CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009455	Pseudomonas cremoricolorata strain ND07 chromosome, complete genome	1 crisprs	DinG,DEDDh,csa3,WYL,cas3	4	12	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009455_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009455_1

264150-264964

Orphan

Consensus_repeat	Method
CTGACCACCGCGCAAGTGGCGGC	CRISPRCasFinder

15 spacers

The CRISPR arrays of NZ_CP009455_1

>merge|NZ_CP009455|1|264150-264964|CRISPRCasFinder
TTGACCACCGCCCAGGTGGTCGCGCTGAGCACTGCCCAGGTGGCCGCGCTCAAGCCGACGCAGATCGCAGCCCTCACCACCACGCAAGTGGCGGCCTTGGAAAATGCCGACCTGGCAGCCCTGAGCAACCCACAACTGGTGGCCCTGACCACTGCCCAGGTCGCCGCACTGACCACCGCACAAGTGGCCGCGCTGAAACCGACGCAGATCGCTGCGATGGAAAACGCCGACATCGCTGCATTGACCACCGCTCAGGTGGTGGCGCTGACCACCGCGCAAGTGGCCGCGTTGACCACCGCCCAGGCCGCAGCGCTGACCACCACCCAAGTGGCCGCGCTGGAAACCGCCGACGTTGCGGCGTTGTCGCTGGCCAGCGTGGCGAGCCTGACCACCGCGCAGACCGCAGCACTGACCACGGCCCAAGTGGTGGCACTGACCACCGCGCAAGTGGCGGCGCTCAAGGTCACGCAGATCGCTGCGCTGACCACCACGCAAGTGGCGGCCATGGAAACCGCTGATGTCGCGGCGCTGACCAACGCTCAAGTGGTGGCGTTGACCACCGCCCAGGTGGCGGCGTTGACTACCGCGCAGATCGTCGCGCTCAAGGCGACCCAGTTCGCGGCCATGGAAACCGCTGACATCGCAGCGCTGACCACCGCGCAGATCATCGCCATCGAAACCACCGACATGGCCGCCCTGACCACCGCGCAAGTGGCCGCGCTGACCACCACCCAGGCGGCAGCCCTGACCACCGCGCAGTTGTCGCACCTGTCGATGACCCAGGTCGATGCCTTCACCACCGCGCAATTGCAGGC

>NZ_CP009455|1|1|264150-264964|CRISPRCasFinder
TTGACCACCGCCCAGGTGGTCGC	GCTGAGCACTGCCCAGGTGGCCGCGCTCAAGCCGACGCAGATCGCAGCC
CTCACCACCACGCAAGTGGCGGC	CTTGGAAAATGCCGACCTGGCAGCC
CTGAGCAACCCACAACTGGTGGC	CCTGACCACTGCCCAGGTCGCCGCA
CTGACCACCGCACAAGTGGCCGC	GCTGAAACCGACGCAGATCGCTGCGATGGAAAACGCCGACATCGCTGCA
TTGACCACCGCTCAGGTGGTGGC	GCTGACCACCGCGCAAGTGGCCGCG
TTGACCACCGCCCAGGCCGCAGC	GCTGACCACCACCCAAGTGGCCGCG
CTGGAAACCGCCGACGTTGCGGC	GTTGTCGCTGGCCAGCGTGGCGAGC
CTGACCACCGCGCAGACCGCAGC	ACTGACCACGGCCCAAGTGGTGGCA
CTGACCACCGCGCAAGTGGCGGC	GCTCAAGGTCACGCAGATCGCTGCG
CTGACCACCACGCAAGTGGCGGC	CATGGAAACCGCTGATGTCGCGGCG
CTGACCAACGCTCAAGTGGTGGC	GTTGACCACCGCCCAGGTGGCGGCG
TTGACTACCGCGCAGATCGTCGC	GCTCAAGGCGACCCAGTTCGCGGCCATGGAAACCGCTGACATCGCAGCG
CTGACCACCGCGCAGATCATCGC	CATCGAAACCACCGACATGGCCGCC
CTGACCACCGCGCAAGTGGCCGC	GCTGACCACCACCCAGGCGGCAGCC
CTGACCACCGCGCAGTTGTCGCA	CCTGTCGATGACCCAGGTCGATGCC
TTCACCACCGCGCAATTGCAGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009455.1\|WP_038410719.1\|251345_255245_-\|phosphoribosylformylglycinamidine-synthase	unknown	unknown	gnl\|CDD\|235394
NZ_CP009455.1\|WP_038410725.1\|267785_268664_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293825
NZ_CP009455.1\|WP_038410729.1\|274545_277707_+\|multidrug-efflux-RND-transporter-permease-subunit-TtgB	unknown	unknown	gnl\|CDD\|273335
NZ_CP009455.1\|WP_038410724.1\|265931_267779_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|226428
NZ_CP009455.1\|WP_049870402.1\|268835_269768_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP009455.1\|WP_038410717.1\|250346_250973_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP009455.1\|WP_038410718.1\|251031_251343_-\|NGG1p-interacting-factor-3-protein,-NIF3	unknown	unknown	gnl\|CDD\|225860
NZ_CP009455.1\|WP_156109557.1\|271054_272455_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP009455.1\|WP_038410721.1\|257163_257643_-\|tRNA-adenosine(34)-deaminase-TadA	unknown	unknown	gnl\|CDD\|223663
NZ_CP009455.1\|WP_038410730.1\|277703_279155_+\|AdeC/AdeK/OprM-family-multidrug-efflux-complex-outer-membrane-factor	unknown	unknown	gnl\|CDD\|273830
NZ_CP009455.1\|WP_038410716.1\|249734_250316_+\|aminodeoxychorismate/anthranilate-synthase-component-II	unknown	unknown	gnl\|CDD\|223586
NZ_CP009455.1\|WP_038410715.1\|248268_249738_+\|anthranilate-synthase-component-I-family-protein	unknown	unknown	gnl\|CDD\|223225
NZ_CP009455.1\|WP_038410723.1\|259166_259769_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|226975
NZ_CP009455.1\|WP_049870403.1\|272456_273131_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182632
NZ_CP009455.1\|WP_038410731.1\|279381_280302_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP009455.1\|WP_038410722.1\|257642_259025_-\|multicopper-oxidase-family-protein	unknown	unknown	gnl\|CDD\|225043
NZ_CP009455.1\|WP_038410728.1\|273384_274542_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|380145
NZ_CP009455.1\|WP_038410726.1\|269777_270647_-\|oxaloacetate-decarboxylase	unknown	unknown	gnl\|CDD\|225311
NZ_CP009455.1\|WP_038410720.1\|255519_256974_+\|membrane-bound-lytic-murein-transglycosylase-MltF	unknown	unknown	gnl\|CDD\|236778
NZ_CP009455.1\|WP_049870401.1\|245204_247256_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369266

Protein	Function_ID	Function_description	E-value
NZ_CP009455.1\|WP_038410719.1\|251345_255245_-\|phosphoribosylformylglycinamidine-synthase	gnl\|CDD\|235394	PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional.	0
NZ_CP009455.1\|WP_038410725.1\|267785_268664_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293825	cd07739, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.364e-93
NZ_CP009455.1\|WP_038410729.1\|274545_277707_+\|multidrug-efflux-RND-transporter-permease-subunit-TtgB	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP009455.1\|WP_038410724.1\|265931_267779_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|226428	COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].	2.91726e-147
NZ_CP009455.1\|WP_049870402.1\|268835_269768_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.8584e-79
NZ_CP009455.1\|WP_038410717.1\|250346_250973_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	8.12646e-33
NZ_CP009455.1\|WP_038410718.1\|251031_251343_-\|NGG1p-interacting-factor-3-protein,-NIF3	gnl\|CDD\|225860	COG3323, COG3323, Uncharacterized protein conserved in bacteria [Function unknown].	3.86593e-44
NZ_CP009455.1\|WP_156109557.1\|271054_272455_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.961e-65
NZ_CP009455.1\|WP_038410721.1\|257163_257643_-\|tRNA-adenosine(34)-deaminase-TadA	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	2.03223e-63
NZ_CP009455.1\|WP_038410730.1\|277703_279155_+\|AdeC/AdeK/OprM-family-multidrug-efflux-complex-outer-membrane-factor	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	4.32498e-134
NZ_CP009455.1\|WP_038410716.1\|249734_250316_+\|aminodeoxychorismate/anthranilate-synthase-component-II	gnl\|CDD\|223586	COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism].	3.03751e-87
NZ_CP009455.1\|WP_038410715.1\|248268_249738_+\|anthranilate-synthase-component-I-family-protein	gnl\|CDD\|223225	COG0147, TrpE, Anthranilate/para-aminobenzoate synthases component I [Amino acid transport and metabolism / Coenzyme metabolism].	2.98298e-138
NZ_CP009455.1\|WP_038410723.1\|259166_259769_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|226975	COG4627, COG4627, Uncharacterized protein conserved in bacteria [Function unknown].	7.77936e-11
NZ_CP009455.1\|WP_049870403.1\|272456_273131_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|182632	PRK10668, PRK10668, DNA-binding transcriptional repressor AcrR; Provisional.	3.68885e-66
NZ_CP009455.1\|WP_038410731.1\|279381_280302_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.43928e-36
NZ_CP009455.1\|WP_038410722.1\|257642_259025_-\|multicopper-oxidase-family-protein	gnl\|CDD\|225043	COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism].	8.89839e-87
NZ_CP009455.1\|WP_038410728.1\|273384_274542_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|380145	NF000247, MexA, MexA family multidrug efflux RND transporter periplasmic adaptor subunit.	1.12142e-156
NZ_CP009455.1\|WP_038410726.1\|269777_270647_-\|oxaloacetate-decarboxylase	gnl\|CDD\|225311	COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism].	4.65486e-79
NZ_CP009455.1\|WP_038410720.1\|255519_256974_+\|membrane-bound-lytic-murein-transglycosylase-MltF	gnl\|CDD\|236778	PRK10859, PRK10859, membrane-bound lytic murein transglycosylase MltF.	0
NZ_CP009455.1\|WP_049870401.1\|245204_247256_+\|hypothetical-protein	gnl\|CDD\|369266	pfam07217, Het-C, Heterokaryon incompatibility protein Het-C. In filamentous fungi, het loci (for heterokaryon incompatibility) are believed to regulate self/nonself-recognition during vegetative growth. As filamentous fungi grow, hyphal fusion occurs within an individual colony to form a network. Hyphal fusion can occur also between different individuals to form a heterokaryon, in which genetically distinct nuclei occupy a common cytoplasm. However, heterokaryotic cells are viable only if the individuals involved have identical alleles at all het loci.	4.60237e-36

