CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP016822	Rhodococcus sp. p52 plasmid pDF03, complete sequence	0 crisprs	NA	0
NZ_CP016821	Rhodococcus sp. p52 plasmid pDF01, complete sequence	0 crisprs	csa3	1
NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	0 crisprs	csa3	1
NZ_CP016819	Rhodococcus sp. p52 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,c2c9_V-U4,WYL,DinG,cas4,Cas9_archaeal	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

105124 : 136771

Mycobacterium_phage(50.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157126919.1\|105124_106361_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.6e-29	36.3
WP_084295185.1\|107030_107492_+	FAD-binding protein	NA	NA	NA	NA
WP_084295170.1\|107374_108316_-	maleylpyruvate isomerase family mycothiol-dependent enzyme	NA	NA	NA	NA
WP_065996615.1\|108312_109176_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_033098819.1\|109172_110288_-	cupin domain-containing protein	NA	NA	NA	NA
WP_033098818.1\|110340_110952_-	hypothetical protein	NA	NA	NA	NA
WP_033098817.1\|110951_112643_-	AMP-binding protein	A0A2K9KZV5	Tupanvirus	2.7e-11	25.7
WP_033098816.1\|112642_114727_-	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_033098815.1\|114719_116330_-	2-polyprenyl-6-methoxyphenol hydroxylase	NA	NA	NA	NA
WP_052040224.1\|116415_117258_-	PaaX family transcriptional regulator	NA	NA	NA	NA
WP_065996616.1\|117861_119094_-	hypothetical protein	NA	NA	NA	NA
WP_032492322.1\|119178_120021_-	alpha/beta fold hydrolase	A0A222ZNA0	Mycobacterium_phage	4.4e-07	26.1
WP_033098858.1\|120022_120949_-	biphenyl 2,3-dioxygenase	NA	NA	NA	NA
WP_052040251.1\|121427_122675_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	3.6e-183	77.5
WP_157127026.1\|122770_124032_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.2e-30	34.4
WP_033098836.1\|124302_125373_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157127027.1\|126005_126158_+	hypothetical protein	NA	NA	NA	NA
WP_084295187.1\|126592_128017_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_032492317.1\|128016_128556_+	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_052040236.1\|128638_129010_+	non-heme iron oxygenase ferredoxin subunit	NA	NA	NA	NA
WP_033098834.1\|129412_130648_+	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
WP_033098835.1\|131134_131536_-	hypothetical protein	NA	NA	NA	NA
WP_157127028.1\|131597_131810_-	hypothetical protein	NA	NA	NA	NA
WP_032492322.1\|131918_132761_-	alpha/beta fold hydrolase	A0A222ZNA0	Mycobacterium_phage	4.4e-07	26.1
WP_033098858.1\|132762_133689_-	biphenyl 2,3-dioxygenase	NA	NA	NA	NA
WP_052040251.1\|134167_135415_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	3.6e-183	77.5
WP_157127026.1\|135509_136771_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.2e-30	34.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016820

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

38989 : 105430

Mycobacterium_phage(30.77%)

transposase,integrase

attL 101505:101521|attR 105961:105977

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157126995.1\|38989_40257_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.2e-70	51.3
WP_065996575.1\|40739_41495_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_033098502.1\|41563_42325_+	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_033098503.1\|42321_42891_+	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_033098504.1\|42896_44141_+	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_033098505.1\|44137_45337_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_033098547.1\|46029_46626_-	recombinase family protein	A0A219YB42	Aeromonas_phage	1.9e-33	45.6
WP_033098507.1\|46972_47839_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_052040169.1\|47944_48457_-	hypothetical protein	NA	NA	NA	NA
WP_084295140.1\|48453_48993_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_033098508.1\|49247_49865_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.5e-36	50.0
WP_033098509.1\|49990_51160_-	TniQ family protein	NA	NA	NA	NA
WP_033098510.1\|51156_52074_-	AAA family ATPase	NA	NA	NA	NA
WP_033098511.1\|52067_53747_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	6.3e-05	23.4
WP_033098512.1\|53999_54359_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033098513.1\|54355_54952_+	cadmium transporter	NA	NA	NA	NA
WP_157126996.1\|55436_58007_+	hypothetical protein	NA	NA	NA	NA
WP_033098515.1\|58362_59952_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_033098516.1\|60279_60525_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_033098517.1\|60546_60804_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2P1N333	Gordonia_phage	1.0e-15	50.6
WP_033098518.1\|61401_61977_-	ParA family protein	A0A222ZPB1	Mycobacterium_phage	1.2e-40	48.7
WP_157126997.1\|64340_64676_+	hypothetical protein	NA	NA	NA	NA
WP_084295142.1\|64714_66565_-	AAA family ATPase	V5UQN3	Mycobacterium_phage	6.7e-16	26.6
WP_033098553.1\|67785_69588_-	relaxase domain-containing protein	NA	NA	NA	NA
WP_065996578.1\|69898_70195_+	hypothetical protein	NA	NA	NA	NA
WP_033098522.1\|70349_70766_+	hypothetical protein	NA	NA	NA	NA
WP_033098523.1\|71316_71886_-	hypothetical protein	NA	NA	NA	NA
WP_157126998.1\|72089_72863_-	RES domain-containing protein	NA	NA	NA	NA
WP_017835891.1\|72957_73338_-	hypothetical protein	NA	NA	NA	NA
WP_033098525.1\|73633_73972_+	Lsr2 family protein	A0A2H4PGG5	Streptomyces_phage	1.8e-12	43.4
WP_033098526.1\|74156_75212_-	DUF2236 domain-containing protein	NA	NA	NA	NA
WP_084295144.1\|76344_77190_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	8.6e-19	31.5
WP_052040173.1\|78202_78445_-	hypothetical protein	NA	NA	NA	NA
WP_052040174.1\|78453_79098_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.4e-05	34.3
WP_033098528.1\|79579_80356_-	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_033098529.1\|81248_82040_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_033098530.1\|82071_82986_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_033098531.1\|83113_84187_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_019287415.1\|84286_85618_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_019287416.1\|85614_86118_+	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_157126999.1\|86095_86407_+	hypothetical protein	NA	NA	NA	NA
WP_065996580.1\|86467_87427_+	alpha/beta fold hydrolase	A0A1D8EVD1	Mycobacterium_phage	2.9e-07	29.1
WP_033098533.1\|87426_88299_+	extradiol dioxygenase	NA	NA	NA	NA
WP_006897065.1\|88295_88568_+	hypothetical protein	NA	NA	NA	NA
WP_019287421.1\|88564_88810_+	ferredoxin	NA	NA	NA	NA
WP_033098534.1\|89783_90926_+	MFS transporter	NA	NA	NA	NA
WP_033098535.1\|91001_91868_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	9.3e-53	40.0
WP_033098536.1\|92006_93470_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_019287426.1\|93472_94084_+	3-phenylpropionate/cinnamic acid dioxygenase subunit beta	NA	NA	NA	NA
WP_033098537.1\|94080_94386_+	hypothetical protein	NA	NA	NA	NA
WP_033098538.1\|94433_94631_+	ferredoxin	NA	NA	NA	NA
WP_033098539.1\|94627_95860_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_052040175.1\|95856_96609_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_033098540.1\|96655_97456_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_065996581.1\|97784_99149_+\|transposase	IS1380 family transposase	A0A222ZN33	Mycobacterium_phage	2.8e-120	53.6
WP_157127000.1\|100446_100590_-	hypothetical protein	NA	NA	NA	NA
WP_033098559.1\|100830_101820_-	hypothetical protein	NA	NA	NA	NA
101505:101521	attL	NA	NA	NA	NA
WP_157127001.1\|101875_103498_-	hypothetical protein	NA	NA	NA	NA
WP_033098544.1\|103979_104306_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033098545.1\|104305_105430_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
105961:105977	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP016819

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016819_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016819_1

1702235-1702350

Orphan

Consensus_repeat	Method
CCGTACTGAGGAGCGCCGAACTGGGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP016819_1

>merge|NZ_CP016819|1|1702235-1702350|CRISPRCasFinder
CCATCCTGCGGCGCCCCGTACGGGGGTGCACCGTACTGAGGAGCGCCGAACTGGGGCGCACCGAATTGGGGCGTTCCGTTCTGCGGGGTTCCGTACTGAGGAGCGCCGTACTGGGG

>NZ_CP016819|1|1|1702235-1702350|CRISPRCasFinder
CCATCCTGCGGCGCCCCGTACGGGGG	TGCACCGTACTGAGGAGCG
CCGAACTGGGGCGCACCGAATTGGGG	CGTTCCGTTCTGCGGGGTT
CCGTACTGAGGAGCGCCGTACTGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016819.1\|WP_033097944.1\|1691370_1692348_+\|ROK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378956
NZ_CP016819.1\|WP_019290292.1\|1708390_1709056_-\|DUF1275-domain-containing-protein	unknown	unknown	gnl\|CDD\|377734
NZ_CP016819.1\|WP_065996493.1\|1695460_1698202_+\|calcium-translocating-P-type-ATPase,-PMCA-type	unknown	unknown	gnl\|CDD\|319781
NZ_CP016819.1\|WP_006552507.1\|1710268_1710532_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016819.1\|WP_024102753.1\|1707752_1708337_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP016819.1\|WP_033097943.1\|1698364_1699603_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182234
NZ_CP016819.1\|WP_024102747.1\|1692428_1693310_-\|LysR-family-transcriptional-regulator-ArgP	unknown	unknown	gnl\|CDD\|235144
NZ_CP016819.1\|WP_006552522.1\|1693382_1693985_+\|amino-acid-transporter	unknown	unknown	gnl\|CDD\|224198
NZ_CP016819.1\|WP_006552511.1\|1706961_1707699_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|211705
NZ_CP016819.1\|WP_033097942.1\|1703611_1704544_-\|tRNA-glutamyl-Q(34)-synthetase-GluQRS	unknown	unknown	gnl\|CDD\|235573
NZ_CP016819.1\|WP_006552521.1\|1693989_1694889_-\|cation-transporter	unknown	unknown	gnl\|CDD\|223131
NZ_CP016819.1\|WP_033097939.1\|1710964_1712257_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|372371
NZ_CP016819.1\|WP_033097971.1\|1700878_1701610_-\|queuosine-precursor-transporter	unknown	unknown	gnl\|CDD\|376842
NZ_CP016819.1\|WP_065996494.1\|1699614_1700859_+\|tRNA-guanosine(34)-transglycosylase-Tgt	unknown	unknown	gnl\|CDD\|234642
NZ_CP016819.1\|WP_006552525.1\|1689277_1691167_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP016819.1\|WP_006552520.1\|1694892_1695312_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|378988
NZ_CP016819.1\|WP_033097941.1\|1705576_1706965_+\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP016819.1\|WP_006552514.1\|1702598_1703525_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227760
NZ_CP016819.1\|WP_065996495.1\|1704553_1705453_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP016819.1\|WP_033097940.1\|1709195_1710245_+\|DUF1524-domain-containing-protein	unknown	unknown	gnl\|CDD\|377857

Protein	Function_ID	Function_description	E-value
NZ_CP016819.1\|WP_033097944.1\|1691370_1692348_+\|ROK-family-transcriptional-regulator	gnl\|CDD\|378956	pfam12802, MarR_2, MarR family. The Mar proteins are involved in the multiple antibiotic resistance, a non-specific resistance system. The expression of the mar operon is controlled by a repressor, MarR. A large number of compounds induce transcription of the mar operon. This is thought to be due to the compound binding to MarR, and the resulting complex stops MarR binding to the DNA. With the MarR repression lost, transcription of the operon proceeds. The structure of MarR is known and shows MarR as a dimer with each subunit containing a winged-helix DNA binding motif.	0.000833815
NZ_CP016819.1\|WP_019290292.1\|1708390_1709056_-\|DUF1275-domain-containing-protein	gnl\|CDD\|377734	pfam06912, DUF1275, Protein of unknown function (DUF1275). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown although most members have 6 TM regions, and may be putative permeases.	2.67157e-32
NZ_CP016819.1\|WP_065996493.1\|1695460_1698202_+\|calcium-translocating-P-type-ATPase,-PMCA-type	gnl\|CDD\|319781	cd02089, P-type_ATPase_Ca_prok, prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL and Listeria monocytogenes LMCA1. Ca(2+) transport ATPase is a plasma membrane protein which pumps Ca(2+) ion out of the cytoplasm. This prokaryotic subfamily includes the Ca(2+)-ATPase Synechococcus elongatus PacL, Listeria monocytogenes Ca(2+)-ATPase 1 (LMCA1) which has a low Ca(2+) affinity and a high pH optimum (pH about 9) and may remove Ca(2+) from the microorganism in environmental conditions when e.g. stressed by high Ca(2+) and alkaline pH, and the Bacillus subtilis putative P-type Ca(2+)-transport ATPase encoded by the yloB gene, which is expressed during sporulation. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP016819.1\|WP_024102753.1\|1707752_1708337_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.18736e-08
NZ_CP016819.1\|WP_033097943.1\|1698364_1699603_+\|MFS-transporter	gnl\|CDD\|182234	PRK10091, PRK10091, MFS transport protein AraJ; Provisional.	9.76225e-92
NZ_CP016819.1\|WP_024102747.1\|1692428_1693310_-\|LysR-family-transcriptional-regulator-ArgP	gnl\|CDD\|235144	PRK03635, PRK03635, ArgP/LysG family DNA-binding transcriptional regulator.	9.50089e-138
NZ_CP016819.1\|WP_006552522.1\|1693382_1693985_+\|amino-acid-transporter	gnl\|CDD\|224198	COG1279, COG1279, Lysine efflux permease [General function prediction only].	5.12752e-61
NZ_CP016819.1\|WP_006552511.1\|1706961_1707699_+\|SDR-family-oxidoreductase	gnl\|CDD\|211705	TIGR01963, D-beta-hydroxybutyrate_dehydrogenase, 3-hydroxybutyrate dehydrogenase. This model represents a subfamily of the short chain dehydrogenases. Characterized members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polmers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.	6.12434e-100
NZ_CP016819.1\|WP_033097942.1\|1703611_1704544_-\|tRNA-glutamyl-Q(34)-synthetase-GluQRS	gnl\|CDD\|235573	PRK05710, PRK05710, tRNA glutamyl-Q(34) synthetase GluQRS.	5.79965e-123
NZ_CP016819.1\|WP_006552521.1\|1693989_1694889_-\|cation-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	2.65539e-77
NZ_CP016819.1\|WP_033097939.1\|1710964_1712257_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|372371	pfam12897, Aminotran_MocR, Alanine-glyoxylate amino-transferase. These proteins catalyze the reversible transfer of an amino group from the amino acid substrate to an acceptor alpha-keto acid. They require pyridoxal 5'-phosphate (PLP) as a cofactor to catalyze this reaction. Trans-amination reactions are of central importance in amino acid metabolism and in links to carbohydrate and fat metabolism. This class of aminotransferases acts as dimers in a head-to-tail configuration.	0
NZ_CP016819.1\|WP_033097971.1\|1700878_1701610_-\|queuosine-precursor-transporter	gnl\|CDD\|376842	pfam02592, Vut_1, Putative vitamin uptake transporter.	8.32448e-52
NZ_CP016819.1\|WP_065996494.1\|1699614_1700859_+\|tRNA-guanosine(34)-transglycosylase-Tgt	gnl\|CDD\|234642	PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional.	5.88317e-176
NZ_CP016819.1\|WP_006552525.1\|1689277_1691167_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	8.61678e-179
NZ_CP016819.1\|WP_006552520.1\|1694892_1695312_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|378988	pfam12900, Pyridox_ox_2, Pyridoxamine 5'-phosphate oxidase. Pyridoxamine 5'-phosphate oxidase is a FMN flavoprotein that catalyzes the oxidation of pyridoxamine-5-P (PMP) and pyridoxine-5-P (PNP) to pyridoxal-5-P (PLP). This entry contains several pyridoxamine 5'-phosphate oxidases, and related proteins.	3.99365e-25
NZ_CP016819.1\|WP_033097941.1\|1705576_1706965_+\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.15411e-173
NZ_CP016819.1\|WP_006552514.1\|1702598_1703525_-\|hypothetical-protein	gnl\|CDD\|227760	COG5473, COG5473, Predicted integral membrane protein [Function unknown].	6.74532e-14
NZ_CP016819.1\|WP_065996495.1\|1704553_1705453_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.46529e-23
NZ_CP016819.1\|WP_033097940.1\|1709195_1710245_+\|DUF1524-domain-containing-protein	gnl\|CDD\|377857	pfam07510, DUF1524, Protein of unknown function (DUF1524). This family of uncharacterized proteins contain a conserved HXXP motif. A similar motif is seen in protein families in the His-Me finger endonuclease superfamily which suggests this family of proteins may also act as endonucleases.	7.07235e-38

>NZ_CP016819.1|WP_033097971.1|1700878_1701610_-|queuosine-precursor-transporter
MTEHGSNTSPALFDHAAFARVGRSPYTGIVVLFTAVLMISNISATKGIAFFTGSELTVGPLQILPIITDGGFFLFPLAYILGDVLSEVYGFAATRRAVFYGFGAVALSALCFWITQQLPPADFYAGQESFENVLGVVPRMLIAGLAGYAVGQLLNSYVLVRIKERTREKHLWARLIGSTVVGEFADTLIFCSIAAGAIGITTWADFVNFVIVGFLWKTLVEIVVLPVTYRVIAYVKKREPSYA
>NZ_CP016819.1|WP_065996494.1|1699614_1700859_+|tRNA-guanosine(34)-transglycosylase-Tgt
MPTPPDPFFTVGARLDNGLGRTGTIHTPHGDIRTPAFVPVGTKATVKAVLPETMAELGSQALLANAYHLYLQPGSDIVDEAGGLGKFMNWPGPTFTDSGGFQVMSLGAGFKKVIAMESVGVQNDDVIAKGKERLAPVDDDGGTFKSHLDGSRHRFTPEVSMRIQHELGADIMFAFDELTTLMNTRGYQERSLERTQAWAVRCIAEHEKLTAERARRPYQALFGVVQGAQYEDLRRQACRGLESIVGETGRGFDGYGIGGALEKHNLGTIVRWCTEELPEHKPRHLLGISEPDDIFVAVEHGVDTFDCVNPSRVARNAAIYHPDGRFNINTSRHRRDFTPIDENCDCYTCRNYTRAYIHHLFKAKEMLASTLCTIHNERFTVRLVDDIRANMENGTLAEFKAETLGRFYASRRRA
>NZ_CP016819.1|WP_033097943.1|1698364_1699603_+|MFS-transporter
MTTTASGRPLDDPAHTDSGHPARTLVMWALALGGFGIGTTEFVAMGLLPEIATSIGVSEPTAGHVVSAYAAGVVVGAPLIATIAARVPRKTLLVALMVAFTLGNAATVLAPSYGLLVVSRFVAGLPHGAYFGVAALVAAHLAGPGRRARAVSLVMMGLSVANVVGVPAASWLGMALGWRAAFVLVAVIGVATVVALAAWVPTLSIPTTSVRVELGALKSSTVWLTLAVAVIGFGGVFAVYTYISTTLTDVAGVSRSLVPVALMLFGVGMVVGNAIGGRVADRGVIPGVYASITSLAVLLALFVAAAHNPWTAFVMVFGLGVGCAAVGPALQVRLMDVAEDAQTLAASLHHAAFNLANAFGAWIGGVVIAAGFGYTAPAAVGVLLALAGVAVFAISVRRREKAAPSRRDWIRK
>NZ_CP016819.1|WP_065996493.1|1695460_1698202_+|calcium-translocating-P-type-ATPase,-PMCA-type
MSAQAPATTSSWHTRAATDVAEAFEVDPQRGLSADEVERRRGEYGPNLLDEAKKVPTWRRVLSLLADRMTLVLVVAAVVSATVSREWETPVVIFAVIALNTVLNYVQESRAESSLAALKKMSVSTSRVLRDGRGTEVPRAELVPGDVVLLEAGDTVPADGRLVTAVRLQVAEAALTGESQPVDKQVDVVDDPDAPLGDRTDMLFMNTEVTRGRAAMIVTGTGMRTEMGAIATLLGSAGVEQTPLQRRIGQLAQALTIIAIVTVALVFVLGLLRGQTWSDLLVTAVSLAVATIPEGLTAVVAFTLAMGASRLAARGAIVKRLAAVETLGSTTHICTDKTGTLTLNEMTVQRLLVAGRAFRVTGTGYGTDGKILVGDGLPAPDFTDALLGMGLCNDATVRNGILVGDPTEGALVVLAEKGGIDVEGARAALNRIAEVPFDSDYKYMATFHTLPNGGYRCFAKGAPGVLLDRATSIAGPDGPIPLDDDGRARIHRAVEALASEGLRTLMIAGRDLDAVPRGDTDALQEKVADLTIHAIVGIVAPPRTEAEDAIAVAHEAGISVHMITGDHLVTASAIAEELGIRGSAASGADLDKLTDDELRRRAKEFGVLARVAPQHKIRFVEALQADGQIVAMTGDGVNDAPALEQSDIGVAMGITGTDVSKGAADMILTDDNFATIVAAVAEGRGIYDNIIKFVKFQLTTAWGFVLIFLTAGVLGLAGGAPFSALQILWVNIIMDGPPALALGVDPTAPDAMRRRPRPANEALLERSRVQRILGLGIVMTVGTIAVLHFGPELFPDSASDPLFATTLAFTTFVFYQVFNLFNVRSDLGSVFSAQTFTNHTIWIAIGAVVVLQICVVQLGALQGFMDTTSLTSEQWLLAVAVGSSVLWVDEIGKFVARRIEARRAERADTTFLT
>NZ_CP016819.1|WP_006552520.1|1694892_1695312_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MRDNPNTDDPVVPLDEDQCWDLLATGKVGRLVTVVGGRPEIYPVNYVTDDRTVYFRSGEGSKLSELAVHPQVAFEVDEIREDSAWSVVLHGHARILRSFDDAARIDALGLSPWVPTPKYDYVALTATDLTGMQLTLVKR
>NZ_CP016819.1|WP_006552521.1|1693989_1694889_-|cation-transporter
MVPSAQQHRLLMRFMLLSVATALATMLLKASAAWITGSVGLLSDALESGVNLVAALVGLAALRLAAKPADANHDFGHGKAEYLSAAVEGTMVFAAATVILWTSVERLISPQPVTEVGLGLLLSAGSSALNLVVGLLLIRQGRAHRSITLVADGKHLLTDVWTSAGVLVGVALVALSGWDVLDPIVAILVALNILRIGFGLVRQAVVGMLDAVLPPEDVTAVNAVLDRYREPGVVTILPPRTRESGRQRFVYLVVRVPGDWTVRAGHDLLDRIEADLAEALPGVVVFSHLEPDRAPTGRR
>NZ_CP016819.1|WP_006552522.1|1693382_1693985_+|amino-acid-transporter
MSLVVAGFVTGLSLIAAIGAQNAFVLRMAIARRFVLPVIAICVISDAVLITAGIAGIATILDRAPGAIDVIRWAGAAFLICYGLFAARRALKPSALSAAPGGAVTIGAALLTCLALTWLNPHTYLDTVLMLGSVANHYGNPGRWWFGAGAITASVVWFAALGYGARYLRAWFAKPSSWRILDGGVAVLMLGLGAGLVASS
>NZ_CP016819.1|WP_024102747.1|1692428_1693310_-|LysR-family-transcriptional-regulator-ArgP
MDLDFAQLRTFATVLDEGTFEGAAAVLRVTPSAVSQRIKSLEQHVGQVLLRRTRPVSATAAGEVVMRLARQVARLEQDASEELGLGADTGSYATIPLVVNADSMSTWMLRALARMPVRYRALFELHREDEFHSTDLLRDGTAMAAVTSVPEPVQGCTSEKLGAMRYHAMASVDFAERWFPEGMTPTELREAPMLTFDRKDDMQDRFVRKRTRRRLNPPRNYVPGALEFVEAARLGLGWAMLPDAMVADTTDLVSLAPDDPIAVPLYWQRWRLDSPVLDALTDAVRRTAREVLH
>NZ_CP016819.1|WP_033097944.1|1691370_1692348_+|ROK-family-transcriptional-regulator
MQHLRRGGPATRTMLADFTGLSASTVNRAVTSLLEHGLLRDRPDLAPRGRVGRPHVPVEVDTERGFLAGIHLGERETRVVSGDLLGRELHRTTFATPASVFDVFAAIGAALRVHESHQRGRQPLWAGLAVGGLYDEHRGALDHPRLGWCEAPVDVLFRAIVPTPYTVVPYVEAVAEVEYRRCESAFRRRPESWLYLCAEESISMAWLVDGLARSSADDIESFCAVLEPGSAGGTDPSPNQAVLLGRAVALVRDVVNPDVVTVGGELFTRHGREREDVSDGYRQQSSYNDVPLRFSEADDDLRSAAALGAASRVMYVDPIGAMQAR
>NZ_CP016819.1|WP_006552525.1|1689277_1691167_+|ABC-transporter-ATP-binding-protein
MTTPEAAAPSRLRTVRRVLGLLHPHRYAVYSVLLSAFLGVVSMSVAPFVLGRGTDVIFDGVVGMQFPAGQTKEEAVAGLRAEGRDQFADMVSGMDVVPGLGIDFSALGRILVIVLALYLLSSGLIWVAAYGLNEIVQRVVRDMRSRIERKIHRLPLRYFDTHSRGDLLSRVTNDIDNVAAGMQESISQLVLAVLTLLGLVVMMLFISPMLALVAILTVPASVVATAVIARRSRKHFLAQWETTGKLNGQIEEAFTGHELITAYSRTAEVQRRFTDTNESLYQASYRAQFVSGLVMPFVTFLGNVGYVVIAVLGGLRIASGTATLGEIQAMIQYSRQLVQPLAQIGAMVNLLQSASASAERVFAVLDEPEEEPEVAAPTMPWSRHGLVEFENVAFSYTPDRPLIENLSLRAEPGQMIAIVGPTGAGKTTLINLILRFYEVDAGRILVDGVDIRSMSRDELRSRIGIVLQDTWLFGGTIRENIAYGNPYATENQIMSAARMSYVDRFVRALPDGYDTIIDEENDGNLSAGERQLITIARAFVSKPSILILDEATSSVDTRTELLVQQATARLRDDRTSFVIAHRLSTIRNADRIVVMEDGRIVEQGTHEGLLEAAGAYARLYDAQFKALVE
>NZ_CP016819.1|WP_006552514.1|1702598_1703525_-|hypothetical-protein
MTTGGYDPNQDPKNPGGYPPPGSYPPPSGGGTPPPGGNYPPPGNYPPPGNYPPPSGGNYPPPGGSYPPPGNYPPPPSGGDYPPPPGAYGAGSFGGPPPNQLNVGDAISYGWSKFSGNAGVWIVFMLAAFVIQGLISGIFNGFDFTGEATDFTFLSAIGSIVSAIVGYLIQAAFVRGALAETDGQRPAFGTFLQIGPIGAVILAGLLVGIGTSIGLVLCILPGLVFAFFAWWTMQFVIDRNQDAVTAIKSSFNAVKSNAGTLVLLALALLGINLLGALLCLIGLLVTVPVSIIAVTYAYRVTTGGPVAA
>NZ_CP016819.1|WP_033097942.1|1703611_1704544_-|tRNA-glutamyl-Q(34)-synthetase-GluQRS
MSLSDEDEAGAGRFAPSPSGDLHLGNLRTAVLAWLFARSTNRRFLVRVEDLDRVRPGAEQRQLADLAAIGLDWDGRVVHQSRRRRLYDEAIARLEQAGLTYECYCTRREILEATSAPHAPAGAYPGTCRNLTDEQRAERRASGRAPAIRLRATEEWFTVHDLLHGDFTGIVDDLVLRRNDGTPAYNLAVVVDDADQGIDQVVRGDDLLTSAPRQACLAHLLGLSEPVYAHVPLALGKEGKRLAKRDGAVTLADQLALGHTAADVLGTIAVSLRLADPGEPVSPELLLDRWNPVRLPRDPWVFTPSEEGIR
>NZ_CP016819.1|WP_065996495.1|1704553_1705453_-|LysR-family-transcriptional-regulator
MSVPSADDLLVLLAVGRSGRVTSAADDLGVNHTTISRRIAALERSLGGRVLTRSAAGWELTDRGREALEAAERIEAAVGSLRNPRGERRLEGVVRISATDGFSAYIAAPAGALVRQRHPGISVEIVATTRRASQQRSGMDIEVVVGRPQVHRAEAHRLADYNLGLYASRDYLATHGSPSSVRDLREHTLVYFIDSMLQVDDLDVARRIAPDMQDSISSTNVFVHVEATRAAGGLGLLPCFMADRHPDLVRVLPGEVEARLAYWLLARSETLRQPEVAAAVAAIREVVHAQRAVLLGVAR
>NZ_CP016819.1|WP_033097941.1|1705576_1706965_+|MHS-family-MFS-transporter
MSVEQARTDGPESSPSALRRVVGASMAGTVVEWYEFFLYGTAATLVFAKVFFPDGGNELDAIIAAFVTYAVGFVARPLGGIVFGHFGDRFGRKQLLQTSIIMVGVATFLMGCLPTFGAIGYWAPALLVTLRFIQGFAVGGEWGGAVLLVAEHSPNRSRGFWSSWPQAGVPMGNLLATIVLLVLTTTLPESAFLSWGWRVAFWLSAVIVLIGYYIRTKVTDAPIFLEAQQEADKLKETSFNVFEVLERYPRGVFTAMGLRFAENVMYYLVVTFSITYLKIVVGADTSHILWWMLAAHAVHFVIIPMVGRLSDTLGRRPVYMIGAVTAGAWGFLAFPMMDTGNSAWIISAIVIGLVFHSFMYAGQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSLAPIIAASLLSRFESSVPISFYLLGSSLITIVAVIVARETKGISLRDIDAADAETVAQKKAAENARISA
>NZ_CP016819.1|WP_006552511.1|1706961_1707699_+|SDR-family-oxidoreductase
MRARTALVTGGVGGIGAACARALARQGVRVTVADVDEVAAKTLAHEIGGEAWGVDLLDTDGLDGLRLDVDILVNNAGIQVVRPVEDFALADFRRIQTLMVEAPFLLVKAALPGMYERGFGRIVNISSVHGLRASAFKAGYVTAKHGLEGFSKVVALEGGPRGVTSNCVNPGYVRTPLVEKQISEQARAHDIPEDRVLSDVLLTDQAVTRLVEPEEVASLVSWLASDEAGMVTGASYTMDGGWSAH
>NZ_CP016819.1|WP_024102753.1|1707752_1708337_-|TetR/AcrR-family-transcriptional-regulator
MRTRPYITTSPTRLAAALLDVAARNGLDAASVREVANEAGVSIGAVQHHFPTKDEMLAYSFRTLSDRVLNRLTNVDPDIDPARTLFSALSQLLPLDEERGSEVHVMSAFAVRAVTSPTLSAIRTATLFTIRTGIARVLIRAGTPDPETRAALLLSAANGLALDAAASPELYPREYLTHALHAQVQLVLDGADAH
>NZ_CP016819.1|WP_019290292.1|1708390_1709056_-|DUF1275-domain-containing-protein
MVGYGRQLQGLAIALSSLAGFIDALGFITLGGVFVSFMSGNSTRFAVGTADGAWQTVALIGGVLALFVLGVILGSVVAELTDRDRRTRKIAVLATVTVLLTVAAAAVLVDWTPVAVIAMTLAMGTENSVFRRLGETTVALTYMTGALVKIGQRIAAAFFGGPRWSWLPYLGLWGGLVTGAVLGALAHRVLGLHALWIAAAFAAALTVSVRFLSDRELTDGV
>NZ_CP016819.1|WP_033097940.1|1709195_1710245_+|DUF1524-domain-containing-protein
MSLPRLSSRLSLLVVATVAGLTLTGCDSTTEDTSVAPAATSEQSPVPSSETPTTTPSPTTTRSTSTTAPNPAASADSSEALARLATLPIKGRAPKTGYSRDLFGQAWSDDVSVEFGGNGCDTRNDILRRDLVDIVYRPGTRDCVVASGTLNDLYTGTTIAFTRGQDTSTAVQIDHVVALSDAWQKGAQQLDAGTRADFANDPRNLQAVDGPTNQQKSDGDAATWLPPNRAYRCTYVARQIEVKAIYGLWVTQAEHDAMARVLTECGGGAPAAAPAPTTTTRQAPAPAPAPSPAPAPVPAPAPAEPAPAPAEVYYKNCAAARAAGAAPLYVGEPGYRPKMDGDGDGVACE
>NZ_CP016819.1|WP_006552507.1|1710268_1710532_-|hypothetical-protein
MRLVTADDNFPLGGDADHEQASVWVEMLDREIDEVSAAIEKTEQKALAEHRVGAVDRARRFDAEVERLGAQLRELHRMRRNLTHRFS
>NZ_CP016819.1|WP_033097939.1|1710964_1712257_+|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MPTQTQYGLMSHEELVAEHERQSANYERLKSEKLTLDLTRGKPSPEQLDLSAELLSLPGADDFRDGSGTDTRNYGGLTGLPELRAIFAELLNIPVENLVAGNNASLEIMHDLVVWSLLHGTVDSPRPWSQESVVKFLCPAPGYDRHFAITESLGIEMIPVPLREDGPDVRFIADLVANDPQIKGMWAVPTYSNPTGAVYSEEVARELVSIPTAAPDFRIFWDNAYAVHPLTEHLAPAIDILGLAAQAGHPNRVFALASTSKITFAGSGVSFFGSSTENLTWYQKYLGIKTIGPDKVNQLRHLRFFRDADGVRAHMATHREILAPKFALVRRILEERLGTSKVASWTEPEGGYFISLDVVEGTAARVIALAKEAGIALTGAGSAFPYKKDPEDKNIRLAPSFPSLGELEKAMDGVATCVLLAAAEKALADK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1805980 : 1870080

Tupanvirus(23.53%)

protease,transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033097904.1\|1805980_1807168_+\|protease	MarP family serine protease	NA	NA	NA	NA
WP_065996501.1\|1807195_1808131_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_006552419.1\|1808147_1808663_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_065996502.1\|1808662_1809889_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	4.4e-56	39.1
WP_006552417.1\|1810089_1811460_+	MHS family MFS transporter	NA	NA	NA	NA
WP_065995948.1\|1811520_1813452_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.2e-76	37.1
WP_084294984.1\|1813602_1814400_+	oxidoreductase	NA	NA	NA	NA
WP_065996504.1\|1814848_1815682_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_065995949.1\|1816046_1817117_+	hypothetical protein	NA	NA	NA	NA
WP_019290219.1\|1817113_1818286_+	TadA family conjugal transfer-associated ATPase	NA	NA	NA	NA
WP_033097903.1\|1818282_1819080_+	secretion protein F	NA	NA	NA	NA
WP_033097954.1\|1819076_1819652_+	type II secretion system F family protein	NA	NA	NA	NA
WP_050993523.1\|1819698_1819917_+	DUF4244 domain-containing protein	NA	NA	NA	NA
WP_100167921.1\|1819926_1820301_+	pilus assembly protein TadE	NA	NA	NA	NA
WP_065995950.1\|1820297_1820657_+	flp pilus-assembly TadE/G-like family protein	NA	NA	NA	NA
WP_065995951.1\|1820821_1823170_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	6.5e-08	26.9
WP_003935252.1\|1823605_1823809_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	5.2e-15	57.8
WP_019290213.1\|1823971_1824577_+	hypothetical protein	NA	NA	NA	NA
WP_157126944.1\|1824694_1827640_+	type I DNA topoisomerase	J3E777	Acanthamoeba_polyphaga_lentillevirus	6.7e-103	34.9
WP_065995953.1\|1828562_1829750_+	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	1.5e-08	31.7
WP_006552400.1\|1830153_1830351_+	hypothetical protein	NA	NA	NA	NA
WP_033096939.1\|1836171_1836702_+	hypothetical protein	NA	NA	NA	NA
WP_065995954.1\|1836698_1838078_-	M1 family metallopeptidase	A0A2K9L1R3	Tupanvirus	3.1e-18	22.9
WP_065995955.1\|1838044_1841950_-	non-ribosomal peptide synthetase	NA	NA	NA	NA
WP_065995956.1\|1842301_1843615_+	aminotransferase class V-fold PLP-dependent enzyme	A0A2K9L2Y3	Tupanvirus	2.0e-30	24.6
WP_084294985.1\|1843823_1844441_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_006550528.1\|1844503_1845034_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006550527.1\|1845252_1845726_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_033096937.1\|1845830_1847039_-\|transposase	transposase	A0A1D8ETH9	Propionibacterium_phage	7.7e-130	66.5
WP_065995957.1\|1847156_1847987_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_006550524.1\|1848055_1848547_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	6.3e-30	45.5
WP_019290202.1\|1848809_1850153_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_019290201.1\|1850137_1851199_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_065995958.1\|1851174_1852224_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_006550520.1\|1852236_1852791_+	hypoxanthine phosphoribosyltransferase	A0A2K9L634	Tupanvirus	7.6e-08	25.0
WP_033096935.1\|1853042_1855583_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	3.0e-107	46.3
WP_006550518.1\|1855653_1856319_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	4.2e-45	55.6
WP_006550517.1\|1856315_1857173_+	dihydropteroate synthase	S4VNV0	Pandoravirus	4.4e-23	33.7
WP_033096934.1\|1857169_1857550_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_006550515.1\|1857549_1858092_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_019290198.1\|1858085_1858562_+	DUF3180 domain-containing protein	NA	NA	NA	NA
WP_033096933.1\|1858693_1859758_+	hypothetical protein	NA	NA	NA	NA
WP_065995959.1\|1859917_1860853_+	DUF2520 domain-containing protein	NA	NA	NA	NA
WP_006550511.1\|1860845_1861784_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_006550510.1\|1861828_1862266_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_065995960.1\|1862268_1863102_+	type III pantothenate kinase	NA	NA	NA	NA
WP_033096932.1\|1863195_1863666_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_019290193.1\|1863719_1865231_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	4.9e-73	35.1
WP_006550504.1\|1865326_1865686_+	Lsr2 family protein	A0A160DEV0	Gordonia_phage	8.7e-13	39.3
WP_033096931.1\|1865835_1867266_+	phospholipase D	NA	NA	NA	NA
WP_033096930.1\|1867536_1870080_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	7.8e-132	39.7

DBSCAN-SWA_2

3850664 : 3911408

Burkholderia_virus(14.29%)

tRNA,transposase,integrase

attL 3865206:3865228|attR 3912779:3912801

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033098206.1\|3850664_3851888_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_156895145.1\|3851913_3852429_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q8W6R2	Burkholderia_virus	1.6e-31	51.9
WP_157126991.1\|3852549_3852822_-	hypothetical protein	NA	NA	NA	NA
WP_112320133.1\|3852828_3853994_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.3e-29	36.2
WP_084295038.1\|3854044_3855589_-	hypothetical protein	NA	NA	NA	NA
WP_033098335.1\|3856495_3857665_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_024102494.1\|3857911_3859150_+	PucR family transcriptional regulator	NA	NA	NA	NA
WP_157126963.1\|3859218_3860023_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_033098389.1\|3861741_3864234_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.0e-47	25.9
WP_065996203.1\|3864230_3865361_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
3865206:3865228	attL	NA	NA	NA	NA
WP_006552149.1\|3865489_3866191_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_033098338.1\|3867059_3869426_+	phosphoketolase family protein	NA	NA	NA	NA
WP_065996209.1\|3869429_3870194_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_033098339.1\|3870210_3872697_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_006552154.1\|3872693_3873509_-	trehalose-phosphatase	NA	NA	NA	NA
WP_006552155.1\|3873617_3874685_-	hypothetical protein	NA	NA	NA	NA
WP_006552156.1\|3874805_3875267_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.5e-13	36.4
WP_084295103.1\|3875824_3876715_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033098341.1\|3876866_3878012_-	MFS transporter	NA	NA	NA	NA
WP_065996211.1\|3878008_3878908_-	PAC2 family protein	NA	NA	NA	NA
WP_065996213.1\|3878959_3882529_+	methionine synthase	NA	NA	NA	NA
WP_084295039.1\|3882533_3883229_+	HAD family phosphatase	NA	NA	NA	NA
WP_019289517.1\|3883230_3884091_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_033098344.1\|3884095_3884983_+	pseudouridine synthase	NA	NA	NA	NA
WP_016934619.1\|3885041_3885305_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
WP_006552165.1\|3885398_3886262_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_033098345.1\|3886303_3887143_-	thioesterase family protein	NA	NA	NA	NA
WP_033098346.1\|3887139_3888015_-	RecB family exonuclease	NA	NA	NA	NA
WP_033098347.1\|3888104_3888956_+\|tRNA	tRNA (adenine-N1)-methyltransferase	NA	NA	NA	NA
WP_033098348.1\|3888977_3889457_-	hypothetical protein	NA	NA	NA	NA
WP_065996215.1\|3889644_3891414_+	proteasome ATPase	A0A0K1L651	Scale_drop_disease_virus	2.2e-32	40.9
WP_033098349.1\|3891505_3891892_+	nitroreductase family deazaflavin-dependent oxidoreductase	NA	NA	NA	NA
WP_006552172.1\|3891947_3893441_+	proteasome accessory factor PafA2	NA	NA	NA	NA
WP_006552173.1\|3893607_3893799_+	ubiquitin-like protein Pup	NA	NA	NA	NA
WP_006552174.1\|3893795_3894650_+	proteasome subunit beta	NA	NA	NA	NA
WP_033098350.1\|3894646_3895459_+	proteasome subunit alpha	NA	NA	NA	NA
WP_052040143.1\|3895356_3896958_-	bifunctional phosphatase PAP2/diacylglycerol kinase family protein	NA	NA	NA	NA
WP_157126964.1\|3896989_3898348_+	Pup--protein ligase	NA	NA	NA	NA
WP_006552178.1\|3898436_3899432_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_033098351.1\|3899428_3900439_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_033098352.1\|3900566_3900821_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_033098353.1\|3900925_3901888_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_033098354.1\|3901884_3904641_+	DEAD/DEAH box helicase	M1I8L9	Paramecium_bursaria_Chlorella_virus	1.1e-62	33.0
WP_081263547.1\|3905360_3905627_+	DUF4333 domain-containing protein	NA	NA	NA	NA
WP_065996219.1\|3905637_3906615_-	5'-3' exonuclease	F8WQ40	Bacillus_phage	2.3e-15	28.6
WP_065996220.1\|3906650_3907781_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_033098357.1\|3907928_3908675_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_065996221.1\|3909137_3909971_-	AAA family ATPase	NA	NA	NA	NA
WP_052040144.1\|3909974_3911408_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
3912779:3912801	attR	NA	NA	NA	NA

DBSCAN-SWA_3

4600222 : 4622972

Rhodococcus_phage(35.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033097157.1\|4600222_4601680_-	SGNH/GDSL hydrolase family protein	A0A0A0RS52	Bacillus_phage	4.4e-23	29.4
WP_033097156.1\|4601683_4602169_-	hypothetical protein	NA	NA	NA	NA
WP_033097155.1\|4602282_4602651_+	hypothetical protein	NA	NA	NA	NA
WP_033097154.1\|4602708_4603002_-	hypothetical protein	A0A2H4JC25	uncultured_Caudovirales_phage	2.7e-20	50.5
WP_065996370.1\|4603013_4604261_-	fibronectin type III domain-containing protein	A0A2H4JC23	uncultured_Caudovirales_phage	3.4e-16	48.0
WP_065996372.1\|4604260_4604608_-	hypothetical protein	A0A1W6JQC8	Corynebacterium_phage	6.4e-05	34.6
WP_065996378.1\|4604604_4605027_-	hypothetical protein	NA	NA	NA	NA
WP_033097150.1\|4605030_4605366_-	hypothetical protein	NA	NA	NA	NA
WP_065996379.1\|4605362_4606337_-	glycoside hydrolase family 25 protein	G9FHQ8	Rhodococcus_virus	2.6e-67	55.2
WP_033097148.1\|4606333_4606795_-	M23 family metallopeptidase	A0A1P8D5Q3	Corynebacterium_phage	4.2e-44	69.1
WP_033097147.1\|4606874_4608428_-	hypothetical protein	A0A0U4IA58	Gordonia_phage	3.4e-106	42.4
WP_033097146.1\|4608424_4609237_-	hypothetical protein	A0A142K8Q8	Gordonia_phage	2.7e-46	38.6
WP_065996380.1\|4609237_4613011_-	hypothetical protein	A0A142K8Q7	Gordonia_phage	3.4e-59	32.9
WP_033097145.1\|4613302_4613698_-	hypothetical protein	G9FH94	Rhodococcus_phage	4.4e-10	36.0
WP_157126973.1\|4613698_4614016_-	hypothetical protein	A0A142KAP1	Gordonia_phage	7.6e-13	46.1
WP_157126974.1\|4613898_4614363_-	hypothetical protein	NA	NA	NA	NA
WP_052040041.1\|4614485_4614995_-	hypothetical protein	G9FH93	Rhodococcus_phage	3.6e-57	69.9
WP_033097143.1\|4615007_4615445_-	hypothetical protein	G9FH92	Rhodococcus_phage	4.7e-29	47.1
WP_033097142.1\|4615441_4615639_-	hypothetical protein	NA	NA	NA	NA
WP_033097141.1\|4615635_4615950_-	HK97 gp10 family phage protein	G9FH91	Rhodococcus_phage	1.9e-24	60.8
WP_033097224.1\|4615958_4616288_-	hypothetical protein	G9FH90	Rhodococcus_phage	3.5e-37	73.0
WP_033097140.1\|4616284_4616698_-	hypothetical protein	NA	NA	NA	NA
WP_157126975.1\|4616746_4617034_-	hypothetical protein	NA	NA	NA	NA
WP_033097138.1\|4617030_4617966_-	hypothetical protein	A0A2H5BLD0	Streptomyces_phage	1.6e-66	48.1
WP_065996382.1\|4617978_4618617_-	hypothetical protein	A0A159B6H8	Gordonia_phage	2.5e-07	64.6
WP_052040039.1\|4618715_4619906_-	hypothetical protein	G9FH84	Rhodococcus_phage	1.2e-71	34.0
WP_033097137.1\|4619924_4620218_-	hypothetical protein	D9I600	Acinetobacter_virus	8.0e-17	52.3
WP_084295108.1\|4621787_4622972_-	hypothetical protein	G9FH82	Rhodococcus_phage	3.3e-141	64.0

DBSCAN-SWA_4

4856446 : 4865256

Gordonia_phage(42.86%)

integrase

attL 4849814:4849828|attR 4860317:4860331

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4849814:4849828	attL	NA	NA	NA	NA
WP_006550072.1\|4856446_4858057_-	chaperonin GroEL	A0A240F779	uncultured_virus	4.4e-141	52.7
WP_006550071.1\|4858144_4858447_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	3.6e-20	53.8
WP_052040023.1\|4858817_4859693_+\|integrase	tyrosine-type recombinase/integrase	A0A160DF60	Gordonia_phage	4.9e-25	34.5
WP_065996439.1\|4859731_4859938_+	hypothetical protein	NA	NA	NA	NA
WP_157126979.1\|4860045_4860504_+	hypothetical protein	G9FGX7	Rhodococcus_phage	5.0e-05	32.0
4860317:4860331	attR	NA	NA	NA	NA
WP_033097187.1\|4860562_4860928_-	hypothetical protein	NA	NA	NA	NA
WP_084295054.1\|4861027_4861768_-	HNH endonuclease	A0A0N9ESC4	Pseudomonas_phage	6.8e-20	46.2
WP_052040020.1\|4861957_4862281_-	hypothetical protein	NA	NA	NA	NA
WP_157126980.1\|4862375_4863515_+	acyltransferase family protein	A0A142KA18	Gordonia_phage	6.6e-91	51.5
WP_033097045.1\|4863462_4865256_-	hypothetical protein	A0A142KA17	Gordonia_phage	1.3e-218	70.3

DBSCAN-SWA_5

4874433 : 4889866

Rhodococcus_phage(46.15%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157126993.1\|4874433_4876482_-	transglycosylase SLT domain-containing protein	A0A0K0N732	Gordonia_phage	1.1e-88	43.8
WP_033097038.1\|4878601_4879420_-	hypothetical protein	G9FH42	Rhodococcus_phage	2.9e-56	45.9
WP_033097037.1\|4879420_4879783_-	hypothetical protein	G9FH41	Rhodococcus_phage	2.0e-09	37.2
WP_157126981.1\|4879779_4880154_-	hypothetical protein	NA	NA	NA	NA
WP_052040013.1\|4881251_4881653_-	hypothetical protein	G9FH36	Rhodococcus_phage	2.1e-20	40.5
WP_157126982.1\|4881652_4881913_-	hypothetical protein	NA	NA	NA	NA
WP_033097034.1\|4881960_4882305_-	hypothetical protein	NA	NA	NA	NA
WP_052040011.1\|4882304_4882667_-	hypothetical protein	G9FH33	Rhodococcus_phage	3.5e-22	45.0
WP_157126983.1\|4882675_4883059_-	hypothetical protein	A0A0F6SJK3	Mycobacterium_phage	2.4e-05	33.9
WP_033097032.1\|4883092_4883992_-	hypothetical protein	A0A142K9Z4	Gordonia_phage	5.4e-96	60.3
WP_033097031.1\|4884009_4884384_-	hypothetical protein	A0A2K9VEZ0	Mycobacterium_phage	1.3e-30	59.7
WP_033097030.1\|4884387_4885623_-	hypothetical protein	A0A142K8P6	Gordonia_phage	4.2e-99	57.1
WP_033097174.1\|4885612_4886929_-	hypothetical protein	G9FH28	Rhodococcus_phage	1.1e-140	61.4
WP_052040010.1\|4886946_4888428_-	hypothetical protein	G9FH27	Rhodococcus_phage	2.9e-110	46.1
WP_033097029.1\|4888441_4888717_-	hypothetical protein	Q9ZX74	Mycobacterium_phage	1.9e-07	48.1
WP_084295056.1\|4888723_4889866_-	hypothetical protein	A0A2K9VGY0	Gordonia_phage	2.0e-18	50.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016821

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016820

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP016819

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection