIDVNFFQHRPFMENAAKQKGYAFDIVGQGILSNIGLYSLKHKRLDEIPVGGSVALANDPVNQGRGLLLLQKAGLVRLKDGVGFLGTLDDIVENPKTLRFTEVEGPQLARITGDVDLAQGYPHFIVAAGSFDPTSGLIYSGIEDKLFTVSFVTKTSRKDDPAIRKFVTLFQNSDAVKRQIRKSFADSDKLYLLAWQN
>NZ_CP003811.1|WP_043352327.1|4872404_4873628_-|metallophosphoesterase
MTADHGVFAFAHVGDLHLERSSDPHAADLRAILAEVDGLHGHGLLDFAYLPGDLAEDGRAEQYAVLREALHRHPDLPVRLIAGDHDRQHGTMTDFDALFAAVAGSPRGGGHAARRHDLPRPHDPAPVTHYYFAETFAGVRCLFLDMVSPGYGRKGFGLDFRLGPCQLAWLAEELARADEEGRPCAVFTHTYPDDLCVPDEKAALAGLIRHHGVRLVEMGHTHYNELAPDGRTLYAAARSVGQNEDGSVGYAVAAIDGPVTSWRFKPLDRALPFVMITSPADRRLATAPLAMADGRISVRALVLSDRPQGDWCCCVRVDDGRPHAMVPDGPRTVHARIPWPEGARRLAVTVTDGTGQADTEVIEPVGRSFVPPPAPDRPGSDATRLPAWPQKGLRGDQLGPNRNGRPW
>NZ_CP003811.1|WP_043352329.1|4871068_4872337_-|arsenic-transporter
MGALTLTPNIATWAIAALATLGVILRPFAWPEAIWAVLGAGALVALGLLAPATAWDGVLKGTDVYLFLVGMMLMSEVARKEGLFDWLASIAVRAAKGSATRLFTLVYLVGTVVTVFLSNDACAVVLTPAVYAATKAAKVENPLPYLFICAFIANAASFVLPISNPANLVVFAEHMPPLVRWLGLFALPSLLAIATTYAVLRLTQAKTLRGQEVATDVEAVSLSRTGLVAGIGIVATGGVLIAASALGLDLGLPTFVAGLATTIVVLLLKRGGLVEVAKDVSWSVLPLVAGLFVLVEALEKTGVLAMLADLLKGYAHAAPEATAWGAGGLVAVLCNLVNNLPAGLIAGAAVQAAHVPEKVAGAILIGVDLGPNLSVTGSLATILWLTAIRREGQDVGAWTFLKLGLLVMPPALALALAGLLLV
>NZ_CP003811.1|WP_043759535.1|4888297_4888495_+|hypothetical-protein
MQDRRESGDPSIEAEPASRRPGRLRRLVDLLEGIELLVQAVRLLGWLLRGLWLAAGALVRAFGDR
>NZ_CP003811.1|WP_043759537.1|4888686_4889052_-|response-regulator
MTPTPRPLAGRRVLLVEDDYFIAIDLKSGFEASGAQVLGPVPSVGEALALIARTAAIDAAVLDINLQDELVYPVADALYARGVPFLFATGYDPVAVPSLHGAVALCQKPLDPQIVARALFG
>NZ_CP003811.1|WP_043348026.1|4889048_4890539_-|PAS-domain-containing-protein
MSEACIFSAGCSELADLVRTYDWTQTPLGPLADWPQSLIFTVSTLLQSPVPIVLLWGEDGIMIYNDAYSVFAGARHPKLLGSKVREGWPEIVDFNDNVMRVGLAGGTLSYKDQELTLHRYGQPEPVWMNLDYSPVFGADGRPAGVIAIVVESTERVLAERRLRESEELFRTLAQGIPQLVWRAAIDGACIWSSPQWHAYTGQTEATSRGWGWLDAVHADDYAAAETAWREAPVSGHLSFEHRLRNAAEQRFCWFQTRAAPVRDAQGRIVEWLGTSTDIDDLRQFQERQQVMVAELQHRTRNLLGVVRSIAQQTMAQTGPGETFRERFNDRLSALSRVQGLLSRSDQEPITLRALIETELAALDAPAMQGRIRLHGPVVRLRKATVQTFALALHELATNALKYGALTSEEGRLTVTWRTYRADDGGGRLLVEWVEDGLVRRPDSADAPPRGGYGRELIEHALPYALKATTSYELGDTALYCAINIPLPDGEAAGSPA
>NZ_CP003811.1|WP_043759539.1|4890871_4891441_-|DUF3016-domain-containing-protein
MCRRLAGGWAGFAILVLLPLAGPAAAQVQAQIVQAQVAEAPIVQAQVHVRYADPDRFTDAENRFGSGQPLRVTLAELTRIFRDLGTARLRPDERLDIIVLDVDLAGFERPGFATPTGLRVVTDATPPRIRLAYVLHRGGRIVAQGEDTVTDINFLLTSNPRFSTGSLYYERQLLRDWFARRFPEPAGRH
>NZ_CP003811.1|WP_043348032.1|4891785_4892064_-|hypothetical-protein
MAYKPKSAAETKARDLGLALARIAEGAGLPASIGVDQVRRASPRLTPLAVGQMVRKERDTVEATLAERGLALVDYSDQGPGRGMEFCIDTAT
>NZ_CP003811.1|WP_051044697.1|4892093_4892357_-|hypothetical-protein
MERASRPTRLYRFHCTDGHELVTDLCGSRLPDGAPMRAHAERVALALMERVVERFDWSGWQVEVYDAKGRRVWIRAFPDVNVDTRAA
>NZ_CP003811.1|WP_043348035.1|4892740_4893199_-|MucR-family-transcriptional-regulator
MNETFDEASNTLAVITAELVAAYVSNNPVPASELPALIARVHGAVSGLVAGTLTPESGAAPQAEIEKPGAAQVRKSVRQDGIVSFIDGKTYKTLKRHLASHGLDPRSYRDRYGLPADYPMVAPGYAEQRSALAKAIGLGQPGAMARRGGAKR
>NZ_CP003811.1|WP_043759541.1|4893830_4894436_-|PAS-domain-containing-protein
MSEISRTPIDATDGFNTPFDRLQAALDASGVVGAWDWDIRRGTIVYDAGAARLLTGDPALAGTEISGADALAAVHPDDHPWLLDQVQRAVRSGGLVLAEYRVVQGGAEHWLISRGRTVPDSAGRPVRARGIIIDITELRESGDRYIFTSAAAPDDPLSRAADLAIALRQTLGEDAASELRLAADGLLMSLGRALARTMGRR
>NZ_CP003811.1|WP_164706361.1|4894568_4894718_-|hypothetical-protein
MKRLTLIGIFVALLLAIVAIAATWSTVTPVNPAVAPDTSSTPNPTAQRK
>NZ_CP003811.1|WP_100794025.1|4894822_4895353_-|GAF-domain-containing-protein
MDRSACFHDASQMAERPLDSDAGLVRASCRLATARFLEDIVTILRETAREIAGSDGIAVVLREGDASFYAAEDAIEPLWRGRRFPLTDCVSGRAMLNGATIVVPDIECDPRVPIAAYRLTSMRSLVVVPIGSPEPIAALSAYWCASVIPDDGTVRRLEGLARHAAAALDRIRPSGP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP003811_2	2.3\|4885829\|19\|NZ_CP003811\|CRT	4885829-4885847	19	NZ_CP003811.1	1190010-1190028	1	0.947
NZ_CP003811_2	2.1\|4885733\|19\|NZ_CP003811\|CRT	4885733-4885751	19	NZ_CP003811.1	5394046-5394064	2	0.895
NZ_CP003811_2	2.3\|4885829\|19\|NZ_CP003811\|CRT	4885829-4885847	19	NZ_CP003811.1	2746461-2746479	2	0.895
NZ_CP003811_2	2.3\|4885829\|19\|NZ_CP003811\|CRT	4885829-4885847	19	NZ_CP003811.1	3920029-3920047	2	0.895
NZ_CP003811_2	2.3\|4885829\|19\|NZ_CP003811\|CRT	4885829-4885847	19	NZ_CP003811.1	5172093-5172111	2	0.895

1. spacer 2.3|4885829|19|NZ_CP003811|CRT matches to position: 1190010-1190028, mismatch: 1, identity: 0.947

gcctcgccagcagcggcac	CRISPR spacer
gccgcgccagcagcggcac	Protospacer
*** ***************

2. spacer 2.1|4885733|19|NZ_CP003811|CRT matches to position: 5394046-5394064, mismatch: 2, identity: 0.895

gcctggccaacagcggcgc	CRISPR spacer
gcttggccaagagcggcgc	Protospacer
**.******* ********

3. spacer 2.3|4885829|19|NZ_CP003811|CRT matches to position: 2746461-2746479, mismatch: 2, identity: 0.895

gcctcgccagcagcggcac	CRISPR spacer
gccgcgccagcggcggcac	Protospacer
*** *******.*******

4. spacer 2.3|4885829|19|NZ_CP003811|CRT matches to position: 3920029-3920047, mismatch: 2, identity: 0.895

gcctcgccagcagcggcac	CRISPR spacer
gcatcgccaggagcggcac	Protospacer
** ******* ********

5. spacer 2.3|4885829|19|NZ_CP003811|CRT matches to position: 5172093-5172111, mismatch: 2, identity: 0.895

gcctcgccagcagcggcac	CRISPR spacer
gcctcgccagccgcgccac	Protospacer
*********** *** ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1489488 : 1596163

Bacillus_phage(16.67%)

transposase,bacteriocin,integrase

attL 1530186:1530203|attR 1601632:1601649

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100793923.1\|1489488_1490294_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_148311223.1\|1490419_1490800_-	hypothetical protein	NA	NA	NA	NA
WP_158498441.1\|1490796_1490964_-	glycosyltransferase family 25 protein	NA	NA	NA	NA
WP_148311224.1\|1490990_1491383_+	hypothetical protein	NA	NA	NA	NA
WP_148311225.1\|1491587_1492319_-	hypothetical protein	NA	NA	NA	NA
WP_100793925.1\|1492770_1493580_-	hypothetical protein	NA	NA	NA	NA
WP_043756321.1\|1493623_1495615_-	glycosyltransferase family 2 protein	W5S6L1	Pithovirus	1.1e-56	46.2
WP_162483074.1\|1496359_1496668_-	hypothetical protein	NA	NA	NA	NA
WP_100793926.1\|1499232_1501437_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	5.7e-30	26.8
WP_052083836.1\|1501660_1502944_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_043756324.1\|1502975_1504763_+	sel1 repeat family protein	NA	NA	NA	NA
WP_043354299.1\|1504884_1505121_+	hypothetical protein	NA	NA	NA	NA
WP_052083571.1\|1505942_1508465_+	response regulator	A0A1V0SGX0	Hokovirus	3.1e-40	31.7
WP_043388009.1\|1508861_1509458_-	response regulator transcription factor	NA	NA	NA	NA
WP_043354302.1\|1510311_1510866_-	PAS domain-containing protein	NA	NA	NA	NA
WP_158498442.1\|1510962_1511256_-	hypothetical protein	NA	NA	NA	NA
WP_043756327.1\|1513271_1514105_+	porin family protein	NA	NA	NA	NA
WP_043382471.1\|1514514_1514724_+	hypothetical protein	NA	NA	NA	NA
WP_052083572.1\|1515724_1515964_-	hypothetical protein	NA	NA	NA	NA
WP_043756333.1\|1516350_1517676_-\|bacteriocin	NHLP bacteriocin system secretion protein	NA	NA	NA	NA
WP_148311226.1\|1517730_1520340_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	3.8e-17	29.2
WP_100793928.1\|1520336_1522478_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.2e-14	22.5
WP_043354744.1\|1522586_1523048_-	hypothetical protein	NA	NA	NA	NA
WP_043354747.1\|1523106_1523616_-	hypothetical protein	NA	NA	NA	NA
WP_043756339.1\|1523681_1526357_-	hypothetical protein	NA	NA	NA	NA
WP_107067063.1\|1526474_1526822_+	hypothetical protein	NA	NA	NA	NA
WP_043756344.1\|1527193_1528273_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_043756346.1\|1528269_1531389_+	efflux RND transporter permease subunit	NA	NA	NA	NA
1530186:1530203	attL	NA	NA	NA	NA
WP_052083573.1\|1531641_1532226_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_100793929.1\|1532894_1533856_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.1e-09	23.4
WP_100793930.1\|1533948_1534737_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_085985307.1\|1535054_1536156_+\|transposase	IS3-like element ISMra1 family transposase	S5WIU1	Leptospira_phage	3.4e-52	42.6
WP_043756353.1\|1536631_1538194_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_100794077.1\|1538340_1539897_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_100793931.1\|1539859_1540093_-	hypothetical protein	NA	NA	NA	NA
WP_043756357.1\|1540083_1540446_-	hypothetical protein	NA	NA	NA	NA
WP_100793933.1\|1540759_1541407_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	2.7e-25	39.8
WP_043756360.1\|1543149_1544829_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_100793935.1\|1545564_1546404_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_100793936.1\|1546607_1547706_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.4e-53	43.2
WP_167337805.1\|1547839_1548004_-	hypothetical protein	NA	NA	NA	NA
WP_100793937.1\|1560666_1583523_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.1e-143	26.5
WP_091955467.1\|1584395_1585662_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_158498443.1\|1587913_1589659_+	cyclic peptide export ABC transporter	F2Y165	Organic_Lake_phycodnavirus	3.0e-10	26.7
WP_043756370.1\|1590154_1592356_+	ATP-dependent RecD-like DNA helicase	A0A1P8DII4	Virus_Rctr197k	1.3e-50	32.1
WP_043756372.1\|1593182_1594172_-	transporter	NA	NA	NA	NA
WP_043756374.1\|1594645_1594894_-	hypothetical protein	NA	NA	NA	NA
WP_043756376.1\|1595611_1596163_+\|integrase	site-specific integrase	NA	NA	NA	NA
1601632:1601649	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1906008 : 1914827

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043756672.1\|1906008_1907646_-	acyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	3.7e-34	27.9
WP_051044948.1\|1907725_1908340_-	PAS domain-containing protein	NA	NA	NA	NA
WP_043354541.1\|1908658_1909306_+	ParA family protein	W8ECJ6	Mycobacterium_phage	1.2e-12	34.6
WP_043354543.1\|1909289_1909628_+	hypothetical protein	NA	NA	NA	NA
WP_043761076.1\|1909909_1911241_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.6e-19	57.1
WP_043354561.1\|1911413_1912658_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-50	36.2
WP_100794081.1\|1912668_1913391_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.9e-31	42.7
WP_043756674.1\|1913774_1914827_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	4.6e-06	38.7

DBSCAN-SWA_3

5375577 : 5439905

Stx2-converting_phage(33.33%)

transposase,integrase

attL 5376451:5376467|attR 5380386:5380402

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052083708.1\|5375577_5376390_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
5376451:5376467	attL	NA	NA	NA	NA
WP_158498471.1\|5376832_5378491_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_148311270.1\|5378733_5385009_-	hypothetical protein	NA	NA	NA	NA
5380386:5380402	attR	NA	NA	NA	NA
WP_043759905.1\|5385408_5385648_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139237855.1\|5385619_5385949_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158498472.1\|5385987_5386152_-	hypothetical protein	NA	NA	NA	NA
WP_052083710.1\|5386302_5386962_+	hypothetical protein	NA	NA	NA	NA
WP_043759907.1\|5387035_5387863_+	hypothetical protein	NA	NA	NA	NA
WP_052083711.1\|5387937_5389896_+	AAA family ATPase	C7U047	Ostreococcus_tauri_virus	3.3e-29	31.1
WP_043759909.1\|5389985_5390330_+	hypothetical protein	NA	NA	NA	NA
WP_100794038.1\|5390839_5392885_+	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	1.0e-09	27.1
WP_052083712.1\|5393087_5395184_+	recombinase family protein	NA	NA	NA	NA
WP_139237856.1\|5395318_5395984_-	hypothetical protein	NA	NA	NA	NA
WP_139237857.1\|5395980_5397141_-	hypothetical protein	NA	NA	NA	NA
WP_043759912.1\|5397152_5399297_-	ATP-binding protein	NA	NA	NA	NA
WP_148311271.1\|5400178_5401084_-	hypothetical protein	NA	NA	NA	NA
WP_100794122.1\|5403470_5404037_+	DNA mismatch endonuclease Vsr	I6NSG0	Burkholderia_phage	1.3e-23	43.8
WP_043759914.1\|5404173_5406369_-	ATP-binding protein	NA	NA	NA	NA
WP_052083713.1\|5406365_5407442_-	DNA cytosine methyltransferase	A0A0R6PG08	Moraxella_phage	2.5e-95	52.9
WP_043759915.1\|5407645_5413528_-	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_158498473.1\|5413549_5415226_-	hypothetical protein	NA	NA	NA	NA
WP_148311273.1\|5415610_5418199_-	hypothetical protein	NA	NA	NA	NA
WP_148311274.1\|5420307_5421834_-	hypothetical protein	NA	NA	NA	NA
WP_158498474.1\|5422142_5424452_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_091981902.1\|5424468_5425047_+	DUF1353 domain-containing protein	A0A0E3Y4V5	Fusobacterium_phage	4.2e-09	36.7
WP_043759919.1\|5425167_5425506_+	hypothetical protein	NA	NA	NA	NA
WP_139237902.1\|5425515_5425797_+	hypothetical protein	NA	NA	NA	NA
WP_148311275.1\|5426326_5427496_-	hypothetical protein	NA	NA	NA	NA
WP_043759921.1\|5427782_5428100_-	hypothetical protein	NA	NA	NA	NA
WP_043759923.1\|5428236_5428443_-	hypothetical protein	NA	NA	NA	NA
WP_043759926.1\|5428714_5428966_-	hypothetical protein	NA	NA	NA	NA
WP_043759928.1\|5429089_5429302_+	hypothetical protein	NA	NA	NA	NA
WP_100794041.1\|5429303_5429789_+	hypothetical protein	NA	NA	NA	NA
WP_139237904.1\|5429854_5430361_+	hypothetical protein	NA	NA	NA	NA
WP_148311276.1\|5430429_5430654_+	hypothetical protein	NA	NA	NA	NA
WP_052083721.1\|5430673_5431474_-	hypothetical protein	NA	NA	NA	NA
WP_139237906.1\|5431535_5432090_-	hypothetical protein	NA	NA	NA	NA
WP_043759932.1\|5432125_5432836_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	8.2e-47	45.3
WP_139237907.1\|5433025_5433673_-	biotin/lipoyl-binding protein	NA	NA	NA	NA
WP_162483077.1\|5433636_5434401_-	hypothetical protein	NA	NA	NA	NA
WP_162483078.1\|5434406_5434901_+	hypothetical protein	NA	NA	NA	NA
WP_043759934.1\|5435245_5435686_+\|transposase	transposase	NA	NA	NA	NA
WP_043759936.1\|5435682_5436039_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.6e-21	48.1
WP_100794123.1\|5436145_5437624_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.5e-103	44.3
WP_091981917.1\|5437673_5438150_+	VOC family protein	NA	NA	NA	NA
WP_100794043.1\|5438383_5438875_+\|transposase	transposase	NA	NA	NA	NA
WP_052083723.1\|5439170_5439446_+	hypothetical protein	NA	NA	NA	NA
WP_052083725.1\|5439557_5439905_+\|transposase	transposase	A0A0P0ZBS5	Stx2-converting_phage	2.0e-22	52.5

DBSCAN-SWA_4

5676666 : 5693996

Paracoccus_phage(36.36%)

head,tail,protease,capsid,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043760110.1\|5676666_5677860_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	7.3e-56	39.4
WP_043760111.1\|5677953_5678466_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	4.8e-25	46.6
WP_052083759.1\|5678492_5679785_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	7.8e-80	43.8
WP_043353382.1\|5680041_5680587_-	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	4.8e-07	27.7
WP_078947095.1\|5680699_5681623_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_043760114.1\|5681749_5682520_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_043760115.1\|5682545_5683109_+	phiE125 gp8 family protein	NA	NA	NA	NA
WP_043349544.1\|5683143_5683497_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_043387353.1\|5683493_5683922_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_043349538.1\|5683933_5684344_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_043387351.1\|5684349_5684682_+	gene transfer agent family protein	NA	NA	NA	NA
WP_075382066.1\|5684696_5684900_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_043760119.1\|5684909_5685482_+\|tail	phage tail tape measure protein	A0A1B2AP03	Escherichia_phage	3.5e-08	40.0
WP_043760121.1\|5685525_5686167_+	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	1.2e-44	48.8
WP_043760123.1\|5686181_5687057_+	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	2.0e-55	39.6
WP_052083761.1\|5687053_5687629_+	C40 family peptidase	F4YXU4	Roseobacter_phage	3.6e-29	48.2
WP_043760124.1\|5687616_5691525_+	glycoside hydrolase TIM-barrel-like domain-containing protein	A0A0B5A7K5	Paracoccus_phage	2.2e-178	35.6
WP_043760126.1\|5691543_5692800_+	DUF2793 domain-containing protein	A0A0K1LM54	Rhodobacter_phage	2.2e-39	44.9
WP_043761678.1\|5692839_5693373_-	lipase	NA	NA	NA	NA
WP_043760128.1\|5693486_5693996_+	hypothetical protein	X2CYK8	Brucella_phage	5.7e-10	39.0

Anti-CRISPR protein detection

Acr_ID: NZ_CP003811.1|WP_139237902.1|5425515_5425797_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP003811.1|WP_139237902.1|5425515_5425797_+|hypothetical-protein

5425515_5425797_+

93 aa aa

5375577-5439905

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP003811_2	Orphan	2.1\|4885733\|19\|NZ_CP003811\|CRT	4885733-4885751	19	5394046-5394064	2

1. spacer 2.1|4885733|19|NZ_CP003811|CRT matches to NZ_CP003811 position: 5394046-5394064, mismatch: 2

gcctggccaacagcggcgc	CRISPR spacer
gcttggccaagagcggcgc	Protospacer
**.******* ********

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP003811

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information