>NZ_CP009455.1|WP_038410723.1|259166_259769_-|methyltransferase-domain-containing-protein
MKTFLHVGCGPKNKSGTTKGFATDDWQELRFDIDQSVNPDILGTMTDMSQVPDASVDALFSSHNIEHLYPHEVPVALAEFKRVLKPGGFVVITCPDLQSVCALVAEDKLTDEAYRSPAGPIAPIDILYGHRPAMANGNLYMAHRCGFTKKVLTASLQAAGFDMVLPIQRAYPAFDLWAVAALAPINEQQVVEIAQQHFPD
>NZ_CP009455.1|WP_038410722.1|257642_259025_-|multicopper-oxidase-family-protein
MSVTRRQMLMGLSGLVVVGLGAGGAARYWLGKVEDDNAGHDYELIAAPLDVELVPGFKTQAWAFGPSAPGTELRVRQGTWLRVRFINHLPVETTIHWHGIRLPLEMDGVPYVSQLPVKPGEYFDYKFRVPDAGSYWYHPHVSSSEELGRGLVGPLIVEEREPTGFAHERTLSLKTWHVDEQGAFMPFSVPREAARNGTAGRLITINGAADAVTELPAGQVVRVRLLNLDNTWTYRINLRGNCEARIYALDGNPITPRPLEDDYWLGPGMRICLAIRIPQAGEEISLRDGFVRLGTLRSVPSEQAPGDWPKALPANPIAEPDLDNAEKLNFNFEWAGKVSVDTDNGRPPSLWQINGQAWDITDKTCADRPIATLQKGKSYIFELKNMTQYQHPIHLHGMSFKVINSNRHEIREPWFTDTYLLGKNERAQVALVADNPGTWMFHCHVIDHMETGLMAAIAVV
>NZ_CP009455.1|WP_038410721.1|257163_257643_-|tRNA-adenosine(34)-deaminase-TadA
MRPQIIDRSRDQAFMRLALALAAEGAALGEVPVGAVLVHDGEVIGQGFNRPILDSDPSAHAEMVAIRAAAQAASNYRLPGSTLYVTLEPCSMCAGLIVHARVARVVYGASEPKAGVVQSQGQFFAQGFLNHRVMVEGGVLAEDCGRVLSEFFKARRGKG
>NZ_CP009455.1|WP_038410720.1|255519_256974_+|membrane-bound-lytic-murein-transglycosylase-MltF
MFAQTALRQRCARWLIATGLLLMLGACVEKPSTLERVKDDGVLRVVTRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFSQLGSPSGPVLAAAGLVSSEKRTTQARFSHPYLQVTPQVIYRNGRPRPTQPSGLVGKKIMVLKGSSHAEQLAALKQQYPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFSNVRVAFDLGDTRDQRWAVAAGEDDSLLNKVNDFIDKAQKDGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKASAKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGISNRLDARQSIQGGAKYFMLVKDQLDDSIKEPDRTWFALAGYNVGSGHLEDARTLAKREGLNPNKWLDVKKMLPRLAQKQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQPGEGGLHVPGVNKDKPADAAQP
>NZ_CP009455.1|WP_038410719.1|251345_255245_-|phosphoribosylformylglycinamidine-synthase
MLILRGAPALSAFRHGKLLEQLSQKVSAVTGLYAEFAHFADVEGELGTDQQQVLGRLLKYGPSVPVQEPAGRLFLVVPRLGTISPWASKATDIAHNCGLQSIQRLERGIAYYVAGELSEADAALVAAELHDRMTQRVLNRLQDAADLFSHAEPRPMTSVDVLGGGRAALAQANLDLGLALADDEIDYLVEAFQGLQRNPNDIELMMFAQANSEHCRHKIFNATWDIDGQAQEKSLFGMIKNTYQMHNEGVLSAYKDNASVIIGNVAGRFFPNPETRQYGAVQEPVHILMKVETHNHPTAIAPFSGASTGSGGEIRDEGATGRGAKPKAGLTGFSVSNLRIPGFAQPWEQAYGKPERIVDALDIMIEGPLGGAAFNNEFGRPALTGYFRTFEQAISTPHGDEVRGYHKPIMLAGGMGNIREDHVQKGEITVGAKLIVLGGPAMLIGLGGGAASSVATGASSADLDFASVQRENPEMERRCQEVIDRCWQLGDANPIAFIHDVGAGGISNALPELVNDGGRGGRFELRNVPNDEPGMAPHEIWSNESQERYVLAVSSEHFERFQAICERERCPFAVVGEATEEPHLTVTDSHFDNTPVDMPLDVLLGKPPRMHRSVSREAELGDAFDPAALALQDSIERVLHHPAVASKSFLITIGDRTITGLVARDQMVGPWQVPVADCAVTATSFDVYTGEAMAMGERTPLALLDAPASGRMAIGETITNLAAARIGKLSDIKLSANWMSAAGHPGEDARLYDTVKAVGMELCPELGITIPVGKDSMSMKTQWSEAGQDKSVTSPLSLIITGFAPVSDVRQTQTPQLRMDKGETDLILIDLGRGQNRMGASILAQTHGKLADKAPDVDNAEDLKAFFAVIQGLNADGHLLAYHDRSDGGLMTTVLEMAFAGHCGLNLDLKTLTGSVDKACAVLFNEELGAVIQVRRDSTPVVLSQFSAAGLGENCAAVIGQPINNNDIYVRLGDEVLYSGKRSTLQRQWAETSYQIQRLRDNADCAEQEFDALLEEDNPGLSVKLGYDVNEDVAAPYIKKGVRPQVAILREQGVNGQVEMAAAFDRAGFAAIDVHMSDILAGRVDFEAFKGLVACGGFSYGDVLGAGEGWAKSALFNSRARDAFQAFFERSDSFALGVCNGCQMMSNLHELIPGTEYWPHFVRNRSEQFEARVAMVEVQKSNSIFLDGMAGSRMPIAIAHGEGHAEFASEQALQAADASGCVALRFVDNHGKVTETYPANPNGSPRGITGLTSRDGRVTIMMPHPERVFRAVQNSWRPDEWQEDAALMRMFRNARVWVD
>NZ_CP009455.1|WP_038410718.1|251031_251343_-|NGG1p-interacting-factor-3-protein,-NIF3
MYKLAFFVPDSHVEQVKAAVFAAGGGRIGDYEHCAWQTLGQGQFRPMQGSQPFIGRAGEVEVLEEWKVELVVADEAITAVIDALRQHHPYETPAYEVQPLLDI
>NZ_CP009455.1|WP_038410717.1|250346_250973_+|LysE-family-translocator
MFPMKIWLAYTTACLLLVLSPGPDNLLAIGRGLSQGRLAALVSGVSSGMGIVFHITTAALGLTLLIKTSEVAFWVVKLIGAGYLLWLGVKVLRSRSLVTFTATAQQPLRTIFLTGFLSAALNPKPGLFVLAFIPQFVDPVLGSVTVQMLVYGLWFALLTAVGFALMGVFATRLSGCIKARPRLADGLNMGAGMTFIAAGLSIAALSQK
>NZ_CP009455.1|WP_038410716.1|249734_250316_+|aminodeoxychorismate/anthranilate-synthase-component-II
MNVFLIDAYDSFVFIISQYLEQLGLETRVERHDTPDLIERIEAFAPDFCVLGPGPGHPADVGYIELIRYFEGRLPLLGVCLGHQALGLAYGAQVGRAPHVMHGKVSTIVNDGKGVYAHTGGQPIQATRYHSLMILDQALPECLEVSSRSTDDNYIMGVRHRSLAVEGVQFHPESILTENGLELFRSFIRQYVQ
>NZ_CP009455.1|WP_038410715.1|248268_249738_+|anthranilate-synthase-component-I-family-protein
MTIHSIAVDVLRREERRPTDALAVYAQATQQLGDASVFILESLSGPSRDRRATIIGLEPLLEVCIDEDRAWLRGCAQLCEHLYASLRQRGVSIDASLNIALPDRDAAWDLLRQVQACFEPAHQAPGSLAFFGYFSYDCVRLIERLPDHTEKTHHYPLIALSVYQTLVYLHSNGTVETLINNHPLWPTRSLEDYPFLHAQAPATSHSAPLYPQVFEETRSVSIEQFLQRVNVAMEHIRAGDVYQIQLGHEICIRSTVTPFEVYKSLRQRNPSPYMYLAHVGGIDLIGASPELFVRIKDDLIEMRPIAGTVGKKPGVDPTELVRELTRSEKEGAEHLMLIDLCRNDIGRVCQAGSLEVDEFMRVEEYSHLYHMVSNVRGLMRPGLDAYDVIKASFPAGTMSGAPKVRAMQLIEGMESNRRGIYAGALGLIGFDGSVNTALCIRSTVHDQGTYHLRASAGVVADSVAELEWKETLYKMGSVYRAVTGQEIAL
>NZ_CP009455.1|WP_049870401.1|245204_247256_+|hypothetical-protein
MHDTPSFHSRFALEQLQRIAAQFSAKSFEALTVAVFGRRVSAEQYLKLHSDLLADALPNPGYRVLDDSDASGAVYDPADGTIQLPRSVIEQALQDSQASAPLLVSLIEAFGDYLRTGLHDSDIDQAAAVDALFEPSEPSTAGQRYAVFALVHDPVVQGELAFAEYTSSELTANLILTLPTNSAAPSEVDTVDAAPALLASRLFGAGEGNGTHSFGHGRIAKALGNVGFTREQIDAIYFGNWLRDYSQLVDPKIVRTQDAPKDFPSKLSREVLTEVVDLLALKEFHHLQQDDRGRAFYTVTPQVLGVYKPSEHIDNPLTLDADAKDPRSIDPDFEPLVLADSPQAQIDEQRAMRRHIDDAVDFMYNKMIEAMSEGPTPKGLREFGAGLHTLEDFFAHSNFVELSLRKVGHDKVLPWVCGVESQREHPVITGLFGGLDVLASVAEPMAKVLFPANGHIYKPIEPGARSDQEQMLLILLKEHPNPKLREDLVTALEFRDKLADNPLLKYSALAKWALTLPLALLGSAQDVVLKNLLTWAGDQIDDIQTLLQNDPNVKPGTYATHSQLAKDHDTHPFHELAALLAAYAVERVGWSMHAYWAGDHDRDPATVAKSFIGHPDVDDWQDEIVATWANAHPDAITAGESADELTRRKREISEQGRARLKEMDQKHSLNIIDVTEAGAGLIG
>NZ_CP009455.1|WP_038410724.1|265931_267779_+|tetratricopeptide-repeat-protein
MPTDILHSPDLDAVLAAALQLAERAALEPMRLLETAERLNAAQRPRDVAVLYQHWLRHCHSSVNYIIQFNLGATLTGLGELAEAEHAYRAAIAQNPQFAQAWFNLGALQERQQQSQQALATWQTMLDQRLVEAEHSRELYLMTCNALGRLSEETRAFAAAETALQASLIAAPAQPKVIQHWLHLRQKQCVWPAFTTLPGVTAGELLKAASPLALLAASDDPGLQLAAAMRFVRERVRQSGVALAPAQGYAHTKLRIGFLSSDFCLHAVSLLTVELFELIDRSQFEVYGFCWSREDGSALRQRVRQAMDHFVPIGALDDNAAANCIRSHEIDILIDLHGLTAGARPDIPAQRPAPVQMTYLGFPGSTGLPGIDYVIADQYLIPDREKPYYSETPLYLAQIYQCSDRQRPVAELPSRADCGLPAERFVFCSFNNNYKFNEAVFDCWMRILKRTPGSVLWLLADNPWAQGNLCARAAEQGVDAQRLLFAPRVAPAQYLARYSAADLFLDTYPFNAGTTANDALWMGLPVLTRSGRTFASRMAGSLLTALGLPELICQSLQAYEDRAVELASDPQRLASLRQRLRAGRESSVLFDTPRFVRDFEDALKRVAVRQPPAQD
>NZ_CP009455.1|WP_038410725.1|267785_268664_-|MBL-fold-metallo-hydrolase
MPLRAVLGRLLLACCLVSTPLLAAEPLQLEVYNPGKDALFPVSSVIISGKRDALLIDAQFGKTQARQLVRRLKASGKRLKAIYISHGDPDYYFGLYTVLRAFPRTPVLASPATAKYIRKTMNAKRLFWGPKLGADAPERLIAPKVLKGDRLILEGQAIQVVGLDGPQAERSFVWIPSIAAVAGGVVVSQGLHVWMADTQSAQSHVDWLSTLERIESLQPRTVIPGHYLGESTRDVRAVQFTAQYIRDFDDEASKARDAVELIAAMKLRYPRLADDSALELSAKVAKGEMSWP
>NZ_CP009455.1|WP_049870402.1|268835_269768_+|LysR-family-transcriptional-regulator
MDRLTAMRVFVSVVDLGSQSAAAEHLHLSRPVVSRYLAELEGWVGARLMQRTTRKLSLTAAGAQTLPRCRQLLELAGDLQMAVQRPDDTPHGTLRISVSSSFGQAQLIDAVVDYAQRYPAVKVELQMLDRTVDLVEERIDLAVRSCHVLDPGLIARPLTLCRSVVCASPAYLKAHGMPLHVEELAQHNCLTHTYFSNARWYFEVDGEPLEVAVKGNISCNEAISLQKAAVLGAGIALLPAYLAAPALRSGELISVLPQAKPRELMLNAVYTSRKHMPAALRSMLDFLVERFADGSPWSLTAQEHVPGSGE
>NZ_CP009455.1|WP_038410726.1|269777_270647_-|oxaloacetate-decarboxylase
MPKASHHDLRIAFRDLLASQSCYHTASVFDPMSARIASDLGFEVGILGGSVASLQVLAAPDFALITLSEFVEQATRIGRVAQLPFLADADHGYGNALNVMRTVIELERAGVSALTIEDTLLPAQFGRKSTDLISVDEGVGKIRAAIEARVDSAMAIIGRTNAGVLSTEEVIHRTQSYQKAGADGICMVGIKDFDHLEQISSHLSVPLMLVSYGNPNLRDDQRLAELGVRIVVDGHAAYFAAIKATYDCLRLQRGQQNKSENLSATELSHTYTQPEDYIRWAKEYMNVEE
>NZ_CP009455.1|WP_156109557.1|271054_272455_+|MFS-transporter
MLAILLGALDQTIVAVSLPAISAQFNDVGLLAWVISAYLVAMTVAVPIYGKLGDLYGRRRMILTGTALFTLASVGCALAQSMEQLVLARVLQGLGAGGMVSVSQAIIGDYVPPRERGRYQGYFSSMYALASVAGPVLGGWLTAYLSWHWVFWINLPLGLVALWAIHRALGGLPVKRRKAQVDYLGGVLMIIGVGSLLLAISLVGQGSAWGSPAVLALLAGAVLGLLALVAHERRCAEPLLPLQLFSNRVAVLCWCVIFFASFQAISLTMLMPLRYQAITGAGADSAALHLLPLAMGLPVGAFTGGRLTSRTGRYKPQILAGAVLMPLAILGMALSPPQAVWFSGVFMLLAGIAGGLQFPTSLVGTQSAVEHRDMGVATSTTNLFRSLGGAMGVAIMSSLLLALLQHDGVALLDNPLLGSLNDDGVSAQTQAQLLRVFRDVLLGSAGVAAVALFAALALPDRQLRGR
>NZ_CP009455.1|WP_049870403.1|272456_273131_-|TetR-family-transcriptional-regulator
MVRRTKEEAQETRAQIIAAAEKAFYRRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDMLHETHDHLARASESEDELDPLGCMRTLLLQVLDEVVLDARTRRINEILHYKCEFTDDMCEIRQQRQRAVLDCHNSIVVAMANAVRRGQLPPELDPEQAAVVLFAYFDGLIGRWLLLPGSFDLQGQGERWVDAGLDMLRLSPALRKHGFVNDCEGSASRL
>NZ_CP009455.1|WP_038410728.1|273384_274542_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MHFKPAVTALVSAVALATLLSGCKKEEAPPAAQPAPQVGVITLQPQAFTLTSELPGRTSAFRVAEVRPQVNGIILKRLFKEGSDVKQGQQLYQIDPAVYETTLATAQANLQATRSLAGRYKQLIDEQAVSRQEYDDANAKRLQAEASLKSAQIDLRYTKVLAPISGRIGRSAVTEGALVSNGQANAMATIQQLDTIYVDVTQSTAELLKLRRDLASGQLQKAGDNAAQVQLVLEDDSLFKHQGRLEFSEVAVDETTGSVTLRAVFPNPEHELLPGMFVHARLKAGVNANAILAPQQGVTRDLKGTPTALVVNQDNKVELRELKASRTLGSDWLIEEGLNPGDRLITEGLQYVRPGVEVKVSEASNLKKPNSPDQAKAADADAKAE
>NZ_CP009455.1|WP_038410729.1|274545_277707_+|multidrug-efflux-RND-transporter-permease-subunit-TtgB
MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYPSIAPPAIAIAVTYPGASAQTVQDTVVQVIEQQLNGIDNLRYVSSESNSDGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFLMVIGLVSEDGSMTKDDLANYIVSTMQDPISRTAGVGDFQVFGAQYAMRIWLDPAKLNKYQLTPVDVRTAVTAQNVQVSSGQLGGLPAMPGTQLNATIIGKTRLQTAEQFEKILLKVNSDGSQVRLRDVAKVGLGGENYSVSAQFNGKPASGMAIKLATGANALDTAKALRQTISDLEPFFPPGMKAVFPYDTTPVVTESISGVIHTLIEAVVLVFLVMYLFLQNFRATIITTMTVPVVLLGTFGILAAFGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMSEEGLPPKAATKKSMEQIQGALVGIALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGLSVLVALVFTPALCATMLTPLKKGEHHHAKGGFFGWFNRSFDRSVQGYERSVGFVLRRKIPFLLAYALIVVGMVLLFNRIPAAFLPEEDQGVLFAQVQTPAGSSAERTQDVVDQMRSYLLKDESDTVSSVFTVTGFNFAGRGQSSGMAFIMLKPWGERSAENSVFNLATRAQQHFFTFRDAMVFAFAPPAVLELGNASGFDVFLQDRAGVGHEKLMEARNQFLAKASQSKILAGVRPNGLNDEPQYQLIVDDERASALGVTIADINNTLSIALGGSYVNDFIDRGRVKKVYIQGQSSARMSPEDLQKWYVRNGQGEMVPFSSFASGEWTYGSPKLSRYNGVEAVEVLGTPAPGYSTGEAMAEVERIAGELPDGIGYAWTGMSYEEKLSGSQMPALFALSILFVFLCLAALYESWSIPIAVVLVVPLGIIGALIATSLRGLSNDVYFLVGLLTTIGLAAKNAILIVEFAKELHEQGRSLYDATIEACRMRLRPIIMTSLAFILGVVPLTIASGAGSGSQHAIGTGVIGGMISATVLAIFWVPLFFVAVSSVFGGSKRKTDEHSEHPVTPRNEAGQ
>NZ_CP009455.1|WP_038410730.1|277703_279155_+|AdeC/AdeK/OprM-family-multidrug-efflux-complex-outer-membrane-factor
MTKSLLSLAVTAFILGGCSLIPDYQTPEAPVAAQWPQGPAYSPAESADVAAAEQGWRQFFTDRALQQLIQTGLENNRDLRVAALNIDAYRAQYRIQRADLFPAVSANGSGSRQRVPADLSQTGRAGITSQYSATVGVSAYELDLFGRVRSLSQQALEIYLSSEEARRSTQIALVASIANAYYTWQADQDLLKLTKDTLDAYEQSFNLTRRSSEVGVASALDLSQARTAVEGARVKLAQYQRLVAQDLNSLTVLIGTGVPSNLPAPLKLDADQLAEVPAGLPSDLLQRRPDIQEAEHLLKAANANIGAARAAFFPSISLTANAGTLSPDMSGLFSAGSGTWLFQPQINLPIFNAGALRASLDYAKIQKDINVAKYEKTIQTAFQEVADGLAARKTFEEQLQAQRDLVAANQDYYRLAERRYRIGIDSNLTFLDAQRTLFSAQQALISDRLSQLTSEVNLYKALGGGWYERTGQAQQASVQTPKG
>NZ_CP009455.1|WP_038410731.1|279381_280302_+|LysR-family-transcriptional-regulator
MDLRQLRYFIALTDYRSFVRAADAMGITQPAFSRAIQNLEQTLGCQLIDRANKTLAPTAQGLVVLQHARRLVQGAAQLSNEVLQMSAVDAGELHFGCGPAMAVSLVPQALTQLMGERPGIHTRLLTAAPERLGEALRREQIEFFVDDLRPFEADPYFHTQPLQARAGTFFCRAGHPLLRKDSLSTNELFDYPLVSHWLAPGVRKYLANLSGRSDLRLQVQCEDFNVVRSVVLGSDAIGCASTQALAQDLAARTLVTLHWRNLPPRLDLLSVRCGVISRSGYQLSPAARALIDTLLVVDAQPTPERV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP009455.1	261581-261605	0	1.0
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP009455.1	261701-261725	1	0.96
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP009455.1	260525-260549	2	0.92
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP009455.1	261869-261893	2	0.92
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP009455.1	262637-262661	2	0.92
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP009455.1	264053-264077	2	0.92
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP009455.1	261581-261605	2	0.92
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP009455.1	264053-264077	2	0.92
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP009455.1	261773-261797	2	0.92

1. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to position: 261581-261605, mismatch: 0, identity: 1.0

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaagtggccgcg	Protospacer
*************************

2. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to position: 261701-261725, mismatch: 1, identity: 0.96

cctgaccactgcccaggtcgccgca	CRISPR spacer
cctgaccactgcccaggttgccgca	Protospacer
******************.******

3. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to position: 260525-260549, mismatch: 2, identity: 0.92

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaagtcgcggcg	Protospacer
****************** ** ***

4. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to position: 261869-261893, mismatch: 2, identity: 0.92

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaaatcgccgcg	Protospacer
****************.* ******

5. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to position: 262637-262661, mismatch: 2, identity: 0.92

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgacgaccgcgcaggtggccgcg	Protospacer
****** ********.*********

6. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to position: 264053-264077, mismatch: 2, identity: 0.92

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcccaggtggccgcg	Protospacer
************ **.*********

7. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to position: 261581-261605, mismatch: 2, identity: 0.92

gctgaccaccacccaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaagtggccgcg	Protospacer
**********.* ************

8. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to position: 264053-264077, mismatch: 2, identity: 0.92

gctgaccaccacccaagtggccgcg	CRISPR spacer
gctgaccaccgcccaggtggccgcg	Protospacer
**********.****.*********

9. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to position: 261773-261797, mismatch: 2, identity: 0.92

catggaaaccgctgatgtcgcggcg	CRISPR spacer
catggagactgctgatgtcgcggcg	Protospacer
******.**.***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	92004-92028	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	563024-563048	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	92004-92028	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1795841-1795865	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	67010-67034	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1106012-1106036	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1942227-1942251	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	82074-82098	2	0.92
NZ_CP009455_1	1.2\|264245\|25\|NZ_CP009455\|CRISPRCasFinder	264245-264269	25	NZ_CP020698	Sulfitobacter sp. D7 plasmid p4SUD7, complete sequence	17991-18015	3	0.88
NZ_CP009455_1	1.2\|264245\|25\|NZ_CP009455\|CRISPRCasFinder	264245-264269	25	NZ_CP049815	Monaibacterium sp. ALG8 plasmid unnamed4, complete sequence	17877-17901	3	0.88
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	43068-43092	3	0.88
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NC_018532	Arthrobacter sp. Rue61a plasmid p232, complete sequence	79642-79666	3	0.88
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70046-70070	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	605285-605309	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	39503-39527	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	47201-47225	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	40874-40898	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	1522-1546	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	23874-23898	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	40859-40883	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	84671-84695	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65160-65184	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	66096-66120	3	0.88
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	66681-66705	3	0.88
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	69878-69902	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	92820-92844	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	47842-47866	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	49097-49121	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	42770-42794	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	42755-42779	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	86567-86591	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	37607-37631	3	0.88
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	21978-22002	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	67041-67065	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	67689-67713	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	68678-68702	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	69734-69758	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65400-65424	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	64992-65016	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP014797	Salipiger profundus strain JLT2016 plasmid pTPRO1, complete sequence	223897-223921	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	56901-56925	3	0.88
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP018236	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8	35502-35526	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	90060-90084	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	92196-92220	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	92820-92844	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70214-70238	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	64824-64848	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70598-70622	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1356032-1356056	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	134975-134999	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	618541-618565	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	958161-958185	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	615018-615042	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	36959-36983	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	37535-37559	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	49169-49193	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	49745-49769	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	42842-42866	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	43418-43442	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	1306-1330	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	1930-1954	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	2122-2146	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	3490-3514	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	4066-4090	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	21330-21354	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	21906-21930	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	42827-42851	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	43403-43427	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	45898-45922	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	46474-46498	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	47842-47866	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	48034-48058	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	48658-48682	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	642248-642272	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	183723-183747	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1170830-1170854	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	86639-86663	3	0.88
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	87215-87239	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NC_047973	Microbacterium phage Hyperion, complete genome	29917-29941	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	597527-597551	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1194798-1194822	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	403581-403605	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	147867-147891	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	461868-461892	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	959479-959503	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1669801-1669825	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	755770-755794	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1854420-1854444	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	268277-268301	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	268277-268301	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	480057-480081	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	238149-238173	3	0.88
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	883974-883998	3	0.88
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65568-65592	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	68870-68894	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	69518-69542	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	69974-69998	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70430-70454	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70694-70718	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	32622-32646	4	0.84
NZ_CP009455_1	1.3\|264293\|25\|NZ_CP009455\|CRISPRCasFinder	264293-264317	25	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	27582-27606	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	38351-38375	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	48353-48377	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	42026-42050	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	2674-2698	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	22722-22746	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	42011-42035	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	85823-85847	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	64824-64848	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65136-65160	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65544-65568	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	66777-66801	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	68414-68438	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	69470-69494	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70526-70550	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	452199-452223	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NC_047914	Faecalibacterium phage FP_Taranis, complete genome	21492-21516	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65136-65160	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	65544-65568	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	66192-66216	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	66777-66801	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	67185-67209	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	67833-67857	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	68414-68438	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	68822-68846	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	69470-69494	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70526-70550	4	0.84
NZ_CP009455_1	1.6\|264461\|25\|NZ_CP009455\|CRISPRCasFinder	264461-264485	25	NZ_CP020084	Blastomonas fulva strain T2 plasmid unnamed, complete sequence	7051-7075	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1329560-1329584	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1251321-1251345	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1314645-1314669	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1250343-1250367	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1251313-1251337	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1250668-1250692	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1251304-1251328	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1329700-1329724	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1329683-1329707	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1329668-1329692	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NC_011667	Thauera sp. MZ1T plasmid pTha01, complete sequence	52195-52219	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	102893-102917	4	0.84
NZ_CP009455_1	1.7\|264509\|25\|NZ_CP009455\|CRISPRCasFinder	264509-264533	25	MN857473	Teseptimavirus S2B, complete genome	8865-8889	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	90132-90156	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	45970-45994	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	47801-47825	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	41474-41498	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	41459-41483	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	85271-85295	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	38903-38927	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	23274-23298	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020984	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6990 plasmid pA, complete sequence	37385-37409	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020984	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6990 plasmid pA, complete sequence	38507-38531	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	3418-3442	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021008	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pA, complete sequence	38993-39017	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021008	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pA, complete sequence	40115-40139	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021019	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pA, complete sequence	25302-25326	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021019	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pA, complete sequence	26424-26448	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020999	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6165 plasmid pA, complete sequence	30072-30096	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021002	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pA, complete sequence	39386-39410	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021002	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pA, complete sequence	40508-40532	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020965	Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pA, complete sequence	24704-24728	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	CP021013	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pA, complete sequence	21992-22016	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	CP021013	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pA, complete sequence	23114-23138	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020988	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6994R plasmid pA, complete sequence	46591-46615	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020988	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6994R plasmid pA, complete sequence	47713-47737	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NC_022539	Xanthomonas citri pv. fuscans plasmid pla, complete sequence	41344-41368	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NC_022539	Xanthomonas citri pv. fuscans plasmid pla, complete sequence	44302-44326	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020986	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6992 plasmid pA, complete sequence	24211-24235	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020986	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6992 plasmid pA, complete sequence	25333-25357	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020993	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pA, complete sequence	41632-41656	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020993	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pA, complete sequence	42754-42778	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021017	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pA, complete sequence	43916-43940	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP021017	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pA, complete sequence	45038-45062	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020982	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6989 plasmid pA, complete sequence	52846-52870	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020982	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6989 plasmid pA, complete sequence	53968-53992	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020990	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6996R plasmid pA, complete sequence	12153-12177	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020990	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6996R plasmid pA, complete sequence	13275-13299	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020976	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pA	21916-21940	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020980	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6988R plasmid pA, complete sequence	41825-41849	4	0.84
NZ_CP009455_1	1.8\|264557\|25\|NZ_CP009455\|CRISPRCasFinder	264557-264581	25	NZ_CP020980	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6988R plasmid pA, complete sequence	42947-42971	4	0.84
NZ_CP009455_1	1.9\|264605\|25\|NZ_CP009455\|CRISPRCasFinder	264605-264629	25	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	818000-818024	4	0.84
NZ_CP009455_1	1.9\|264605\|25\|NZ_CP009455\|CRISPRCasFinder	264605-264629	25	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	1063078-1063102	4	0.84
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	67329-67353	4	0.84
NZ_CP009455_1	1.10\|264653\|25\|NZ_CP009455\|CRISPRCasFinder	264653-264677	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70382-70406	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	90876-90900	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047266	Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence	70430-70454	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	37775-37799	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	48929-48953	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	42602-42626	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	3250-3274	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	3826-3850	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	22146-22170	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	42587-42611	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	46138-46162	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	46714-46738	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	49162-49186	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	86399-86423	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP016618	Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence	372120-372144	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	310910-310934	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MT889368	Gordonia phage Sam12, complete genome	49338-49362	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MT114160	Gordonia phage Breezic, complete genome	49621-49645	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MT889370	Gordonia phage GourdThymes, complete genome	50204-50228	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MK433261	Gordonia phage Msay19, complete genome	51918-51942	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MT889379	Gordonia phage Diabla, complete genome	51687-51711	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MG757155	Gordonia phage Boneham, complete genome	51629-51653	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MK433265	Gordonia phage Exiguo, complete genome	49338-49362	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_048820	Gordonia phage Jellybones, complete genome	51304-51328	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_009935	Pseudomonas phage LKD16, complete genome	25614-25638	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MT740728	Ralstonia phage Anchaing, complete genome	10048-10072	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MG770211	Gordonia phage Flakey, complete genome	50202-50226	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MK433263	Gordonia phage FelixAlejandro, complete genome	52032-52056	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MG757152	Gordonia phage Adgers, complete genome	50064-50088	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MN945905	Gordonia phage John316, complete genome	51367-51391	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MK359302	Gordonia phage Sombrero, complete genome	49905-49929	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_047892	Gordonia phage BirksAndSocks, complete genome	51728-51752	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	FN263372	Pseudomonas phage phikF77, complete genome	25544-25568	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	KU998241	Gordonia phage Monty, complete genome	49348-49372	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_031229	Gordonia phage Hotorobo, complete genome	50209-50233	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_048783	Gordonia phage Beaver, complete genome	51378-51402	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MG770214	Gordonia phage SteveFrench, complete genome	50353-50377	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MK801728	Gordonia phage Gorko, complete genome	49330-49354	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	MK433267	Gordonia phage Butterball, complete genome	51634-51658	4	0.84
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	AM265638	Bacteriophage LKD16 complete genome, specific host Pseudomonas aeruginosa	25614-25638	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	301811-301835	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	446359-446383	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	524311-524335	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1978636-1978660	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	MN183284	Microbacterium phage Mashley, complete genome	29733-29757	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	66506-66530	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	434905-434929	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	220708-220732	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	205926-205950	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	172455-172479	4	0.84
NZ_CP009455_1	1.14\|264869\|25\|NZ_CP009455\|CRISPRCasFinder	264869-264893	25	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	426392-426416	4	0.84
NZ_CP009455_1	1.5\|264413\|25\|NZ_CP009455\|CRISPRCasFinder	264413-264437	25	NZ_CP025805	Sulfitobacter sp. SK012 plasmid unnamed1, complete sequence	152562-152586	5	0.8
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP041156	Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence	117062-117086	5	0.8
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	411006-411030	5	0.8
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_019387	Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence	109924-109948	5	0.8
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	505163-505187	5	0.8
NZ_CP009455_1	1.11\|264701\|25\|NZ_CP009455\|CRISPRCasFinder	264701-264725	25	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	654233-654257	5	0.8
NZ_CP009455_1	1.13\|264821\|25\|NZ_CP009455\|CRISPRCasFinder	264821-264845	25	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	1107440-1107464	5	0.8
NZ_CP009455_1	1.13\|264821\|25\|NZ_CP009455\|CRISPRCasFinder	264821-264845	25	NZ_CP031358	Erythrobacter aureus strain YH-07 plasmid unnamed, complete sequence	106287-106311	5	0.8
NZ_CP009455_1	1.15\|264917\|25\|NZ_CP009455\|CRISPRCasFinder	264917-264941	25	NZ_CP025114	Bradyrhizobium sp. SK17 strain CBNU plasmid unnamed, complete sequence	104260-104284	6	0.76

1. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 2, identity: 0.92

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaggtggcggcg	Protospacer
***************.***** ***

2. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

3. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccaccgcgcaggtggcggcg	Protospacer
*.********** ************

4. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

5. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

6. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

7. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

8. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

9. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

10. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

11. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

12. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

13. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

14. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

15. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

16. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

17. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

18. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.92

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccgccgcgcaggtggcggcg	Protospacer
*******.**** ************

19. spacer 1.2|264245|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020698 (Sulfitobacter sp. D7 plasmid p4SUD7, complete sequence) position: , mismatch: 3, identity: 0.88

cttggaaaatgccgacctggcagcc	CRISPR spacer
cgtggcaaatgccgatctggcagcc	Protospacer
* *** *********.*********

20. spacer 1.2|264245|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP049815 (Monaibacterium sp. ALG8 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.88

cttggaaaatgccgacctggcagcc	CRISPR spacer
cgtggcaaatgccgatctggcagcc	Protospacer
* *** *********.*********

21. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

cctgaccactgcccaggtcgccgca	CRISPR spacer
cctgaccaccgcccagctcgccgcc	Protospacer
*********.****** *******

22. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NC_018532 (Arthrobacter sp. Rue61a plasmid p232, complete sequence) position: , mismatch: 3, identity: 0.88

cctgaccactgcccaggtcgccgca	CRISPR spacer
catgaccaccgcccaggtcgccgcc	Protospacer
* *******.**************

23. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

cctgaccactgcccaggtcgccgca	CRISPR spacer
cctgaccaccgcccaggtcgctgcc	Protospacer
*********.***********.**

24. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaactgtccgcc	Protospacer
**************** ** ****

25. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

26. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

27. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

28. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

29. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

30. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

31. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctcaccaccgcgcaggtggccgcg	Protospacer
 ** ***********.*********

32. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgctcaagtggctgcc	Protospacer
************ ********.**

33. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccgcacaagtggctgcg	Protospacer
 ***********.********.***

34. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccgcacaagtggctgcg	Protospacer
 ***********.********.***

35. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacacaagtggcggcg	Protospacer
 *********** ******** ***

36. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcccaggtggtggcg	Protospacer
.**************.********.

37. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcccaggtggtggcg	Protospacer
.**************.********.

38. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggca	Protospacer
 *********** **.*********

39. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggca	Protospacer
 *********** **.*********

40. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggca	Protospacer
 *********** **.*********

41. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggca	Protospacer
 *********** **.*********

42. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggca	Protospacer
 *********** **.*********

43. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggca	Protospacer
 *********** **.*********

44. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gctggaaaccgctgatgtcgcggca	Protospacer
  **********************.

45. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gctggaaaccgctgatgtcgcggca	Protospacer
  **********************.

46. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gctggaaaccgctgatgtcgcggca	Protospacer
  **********************.

47. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gctggaaaccgctgatgtcgcggca	Protospacer
  **********************.

48. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gctggaaaccgctgatgttgcggcg	Protospacer
  ****************.******

49. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gatggaaaccgccgatgtcgctgcg	Protospacer
 ***********.******** ***

50. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP014797 (Salipiger profundus strain JLT2016 plasmid pTPRO1, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
gatggaaaccgccgatgtcgcggtg	Protospacer
 ***********.**********.*

51. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
cgtggaaaccgccgaagtcgcggcg	Protospacer
*.**********.** *********

52. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP018236 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8) position: , mismatch: 3, identity: 0.88

catggaaaccgctgatgtcgcggcg	CRISPR spacer
cgtggtaaccgatgatgtcgcggcg	Protospacer
*.*** ***** *************

53. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

54. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctcaccaccgcgcaggtggcggcg	Protospacer
*.* ******** ************

55. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcccaggtggtggcg	Protospacer
*.******* **********.****

56. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccaccgctcaggtggcggcg	Protospacer
 .**********.************

57. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cttgaccaccgctcaagtggcggcg	Protospacer
 ***********.**.*********

58. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttgaccaccgcccaggttgtggca	Protospacer
****************** *.***.

59. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttcaccaccggccaggtggcggcc	Protospacer
*** ******* ************

60. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gtcgaccaccgcccaggtgtcggca	Protospacer
**.**************** ****.

61. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccaccgcccctgtggcggcg	Protospacer
*.************  *********

62. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttcaccaccggccaggtggcggcc	Protospacer
*** ******* ************

63. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gttcaccaccggccaggtggcggcc	Protospacer
*** ******* ************

64. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

65. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

66. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

67. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

68. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

69. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

70. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccaccgcgcaggtggtggcg	Protospacer
*.********** *******.****

71. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctcaccaccgcgcaggtggcggcg	Protospacer
*.* ******** ************

72. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccaccgcgcaggtggtggcg	Protospacer
*.********** *******.****

73. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

74. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

75. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

76. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

77. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

78. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

79. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

80. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

81. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcccaggtggtggcg	Protospacer
*.******* **********.****

82. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacgggccaggtggcggcg	Protospacer
*.******* * *************

83. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccaccgcacaggtggtggcg	Protospacer
*.********** *******.****

84. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gtccaccaccgccctggtggcggcg	Protospacer
**. ********** **********

85. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccaccgacctggtggcggcg	Protospacer
*.********* ** **********

86. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gtccaccaccgccctggtggcggcg	Protospacer
**. ********** **********

87. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcacaggtggcggcg	Protospacer
*.******* ** ************

88. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 3, identity: 0.88

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gctgaccacggcgcaggtggcggcg	Protospacer
*.******* ** ************

89. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NC_047973 (Microbacterium phage Hyperion, complete genome) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgtccaccacccaggcgacagcg	Protospacer
**** **************.****

90. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gccgaccaccacccaggcggccacc	Protospacer
**.****************** .**

91. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gccgaccaccacccaggcggccacc	Protospacer
**.****************** .**

92. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

93. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gccgaccaccacccaggcggccacc	Protospacer
**.****************** .**

94. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

95. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gccgaccaccacccaggcggccacc	Protospacer
**.****************** .**

96. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

97. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

98. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gccgaccaccacccaggcggccacc	Protospacer
**.****************** .**

99. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

100. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

101. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

102. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gccgaccaccacccaggcggccacc	Protospacer
**.****************** .**

103. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgaccaccacccaggcggcagcc	CRISPR spacer
gttgaccaccacgcaggcggcatcc	Protospacer
*.********** ********* **

104. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
gctgaccactgcacaggttgccgcc	Protospacer
 *********** *****.*****

105. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
gctgaccactgctcaagtcgccgcg	Protospacer
 ***********.**.********.

106. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
actgaccactgctcaagtcgccgcg	Protospacer
 ***********.**.********.

107. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
actgaccactgcccaggccgtcgcg	Protospacer
 ****************.**.***.

108. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
actgaccaccgcccaggtcgctgcg	Protospacer
 ********.***********.**.

109. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
actgaccactgctcaggtcgctgct	Protospacer
 ***********.********.**

110. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
gctgaccacagcccaggttgccgcg	Protospacer
 ******** ********.*****.

111. spacer 1.3|264293|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 4, identity: 0.84

cctgaccactgcccaggtcgccgca	CRISPR spacer
gctgaccacagcccaggttgccgcg	Protospacer
 ******** ********.*****.

112. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

113. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

114. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

115. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

116. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

117. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

118. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccacggcgcaggtggccgcc	Protospacer
 ******** *****.********

119. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cttgaccaccgctcaagtggcggcg	Protospacer
 .********** ******** ***

120. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********.********** **

121. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********.********** **

122. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********.********** **

123. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********.********** **

124. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********.********** **

125. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********.********** **

126. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
ggcgaccaccgcgcaagtgaccgcc	Protospacer
* .****************.****

127. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NC_047914 (Faecalibacterium phage FP_Taranis, complete genome) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
tgtgaccaccacccaactggccgcc	Protospacer
  ************** *******

128. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********** ******** **

129. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********** ******** **

130. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacacaagtggcggcc	Protospacer
 *********** ******** **

131. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********** ******** **

132. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacacaagtggcggcc	Protospacer
 *********** ******** **

133. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
tctgaccaccacacaagtggcggcc	Protospacer
 *********** ******** **

134. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********** ******** **

135. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacacaagtggcggcc	Protospacer
 *********** ******** **

136. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********** ******** **

137. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
cctgaccaccacgcaagtggcggcc	Protospacer
 *********** ******** **

138. spacer 1.6|264461|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020084 (Blastomonas fulva strain T2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaagtggccgcg	CRISPR spacer
tcttaccaccacccacgtggccgca	Protospacer
 ** *********** ********.

139. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

140. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

141. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

142. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

143. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

144. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

145. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

146. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

147. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

148. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtgtcgctggccagcgtgacgggc	Protospacer
  *****************.**.**

149. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NC_011667 (Thauera sp. MZ1T plasmid pTha01, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cttgtcgagggccagcgtggcgagt	Protospacer
 ******  ***************.

150. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
gttgtcgctggccagcgtgatgcgg	Protospacer
*******************..* *

151. spacer 1.7|264509|25|NZ_CP009455|CRISPRCasFinder matches to MN857473 (Teseptimavirus S2B, complete genome) position: , mismatch: 4, identity: 0.84

gttgtcgctggccagcgtggcgagc	CRISPR spacer
cgtggcgctggtcagcgtggcgagc	Protospacer
  ** ******.*************

152. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggcc	Protospacer
 *********** **.********

153. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggcc	Protospacer
 *********** **.********

154. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcgcaggtggtggcg	Protospacer
.*********** **.********.

155. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcgcaggtggtggcg	Protospacer
.*********** **.********.

156. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcgcaggtggtggcg	Protospacer
.*********** **.********.

157. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcgcaggtggtggcg	Protospacer
.*********** **.********.

158. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcgcaggtggtggcg	Protospacer
.*********** **.********.

159. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
gctgaccacggcgcaggtggtggcg	Protospacer
.*********** **.********.

160. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020984 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6990 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

161. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020984 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6990 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

162. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccacggcgcaggtggtggcg	Protospacer
 *********** **.********.

163. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021008 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

164. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021008 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

165. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021019 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

166. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021019 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

167. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020999 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6165 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

168. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021002 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

169. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021002 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

170. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020965 (Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

171. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to CP021013 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

172. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to CP021013 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

173. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020988 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6994R plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

174. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020988 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6994R plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

175. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NC_022539 (Xanthomonas citri pv. fuscans plasmid pla, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

176. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NC_022539 (Xanthomonas citri pv. fuscans plasmid pla, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

177. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020986 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6992 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

178. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020986 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6992 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

179. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020993 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

180. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020993 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

181. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021017 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

182. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021017 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

183. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020982 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6989 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

184. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020982 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6989 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

185. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020990 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6996R plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

186. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020990 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6996R plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

187. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020976 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pA) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

188. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020980 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6988R plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

189. spacer 1.8|264557|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP020980 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6988R plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

actgaccacggcccaagtggtggca	CRISPR spacer
cctgaccccggcccaggtggtggcc	Protospacer
 ****** *******.********

190. spacer 1.9|264605|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 4, identity: 0.84

gctcaaggtcacgcagatcgctgcg	CRISPR spacer
gctcaaggccacgcacatcgctgaa	Protospacer
********.****** ******* .

191. spacer 1.9|264605|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

gctcaaggtcacgcagatcgctgcg	CRISPR spacer
tatgaaagtcacgcagatcgctgcg	Protospacer
  * **.******************

192. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

catggaaaccgctgatgtcgcggcg	CRISPR spacer
actggaaacggctgatgtcgctgcg	Protospacer
  ******* *********** ***

193. spacer 1.10|264653|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

catggaaaccgctgatgtcgcggcg	CRISPR spacer
actggaaaccgccgatgtcgctgcg	Protospacer
  **********.******** ***

194. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

195. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047266 (Pseudomonas asturiensis strain CC1524 plasmid pCC1524, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
actgaccaccgcccaggtcgctgcg	Protospacer
..**************** ** ***

196. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

197. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

198. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

199. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

200. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

201. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

202. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

203. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

204. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

205. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacgggccaggtggcggcg	Protospacer
 .******* * *************

206. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgaccacggcgcaggtggcggcg	Protospacer
 .******* ** ************

207. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016618 (Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gcagaccgccgcccaggtggcggct	Protospacer
*. ****.****************

208. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gcagaccgccgcccaggtggcggct	Protospacer
*. ****.****************

209. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MT889368 (Gordonia phage Sam12, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

210. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MT114160 (Gordonia phage Breezic, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

211. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MT889370 (Gordonia phage GourdThymes, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

212. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MK433261 (Gordonia phage Msay19, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

213. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MT889379 (Gordonia phage Diabla, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

214. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MG757155 (Gordonia phage Boneham, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

215. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MK433265 (Gordonia phage Exiguo, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

216. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_048820 (Gordonia phage Jellybones, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

217. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_009935 (Pseudomonas phage LKD16, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgatcaccgcccaggtggcgccg	Protospacer
 .***.**************** **

218. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MT740728 (Ralstonia phage Anchaing, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
attgaccaccgccgaggtcgcggcc	Protospacer
.************ **** *****

219. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MG770211 (Gordonia phage Flakey, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

220. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MK433263 (Gordonia phage FelixAlejandro, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

221. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MG757152 (Gordonia phage Adgers, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

222. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MN945905 (Gordonia phage John316, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

223. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MK359302 (Gordonia phage Sombrero, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

224. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_047892 (Gordonia phage BirksAndSocks, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

225. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to FN263372 (Pseudomonas phage phikF77, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgatcaccgcccaggtggcgccg	Protospacer
 .***.**************** **

226. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to KU998241 (Gordonia phage Monty, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

227. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_031229 (Gordonia phage Hotorobo, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

228. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_048783 (Gordonia phage Beaver, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

229. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MG770214 (Gordonia phage SteveFrench, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

230. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MK801728 (Gordonia phage Gorko, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

231. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to MK433267 (Gordonia phage Butterball, complete genome) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgacgaccgaccaggtggcggcg	Protospacer
 .**** **** *************

232. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to AM265638 (Bacteriophage LKD16 complete genome, specific host Pseudomonas aeruginosa) position: , mismatch: 4, identity: 0.84

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cctgatcaccgcccaggtggcgccg	Protospacer
 .***.**************** **

233. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgaccgccacccaggcggccgag	Protospacer
*******.************* *

234. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
cctggccaccacccaggcggcggcg	Protospacer
 ***.****************.**

235. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
cctgaccatcacccaggcggcggcg	Protospacer
 *******.************.**

236. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
attgaccaccacgcaggcggcatcc	Protospacer
..********** ********* **

237. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to MN183284 (Microbacterium phage Mashley, complete genome) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
actgtccaccacccaggcgacagcg	Protospacer
.*** **************.****

238. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgaccgccacccaggcggccgaa	Protospacer
*******.************* *

239. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgaccgccacccaggcggccgag	Protospacer
*******.************* *

240. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgaccgccacccaggcggccgag	Protospacer
*******.************* *

241. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
attgaccaccacgcaggcggcatcc	Protospacer
..********** ********* **

242. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgaccgccacccaggcggccgag	Protospacer
*******.************* *

243. spacer 1.14|264869|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 4, identity: 0.84

gctgaccaccacccaggcggcagcc	CRISPR spacer
gctgaccgccacccaggcggccgag	Protospacer
*******.************* *

244. spacer 1.5|264413|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP025805 (Sulfitobacter sp. SK012 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

gctgaccaccgcgcaagtggccgcg	CRISPR spacer
gctgaccaccgcgcaagtgatggac	Protospacer
*******************.. *

245. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP041156 (Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cgtgaccaccgccaaggtggcgggc	Protospacer
  *********** *********

246. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 5, identity: 0.8

gttgaccaccgcccaggtggcggcg	CRISPR spacer
aatgaccaccgcccgggtggcggaa	Protospacer
. ************.******** .

247. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_019387 (Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence) position: , mismatch: 5, identity: 0.8

gttgaccaccgcccaggtggcggcg	CRISPR spacer
gggctccaccgcccaggtggcggcc	Protospacer
*    *******************

248. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

gttgaccaccgcccaggtggcggcg	CRISPR spacer
ccgcaccacggcccaggtggcggcg	Protospacer
 .  ***** ***************

249. spacer 1.11|264701|25|NZ_CP009455|CRISPRCasFinder matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 5, identity: 0.8

gttgaccaccgcccaggtggcggcg	CRISPR spacer
cggcaccaccacccaggtggcggcg	Protospacer
    ******.**************

250. spacer 1.13|264821|25|NZ_CP009455|CRISPRCasFinder matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 5, identity: 0.8

catcgaaaccaccgacatggccgcc	CRISPR spacer
acaggaaaccgccgacatggccgcc	Protospacer
    ******.**************

251. spacer 1.13|264821|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP031358 (Erythrobacter aureus strain YH-07 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

catcgaaaccaccgacatggccgcc	CRISPR spacer
gttcgtaaccaccgacatggccgag	Protospacer
  *** *****************

252. spacer 1.15|264917|25|NZ_CP009455|CRISPRCasFinder matches to NZ_CP025114 (Bradyrhizobium sp. SK17 strain CBNU plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.76

cctgtcgatgacccaggtcgatgcc	CRISPR spacer
gctgtcgatgacccaggtcggcaaa	Protospacer
 *******************...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2935699 : 3015997

Pseudomonas_phage(40.38%)

tail,portal,protease,capsid,head,terminase,integrase

attL 2937135:2937193|attR 2976845:2976903

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038412800.1\|2935699_2936554_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.1e-28	34.2
2937135:2937193	attL	NA	NA	NA	NA
WP_038412801.1\|2937198_2938308_-\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	5.9e-153	73.6
WP_081951596.1\|2938193_2938514_-	helix-turn-helix domain-containing protein	Q9MC86	Pseudomonas_phage	1.0e-20	59.4
WP_038412802.1\|2938551_2938779_-	hypothetical protein	NA	NA	NA	NA
WP_038412803.1\|2938830_2939031_-	hypothetical protein	NA	NA	NA	NA
WP_038412804.1\|2939027_2939426_-	DUF2591 family protein	A0A125RNP6	Pseudomonas_phage	9.6e-13	36.1
WP_038412806.1\|2939922_2940219_-	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	2.8e-33	75.5
WP_038412807.1\|2940215_2940863_-	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	6.5e-67	64.5
WP_049870485.1\|2940939_2941734_-	hypothetical protein	H2BDF1	Pseudomonas_virus	4.4e-17	52.9
WP_038412808.1\|2941743_2943255_-	DNA cytosine methyltransferase	Q6V7R9	Burkholderia_virus	2.4e-104	44.7
WP_038412809.1\|2943290_2943938_+	hypothetical protein	NA	NA	NA	NA
WP_038412810.1\|2944284_2945100_-	DUF2303 family protein	A0A2R2Z323	Escherichia_phage	1.6e-46	40.8
WP_038412811.1\|2945130_2945478_-	hypothetical protein	I3PUY8	Vibrio_phage	2.3e-23	49.1
WP_038412812.1\|2945566_2946034_-	hypothetical protein	NA	NA	NA	NA
WP_038412813.1\|2946030_2946291_-	hypothetical protein	NA	NA	NA	NA
WP_038414713.1\|2946304_2946688_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	5.8e-23	56.9
WP_038412816.1\|2947424_2947637_-	hypothetical protein	A0A2H4JGV5	uncultured_Caudovirales_phage	6.9e-18	66.7
WP_038412817.1\|2947708_2947888_-	carbon storage regulator CsrA	H2BD56	Pseudomonas_phage	2.9e-09	60.8
WP_167334495.1\|2948194_2948371_-	hypothetical protein	NA	NA	NA	NA
WP_038414714.1\|2948783_2949434_-	helix-turn-helix transcriptional regulator	A0A0H5BBV1	Pseudomonas_phage	4.2e-50	51.4
WP_038412819.1\|2949523_2949733_+	transcriptional regulator	A0A1B0VMF5	Pseudomonas_phage	2.7e-19	65.2
WP_038412820.1\|2949844_2950102_+	hypothetical protein	NA	NA	NA	NA
WP_081951597.1\|2950350_2951211_+	replication protein	W6MYB0	Pseudomonas_phage	9.6e-34	34.9
WP_038412821.1\|2951200_2951995_+	ATP-binding protein	A0A2H4J3E5	uncultured_Caudovirales_phage	6.7e-74	53.0
WP_038414716.1\|2951997_2952294_+	DUF1364 domain-containing protein	H9C174	Pectobacterium_phage	3.4e-31	70.3
WP_038412822.1\|2952290_2952719_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	5.1e-52	73.9
WP_038412823.1\|2954285_2954603_+	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	6.9e-30	60.0
WP_038412824.1\|2954608_2954998_+	antitermination protein Q	A0A1W6JTD2	Pseudomonas_phage	1.9e-42	63.3
WP_038412825.1\|2955123_2955450_+	hypothetical protein	A0A088FVG2	Escherichia_phage	7.1e-22	51.9
WP_038412826.1\|2955446_2955755_+	hypothetical protein	A0A1W6JT10	Escherichia_phage	3.0e-06	33.8
WP_038412827.1\|2955818_2956019_+	hypothetical protein	NA	NA	NA	NA
WP_038412828.1\|2956009_2956390_+	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	2.0e-39	58.1
WP_038412829.1\|2956537_2957020_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	6.1e-62	74.0
WP_038412830.1\|2957016_2958738_+\|terminase	terminase large subunit	A0A2D1GNU5	Pseudomonas_phage	1.3e-292	82.4
WP_038412831.1\|2958737_2960009_+\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	1.5e-187	74.8
WP_038412832.1\|2960027_2960687_+\|head,protease	HK97 family phage prohead protease	Q9MCV5	Escherichia_phage	3.0e-72	64.5
WP_038412833.1\|2960702_2961866_+\|capsid	phage major capsid protein	F1C582	Cronobacter_phage	1.3e-161	75.5
WP_038412834.1\|2961907_2962093_+	hypothetical protein	NA	NA	NA	NA
WP_038412835.1\|2962089_2962419_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J8C5	uncultured_Caudovirales_phage	8.5e-15	46.8
WP_038412836.1\|2962415_2962754_+\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	2.4e-25	58.0
WP_038412837.1\|2962746_2963232_+	HK97 gp10 family phage protein	Q9MCA7	Pseudomonas_phage	5.5e-55	74.8
WP_038412838.1\|2963228_2963597_+	DUF3168 domain-containing protein	Q9MCA6	Pseudomonas_phage	5.2e-37	59.8
WP_038412839.1\|2963659_2964157_+\|tail	phage major tail protein	Q9MCA5	Pseudomonas_phage	1.4e-50	60.8
WP_038412840.1\|2964153_2964624_+\|tail	phage tail assembly protein	K7PJU9	Enterobacteria_phage	1.7e-37	65.4
WP_038412842.1\|2964915_2965236_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_038412843.1\|2965292_2967725_+\|tail	tail tape measure protein	D4FUM0	Pseudomonas_phage	1.8e-138	43.7
WP_038412844.1\|2967721_2968207_+	DUF1833 family protein	A0A2H4J983	uncultured_Caudovirales_phage	1.5e-44	53.4
WP_038412845.1\|2968215_2968650_+	hypothetical protein	A0A0H5AUG1	Pseudomonas_phage	1.2e-40	58.7
WP_038412846.1\|2968606_2971720_+	hypothetical protein	A0A2H4J0V9	uncultured_Caudovirales_phage	2.5e-273	46.5
WP_038412847.1\|2971716_2972199_+	hypothetical protein	A0A0U4K586	Pseudomonas_phage	4.0e-21	39.8
WP_038412848.1\|2972253_2974095_+	SGNH/GDSL hydrolase family protein	A0A2H4J9C6	uncultured_Caudovirales_phage	8.1e-06	49.2
WP_038412849.1\|2974105_2974846_+	hypothetical protein	NA	NA	NA	NA
WP_038412850.1\|2974950_2975490_+	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	2.9e-44	59.9
WP_156109571.1\|2975504_2976020_+	DUF2514 family protein	NA	NA	NA	NA
WP_038412851.1\|2976080_2976377_+	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	2.0e-31	61.9
WP_081951598.1\|2977139_2977646_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
2976845:2976903	attR	NA	NA	NA	NA
WP_038412853.1\|2977642_2978590_+	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_038412854.1\|2978705_2981108_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_038412855.1\|2981183_2982062_-	hypothetical protein	NA	NA	NA	NA
WP_038412856.1\|2982140_2982449_-	hypothetical protein	NA	NA	NA	NA
WP_038412857.1\|2982490_2983204_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	8.3e-07	25.4
WP_038412858.1\|2983454_2983760_+	hypothetical protein	NA	NA	NA	NA
WP_038412859.1\|2983958_2985269_+	trigger factor	NA	NA	NA	NA
WP_028694418.1\|2985361_2986003_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.9e-58	59.6
WP_038412860.1\|2986112_2987396_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.8e-138	58.3
WP_038412861.1\|2987556_2989953_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.1e-220	51.9
WP_038412862.1\|2990103_2990376_+	HU family DNA-binding protein	A3E2K9	Sodalis_phage	1.9e-20	60.7
WP_038412863.1\|2990558_2992430_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_038412864.1\|2992481_2993522_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_038412865.1\|2993673_2993952_+	hypothetical protein	NA	NA	NA	NA
WP_038412866.1\|2993966_2994734_+	CHAD domain-containing protein	NA	NA	NA	NA
WP_038414719.1\|2994745_2994979_-	hypothetical protein	NA	NA	NA	NA
WP_038412867.1\|2995054_2996533_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.2e-41	35.7
WP_038412868.1\|2996618_2997425_-	preprotein translocase subunit TatD	NA	NA	NA	NA
WP_081951599.1\|2997576_2998986_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_038412869.1\|2999202_2999511_+	hypothetical protein	NA	NA	NA	NA
WP_038412870.1\|2999584_3000067_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_038412871.1\|3000067_3002575_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_038412872.1\|3002574_3003258_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.6e-07	27.5
WP_038412873.1\|3003268_3003874_+	arylesterase	NA	NA	NA	NA
WP_038412874.1\|3003932_3004214_+	hypothetical protein	NA	NA	NA	NA
WP_038412875.1\|3004319_3005291_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_003259780.1\|3005389_3005641_-	hypothetical protein	NA	NA	NA	NA
WP_028694400.1\|3006114_3006396_+	N-acetyltransferase	NA	NA	NA	NA
WP_038412876.1\|3006460_3007537_-	3-deoxy-7-phosphoheptulonate synthase	A0A2I6UFP9	Klebsiella_phage	4.1e-82	50.5
WP_038412877.1\|3007789_3008740_+	putative 2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_038412878.1\|3008806_3009304_+	universal stress protein	NA	NA	NA	NA
WP_038412879.1\|3009425_3010400_+	HTH-type transcriptional regulator CysB	NA	NA	NA	NA
WP_038412880.1\|3010584_3011319_-	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_038412881.1\|3011412_3012759_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.2e-43	35.3
WP_038412882.1\|3012939_3013920_-	alpha-L-glutamate ligase-like protein	NA	NA	NA	NA
WP_038412883.1\|3013919_3015455_-	inactive transglutaminase family protein	NA	NA	NA	NA
WP_038412884.1\|3015460_3015997_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA

DBSCAN-SWA_2

3188243 : 3192888

uncultured_Caudovirales_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038413021.1\|3188243_3189245_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	8.0e-141	73.5
WP_038414731.1\|3189241_3189577_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.8e-36	70.3
WP_038413022.1\|3189573_3189870_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.6e-20	57.6
WP_038413023.1\|3189869_3190229_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.4e-31	56.7
WP_038413024.1\|3190230_3190623_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.9e-53	77.5
WP_038413025.1\|3190699_3192076_-	purine permease	H9YQ34	environmental_Halophage	6.9e-26	49.6
WP_028696146.1\|3192219_3192888_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	6.4e-102	89.7

DBSCAN-SWA_3

3239059 : 3335547

142

Pseudomonas_phage(45.83%)

tail,portal,plate,protease,capsid,head,terminase,integrase

attL 3242219:3242278|attR 3336811:3336876

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038413062.1\|3239059_3240685_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-56	39.9
WP_038413063.1\|3241020_3242040_+\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	6.3e-24	27.2
3242219:3242278	attL	NA	NA	NA	NA
WP_038413064.1\|3242403_3243381_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	2.1e-117	66.2
WP_038413065.1\|3243377_3243623_-	hypothetical protein	B5WZU8	Pseudomonas_phage	1.7e-23	67.5
WP_038412802.1\|3243662_3243890_-	hypothetical protein	NA	NA	NA	NA
WP_038413066.1\|3243941_3244142_-	hypothetical protein	NA	NA	NA	NA
WP_038413067.1\|3244138_3244531_-	DUF2591 family protein	A0A125RNP6	Pseudomonas_phage	1.3e-14	37.8
WP_038413069.1\|3245020_3245248_-	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	6.9e-08	48.3
WP_038414734.1\|3245244_3246045_-	hypothetical protein	Q5QF32	Pseudomonas_virus	5.2e-74	58.2
WP_038413071.1\|3246093_3246879_-	hypothetical protein	A0A0U1UNM2	Pseudomonas_phage	8.0e-11	48.4
WP_081951606.1\|3246887_3247421_-	hypothetical protein	Q6V7R9	Burkholderia_virus	1.6e-23	59.2
WP_038413072.1\|3247554_3248268_-	hypothetical protein	NA	NA	NA	NA
WP_038413073.1\|3248326_3248686_-	hypothetical protein	A0A2H4JAQ1	uncultured_Caudovirales_phage	1.2e-14	46.9
WP_038413074.1\|3248660_3249026_-	hypothetical protein	A0A2H4J0L9	uncultured_Caudovirales_phage	3.1e-58	89.3
WP_038413075.1\|3249107_3249296_-	hypothetical protein	NA	NA	NA	NA
WP_038413076.1\|3249304_3249799_-	single-stranded DNA-binding protein	I3PGW4	Xanthomonas_phage	9.0e-45	70.4
WP_038413077.1\|3249808_3250372_-	siphovirus Gp157 family protein	A0A2H4IZG3	uncultured_Caudovirales_phage	4.7e-90	93.0
WP_038413078.1\|3250368_3251100_-	hypothetical protein	A0A2H4J2D5	uncultured_Caudovirales_phage	1.5e-125	94.2
WP_038413079.1\|3251259_3251436_-	hypothetical protein	NA	NA	NA	NA
WP_038413080.1\|3251432_3251801_-	hypothetical protein	A0A218L3S0	Pseudomonas_phage	5.0e-08	35.8
WP_038413081.1\|3251797_3251992_-	hypothetical protein	A0A1B0VMB8	Pseudomonas_phage	6.1e-13	58.1
WP_038413082.1\|3251988_3252408_-	hypothetical protein	NA	NA	NA	NA
WP_038413083.1\|3252428_3252650_-	DUF551 domain-containing protein	A0A2H4J1U4	uncultured_Caudovirales_phage	6.2e-38	95.9
WP_156109537.1\|3252646_3252907_-	hypothetical protein	A0A1B0VMC0	Pseudomonas_phage	2.2e-05	44.0
WP_038413085.1\|3253475_3253709_-	hypothetical protein	NA	NA	NA	NA
WP_038413086.1\|3253767_3253959_-	hypothetical protein	NA	NA	NA	NA
WP_156109538.1\|3254321_3254876_-	hypothetical protein	NA	NA	NA	NA
WP_038413088.1\|3254850_3255195_-	hypothetical protein	NA	NA	NA	NA
WP_038413089.1\|3255230_3256034_-	helix-turn-helix domain-containing protein	A0A2H4J6Q0	uncultured_Caudovirales_phage	6.6e-45	41.6
WP_038413090.1\|3256148_3256346_+	helix-turn-helix domain-containing protein	A0A2H4JF66	uncultured_Caudovirales_phage	6.8e-12	55.2
WP_038413091.1\|3256376_3256580_+	hypothetical protein	B5WZX7	Pseudomonas_phage	6.8e-07	47.7
WP_156109539.1\|3256812_3256974_+	hypothetical protein	NA	NA	NA	NA
WP_038413093.1\|3256966_3257164_-	hypothetical protein	NA	NA	NA	NA
WP_038414735.1\|3257315_3258137_+	transporter	A0A2I7RX10	Vibrio_phage	2.0e-52	48.6
WP_038413094.1\|3258133_3258313_+	hypothetical protein	NA	NA	NA	NA
WP_038413095.1\|3258309_3259041_+	GntR family transcriptional regulator	Q8HA96	Salmonella_phage	1.0e-28	65.0
WP_038413096.1\|3259037_3259775_+	Replication protein P	A0A2H4J1T4	uncultured_Caudovirales_phage	2.9e-63	55.3
WP_038413097.1\|3259774_3259969_+	hypothetical protein	NA	NA	NA	NA
WP_038413098.1\|3259968_3260226_+	hypothetical protein	K4NZ23	Pseudomonas_phage	1.9e-06	38.6
WP_038413099.1\|3260350_3260638_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_038413100.1\|3260630_3261101_+	hypothetical protein	A0A2H4J106	uncultured_Caudovirales_phage	3.7e-56	66.0
WP_038413101.1\|3261097_3261397_+	hypothetical protein	NA	NA	NA	NA
WP_038413102.1\|3261599_3262199_+	ninG protein	H2BDI7	Pseudomonas_virus	1.5e-62	65.3
WP_038413103.1\|3262195_3262786_+	hypothetical protein	A0A0S2SYA9	Pseudomonas_phage	3.7e-61	52.2
WP_156109540.1\|3262917_3263175_+	hypothetical protein	NA	NA	NA	NA
WP_038413105.1\|3263212_3263626_+	hypothetical protein	NA	NA	NA	NA
WP_038413106.1\|3263618_3263990_+	hypothetical protein	NA	NA	NA	NA
WP_038413107.1\|3264036_3264561_+	hypothetical protein	A0A2H4J8J1	uncultured_Caudovirales_phage	3.1e-59	71.9
WP_038413108.1\|3264563_3266051_+\|terminase	terminase	A0A2H4J2I1	uncultured_Caudovirales_phage	5.5e-279	94.2
WP_038413109.1\|3266058_3267510_+	DUF4055 domain-containing protein	A0A2H4J5M6	uncultured_Caudovirales_phage	6.5e-75	37.4
WP_038413110.1\|3267499_3268543_+\|head	head morphogenesis protein	A0A0S0N1M5	Pseudomonas_phage	1.8e-34	30.5
WP_038413111.1\|3268611_3269319_+	hypothetical protein	NA	NA	NA	NA
WP_038413112.1\|3269322_3270354_+	hypothetical protein	A0A2H4J3W6	uncultured_Caudovirales_phage	9.5e-113	60.9
WP_049870497.1\|3270378_3270804_+	hypothetical protein	A0A2H4J0Y2	uncultured_Caudovirales_phage	3.9e-12	35.3
WP_038413113.1\|3270843_3271236_+	hypothetical protein	A0A0S2SYB7	Pseudomonas_phage	2.7e-15	42.5
WP_038413114.1\|3271239_3271620_+	hypothetical protein	A0A059VA70	Pseudomonas_phage	1.2e-25	48.0
WP_038413115.1\|3271622_3272183_+	hypothetical protein	A0A1B0VMI1	Pseudomonas_phage	3.0e-28	39.9
WP_038413116.1\|3272179_3272587_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_038413117.1\|3272649_3273819_+	Ig-like domain-containing protein	A0A059VG08	Pseudomonas_phage	3.4e-58	40.7
WP_038413118.1\|3273877_3274321_+	hypothetical protein	NA	NA	NA	NA
WP_038414738.1\|3274428_3274686_+	hypothetical protein	NA	NA	NA	NA
WP_038413119.1\|3274737_3275058_+	superinfection immunity protein	A0A0S2SY85	Pseudomonas_phage	2.2e-12	56.9
WP_038414739.1\|3275498_3278303_+\|tail	tail length tape measure protein	A0A0S2SYD9	Pseudomonas_phage	6.0e-77	33.3
WP_038413120.1\|3278399_3278579_+	hypothetical protein	NA	NA	NA	NA
WP_038413121.1\|3278575_3278833_-	hypothetical protein	NA	NA	NA	NA
WP_038413122.1\|3278938_3279409_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.1e-18	41.3
WP_038413123.1\|3279405_3279900_+	DUF1833 family protein	NA	NA	NA	NA
WP_038413124.1\|3279902_3280301_+	hypothetical protein	B5WZT7	Pseudomonas_phage	6.4e-25	43.5
WP_038413125.1\|3280275_3283338_+	hypothetical protein	B5WZT8	Pseudomonas_phage	4.2e-209	38.8
WP_038413126.1\|3283395_3285237_+	SGNH/GDSL hydrolase family protein	A0A2H4J9C6	uncultured_Caudovirales_phage	7.4e-07	50.8
WP_038413127.1\|3285247_3285988_+	hypothetical protein	NA	NA	NA	NA
WP_038413128.1\|3286092_3286632_+	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	1.9e-43	59.2
WP_156109571.1\|3286646_3287162_+	DUF2514 family protein	NA	NA	NA	NA
WP_038413129.1\|3287222_3287519_+	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	6.4e-30	59.8
WP_038413130.1\|3288262_3289312_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	9.1e-103	56.3
WP_038413131.1\|3289313_3289559_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_038413133.1\|3289584_3290082_-	hypothetical protein	A0A1B0VM52	Pseudomonas_phage	1.5e-31	55.7
WP_038413134.1\|3290133_3290334_-	hypothetical protein	NA	NA	NA	NA
WP_038412804.1\|3290330_3290729_-	DUF2591 family protein	A0A125RNP6	Pseudomonas_phage	9.6e-13	36.1
WP_038412806.1\|3291225_3291522_-	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	2.8e-33	75.5
WP_038412807.1\|3291518_3292166_-	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	6.5e-67	64.5
WP_049870614.1\|3292231_3292576_-	hypothetical protein	B2ZY87	Ralstonia_phage	3.9e-39	74.8
WP_038413135.1\|3293316_3294804_-	DNA cytosine methyltransferase	A0A2I7QRH3	Vibrio_phage	1.1e-106	46.7
WP_167334498.1\|3294881_3295754_+	hypothetical protein	C9E2Q0	Enterococcus_phage	1.7e-25	34.0
WP_038413137.1\|3296266_3296650_-	hypothetical protein	A0A0U4JNY7	Pseudomonas_phage	9.5e-26	45.7
WP_038413139.1\|3296965_3297385_-	hypothetical protein	NA	NA	NA	NA
WP_038413140.1\|3297682_3298498_-	DUF2303 family protein	A0A2R2Z323	Escherichia_phage	4.6e-46	41.4
WP_038413141.1\|3298528_3298876_-	hypothetical protein	I3PUY8	Vibrio_phage	1.8e-23	49.1
WP_038413142.1\|3298964_3299423_-	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	2.2e-45	61.2
WP_038413143.1\|3299419_3299680_-	hypothetical protein	NA	NA	NA	NA
WP_038413144.1\|3299697_3300081_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	2.9e-22	56.9
WP_038413145.1\|3300356_3300668_-	hypothetical protein	NA	NA	NA	NA
WP_038413146.1\|3300731_3300953_-	hypothetical protein	NA	NA	NA	NA
WP_038413147.1\|3301020_3301200_-	carbon storage regulator CsrA	H2BD56	Pseudomonas_phage	2.9e-09	60.8
WP_167334499.1\|3301259_3301436_-	hypothetical protein	NA	NA	NA	NA
WP_038413148.1\|3302047_3302299_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_081951607.1\|3302466_3303198_-	helix-turn-helix domain-containing protein	K7P850	Enterobacteria_phage	4.2e-46	47.4
WP_038413149.1\|3303228_3303459_+	helix-turn-helix domain-containing protein	W6MWX8	Pseudomonas_phage	8.5e-06	47.7
WP_038414744.1\|3303666_3304347_+	DNA-binding protein	A0A2D1GNK4	Pseudomonas_phage	4.4e-50	47.9
WP_038413150.1\|3304348_3305320_+	hypothetical protein	A0A1B0VME0	Pseudomonas_phage	1.5e-112	69.5
WP_038413151.1\|3305306_3306086_+	hypothetical protein	A0A1B0VMD9	Pseudomonas_phage	4.9e-61	57.3
WP_038413152.1\|3306082_3306379_+	DUF1364 domain-containing protein	K7PKV0	Enterobacteria_phage	1.1e-32	70.5
WP_038413153.1\|3306375_3306801_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	3.0e-44	66.2
WP_038413154.1\|3306797_3308096_+\|integrase	tyrosine-type recombinase/integrase	A0A2D1GND4	Pseudomonas_phage	4.9e-122	54.5
WP_038413155.1\|3308092_3308341_+	hypothetical protein	NA	NA	NA	NA
WP_038413156.1\|3308337_3308655_+	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	1.2e-29	59.0
WP_038413157.1\|3308666_3309008_+	hypothetical protein	A0A2D1GNB4	Pseudomonas_phage	5.3e-36	66.1
WP_038413158.1\|3309134_3309560_-	transcriptional regulator	F1C593	Cronobacter_phage	4.8e-18	39.7
WP_038413159.1\|3309611_3309791_-	type II toxin-antitoxin system HicA family toxin	A0A2H4JDU5	uncultured_Caudovirales_phage	9.3e-08	51.7
WP_038413161.1\|3309886_3310213_+	hypothetical protein	A0A088FVG2	Escherichia_phage	1.2e-21	52.8
WP_038413162.1\|3310209_3310539_+	hypothetical protein	A0A1W6JT10	Escherichia_phage	3.8e-07	37.8
WP_081951608.1\|3310542_3310947_+	HNH endonuclease	H2BDK0	Pseudomonas_virus	3.8e-17	56.5
WP_038413164.1\|3311047_3311527_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	2.7e-62	74.7
WP_038413165.1\|3311526_3313254_+\|terminase	terminase large subunit	A0A2D1GNU5	Pseudomonas_phage	1.3e-287	83.6
WP_167334500.1\|3313253_3313418_+	hypothetical protein	NA	NA	NA	NA
WP_038413166.1\|3313410_3314721_+\|portal	phage portal protein	H2BDA8	Pseudomonas_virus	3.3e-179	69.2
WP_038413168.1\|3314724_3315588_+\|protease	Clp protease ClpP	A0A1V0E8B8	Vibrio_phage	3.7e-94	63.6
WP_038413169.1\|3315584_3316775_+\|capsid	phage major capsid protein	H2BDB0	Pseudomonas_virus	1.3e-145	69.9
WP_038413170.1\|3316821_3317331_+	hypothetical protein	NA	NA	NA	NA
WP_038413171.1\|3317333_3317810_+\|head,tail	phage gp6-like head-tail connector protein	G3ENA1	Psychrobacter_phage	1.4e-15	37.0
WP_081951609.1\|3317852_3318254_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_038413173.1\|3318243_3318753_+	hypothetical protein	NA	NA	NA	NA
WP_049870615.1\|3318882_3319332_+	hypothetical protein	B5TK65	Pseudomonas_phage	1.5e-17	37.0
WP_038413175.1\|3319342_3319546_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_038413176.1\|3319542_3321027_+\|tail	tail sheath protein	B5TK67	Pseudomonas_phage	2.5e-167	61.7
WP_038413177.1\|3321081_3321429_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	2.3e-31	55.3
WP_049870498.1\|3321419_3321767_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_038413178.1\|3321848_3323762_+\|tail	phage tail tape measure protein	U5P420	Shigella_phage	3.2e-122	54.1
WP_038413179.1\|3323758_3325018_+	hypothetical protein	B5TK71	Pseudomonas_phage	1.8e-60	35.5
WP_038413180.1\|3325021_3326131_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	4.2e-98	52.2
WP_038413185.1\|3326136_3326640_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	2.3e-59	71.1
WP_038413187.1\|3326636_3327023_+	phage GP46 family protein	B5TK74	Pseudomonas_phage	8.4e-30	55.6
WP_038413189.1\|3327012_3328056_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	6.7e-74	43.7
WP_038413191.1\|3328046_3328688_+	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_049870499.1\|3328690_3329602_+	hypothetical protein	A0A2H4J9C3	uncultured_Caudovirales_phage	1.3e-60	44.9
WP_167334501.1\|3329822_3331511_+	hypothetical protein	NA	NA	NA	NA
WP_038413193.1\|3331525_3332275_+	hypothetical protein	NA	NA	NA	NA
WP_156109541.1\|3332344_3333139_-	antibiotic acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	5.4e-15	35.6
WP_038413195.1\|3333433_3333973_+	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	2.0e-45	55.4
WP_038413197.1\|3333969_3334470_+	DUF2514 domain-containing protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	6.4e-38	78.2
WP_038413200.1\|3334935_3335145_+	hypothetical protein	A0A2H4JG60	uncultured_Caudovirales_phage	5.9e-14	66.7
WP_038413202.1\|3335250_3335547_+	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	2.2e-30	60.8
3336811:3336876	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3530392 : 3554402

uncultured_Caudovirales_phage(47.06%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038413382.1\|3530392_3530707_+	DUF1654 domain-containing protein	A0A2D1GND3	Pseudomonas_phage	4.4e-21	53.4
WP_038413383.1\|3530721_3531528_-	helix-turn-helix domain-containing protein	A0A2D1GNH0	Pseudomonas_phage	1.5e-73	69.8
WP_038413384.1\|3531828_3532416_+	hypothetical protein	A0A059VF83	Pseudomonas_phage	1.2e-48	52.1
WP_038413386.1\|3532587_3532914_+	hypothetical protein	A0A088FVG2	Escherichia_phage	1.1e-22	52.8
WP_038413387.1\|3532910_3533222_+	hypothetical protein	V5YTR7	Pseudomonas_phage	2.3e-06	32.3
WP_038413388.1\|3533296_3533953_+\|tail	phage tail protein	A0A0S2SYG8	Pseudomonas_phage	1.3e-78	66.5
WP_028693951.1\|3533962_3534346_+	hypothetical protein	A0A2H4IYQ5	uncultured_Caudovirales_phage	1.1e-34	57.5
WP_049870616.1\|3534408_3534660_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	1.5e-24	66.7
WP_156109573.1\|3535848_3537081_+	hypothetical protein	A0A2H4J7J3	uncultured_Caudovirales_phage	1.7e-28	46.9
WP_038413390.1\|3537080_3537419_+\|tail	phage tail protein	A0A2H4JI07	uncultured_Caudovirales_phage	4.7e-37	64.3
WP_038413391.1\|3537428_3538178_+\|tail	phage minor tail protein L	A0A0S2SY57	Pseudomonas_phage	6.2e-114	73.9
WP_038413392.1\|3538180_3538945_+	C40 family peptidase	A0A2H4J1J7	uncultured_Caudovirales_phage	1.3e-114	72.4
WP_038413393.1\|3539067_3539697_+\|tail	tail assembly protein	A0A2H4J1H0	uncultured_Caudovirales_phage	7.4e-60	62.4
WP_038413394.1\|3540397_3549355_+	DUF1983 domain-containing protein	A0A2H4J8Z6	uncultured_Caudovirales_phage	0.0e+00	63.3
WP_038413395.1\|3549354_3549633_+	hypothetical protein	NA	NA	NA	NA
WP_038413396.1\|3549632_3550295_+	hypothetical protein	NA	NA	NA	NA
WP_038413397.1\|3550476_3550713_+	hypothetical protein	NA	NA	NA	NA
WP_038413399.1\|3550939_3551479_+	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	3.8e-44	60.0
WP_038413400.1\|3551475_3551979_+	DUF2514 family protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	8.7e-19	60.1
WP_038413402.1\|3552254_3554402_+\|tail	tail fiber domain-containing protein	A0A286MN82	Klebsiella_phage	1.2e-21	38.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage