CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009468	Vibrio harveyi strain ATCC 33843 (392 [MAV]) chromosome 2, complete sequence	0 crisprs	cas3,csa3,DEDDh	0	0	0	0
NZ_CP009467	Vibrio harveyi strain ATCC 33843 (392 [MAV]) chromosome 1, complete sequence	1 crisprs	cas3,DinG,csa3,csx1,DEDDh,RT	2	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009467_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009467_1

3309206-3309444

Orphan

Consensus_repeat	Method
CCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP009467_1

>merge|NZ_CP009467|1|3309206-3309444|PILER-CR
CTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATTTGGTGCACTTGCTTAAAGCAAGACACAAAACAGAATAGTTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>NZ_CP009467|1|1|3309206-3309444|PILER-CR
CTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGT	CACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGA
TAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCG	GTGGTTCGATTCCGCCTCGAGGCACCATATTTGGTGCACTTGCTTAAAGCAAGACACAAAACAGAATAGTTCCTCCTTA
GCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009467.1\|WP_069687482.1\|3309770_3311396_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP009467.1\|WP_050937295.1\|3306033_3307110_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NZ_CP009467.1\|WP_050908140.1\|3303047_3303968_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880
NZ_CP009467.1\|WP_045371830.1\|3301050_3301653_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP009467.1\|WP_009698789.1\|3320584_3321835_-\|HD-GYP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NZ_CP009467.1\|WP_009697574.1\|3312294_3313731_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP009467.1\|WP_069687485.1\|3323854_3325177_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
NZ_CP009467.1\|WP_005425798.1\|3304070_3305099_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NZ_CP009467.1\|WP_009698793.1\|3325546_3326881_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP009467.1\|WP_005449660.1\|3307484_3308624_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
NZ_CP009467.1\|WP_069687481.1\|3301671_3302844_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP009467.1\|WP_005449665.1\|3305110_3305830_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP009467.1\|WP_069687484.1\|3323081_3323837_-\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007
NZ_CP009467.1\|WP_005425792.1\|3307129_3307402_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP009467.1\|WP_005425805.1\|3300155_3300446_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
NZ_CP009467.1\|WP_005448803.1\|3326969_3327275_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP009467.1\|WP_005425804.1\|3300513_3300945_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NZ_CP009467.1\|WP_005448800.1\|3325187_3325499_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749
NZ_CP009467.1\|WP_069687483.1\|3321980_3322979_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP009467.1\|WP_005448805.1\|3327679_3328129_+\|type-III-secretion-system-chaperone	unknown	unknown	gnl\|CDD\|341100

Protein	Function_ID	Function_description	E-value
NZ_CP009467.1\|WP_069687482.1\|3309770_3311396_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	3.83843e-61
NZ_CP009467.1\|WP_050937295.1\|3306033_3307110_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NZ_CP009467.1\|WP_050908140.1\|3303047_3303968_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NZ_CP009467.1\|WP_045371830.1\|3301050_3301653_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	8.65032e-124
NZ_CP009467.1\|WP_009698789.1\|3320584_3321835_-\|HD-GYP-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	6.04482e-71
NZ_CP009467.1\|WP_009697574.1\|3312294_3313731_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP009467.1\|WP_069687485.1\|3323854_3325177_-\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP009467.1\|WP_005425798.1\|3304070_3305099_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	1.72952e-08
NZ_CP009467.1\|WP_009698793.1\|3325546_3326881_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	2.3877e-153
NZ_CP009467.1\|WP_005449660.1\|3307484_3308624_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	1.26932e-149
NZ_CP009467.1\|WP_069687481.1\|3301671_3302844_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP009467.1\|WP_005449665.1\|3305110_3305830_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	1.32707e-107
NZ_CP009467.1\|WP_069687484.1\|3323081_3323837_-\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	1.81233e-119
NZ_CP009467.1\|WP_005425792.1\|3307129_3307402_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	9.88866e-59
NZ_CP009467.1\|WP_005425805.1\|3300155_3300446_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	1.0803e-59
NZ_CP009467.1\|WP_005448803.1\|3326969_3327275_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.45724e-45
NZ_CP009467.1\|WP_005425804.1\|3300513_3300945_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	2.05857e-68
NZ_CP009467.1\|WP_005448800.1\|3325187_3325499_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	7.43721e-36
NZ_CP009467.1\|WP_069687483.1\|3321980_3322979_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.00513e-111
NZ_CP009467.1\|WP_005448805.1\|3327679_3328129_+\|type-III-secretion-system-chaperone	gnl\|CDD\|341100	cd16364, T3SC_I_like, class I type III secretion system (T3SS) chaperones and similar proteins. This family contains class I type III secretion system (T3SS) chaperones mainly found in Gram-negative bacteria such as Pseudomonas, Yersinia, Salmonella, Escherichia and Erwinia, among others. A wide variety of these bacterial pathogens and symbionts require a T3SS to inject eukaryotic host cells with effector proteins important for suppressing host defenses and establishing infection. Many of these effector proteins interact with specific type III secretion chaperones prior to secretion. These T3SS chaperones have been classified as class I type III secretion chaperones (T3SC), which are small structurally conserved dimers that interact specifically with T3SS effector proteins. Class I T3SC consists of two subclasses: IA and IB. Class IA T3SC binds a single effector, whereas class IB T3SC binds to several effectors. Class IA and Class IB T3SCs typically exhibit little sequence similarities, but share a common overall heart-shaped structure fold (alpha-beta-beta-beta-alpha-beta-beta-alpha) and features, such as a small size, an acidic pI and an amphipathic C-terminal alpha-helix. Chaperone protein CesT serves a chaperone function for the enteropathogenic Escherichia coli (EPEC) translocated intimin receptor (Tir) protein, which confers upon EPEC the ability to alter host cell morphology following intimate bacterial attachment. In Pseudomonas aeruginosa, chaperone ExsC binds small secreted protein ExsE as well as the non-secreted anti-activator protein ExsD; it relieves repression of the transcriptional activator ExsA (which activates expression of T3SS genes) by ExsD. P. aeruginosa SpcU binds the cytotoxin ExoU, which is a broad-specificity phospholipase A2 (PLA2) and lysophospholipase, and maintains the N-terminus of ExoU in an unfolded state which is required for secretion. Salmonella enterica chaperone SicP forms a complex with effector protein SptP at an early stage of its secretion process in order to avoid premature degradation, while chaperone SigE binds to effector SigD, which, upon translocation into the host cell, preferentially dephosphorylates specific inositol phospholipids that are thought to be crucial for subsequent activation of the host cell Ser-Thr kinase Akt. This family also includes Yersinia chaperone/escortee pairs SycE/YopE, SycH/YopH, SycT/YopT and SycN+YscB/YopN, all of which bind to specific Yersinia outer proteins (Yops). Also included are several DspF and related sequences from several plant pathogenic bacteria. The "disease-specific" (dsp) region next to the hrp gene cluster of Erwinia amylovora is required for pathogenicity but not for elicitation of the hypersensitive reaction. In addition, a group of proteins including Escherichia coli YbjN, Erwinia amylovora AmyR, and their homologs, are included in this family. They share a class I T3SC-like fold with T3SS chaperone proteins but appear to function independently of the T3SS.	8.74163e-21

>NZ_CP009467.1|WP_005449660.1|3307484_3308624_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIAFIATALLMAGCSREFVEKIYDVDYEPTNRFANNLAELPGQFEKDTDALDALINSFSGNIKKRWGQREVKFAGKSNYVKYIDNYLSRAEVDFQKGVITIETVSPTEPQKHLKNAIITTLLTPDDPANVDLFSSKEIKLEGQPFLYKQVVDQDKKPIQWSWRANRFADYLIANQVKTKDVDFKKAYYVEIPMVEDHFSQRSYQYADIVRRASKRYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKNRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLKDVQHPTSLEYSMISAYNGGTGGVLNTFHRSDRKRAMRDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSGHTL
>NZ_CP009467.1|WP_005425792.1|3307129_3307402_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQTMLINEKKLNMMDPEHRKQLETEMVNFLFEGKDVHIEGYTPPSE
>NZ_CP009467.1|WP_050937295.1|3306033_3307110_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAHKYNGEFPLDLEQMNALPGIGRSTAAAVLSSVYKQPHAILDGNVKRTLSRCFAVDGWPGQKKVENQLWEIAETHTPQTDVDKYNQAMMDMGAMMCTRSKPKCTLCPVNELCIAKKQGNVLDYPGKKPKKDKPVKQTRFVMLHHKNGDSHEVWLEQRPQTGIWGGLFCFPQTEHIDVESDIELLLEQRGIQADDIKRQETLITFRHTFSHYHLDITPILIDLSKQPNVVMEGNKGLWYNLSKPEEVGLAAPVKLLLEALPHELR
>NZ_CP009467.1|WP_005449665.1|3305110_3305830_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKMIRKIRSFVRREGRLTKGQENAMNECWPTMGIDYKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGITNLRVMCHDAVEVFEHMIPNGSLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLILNEGIFHMATDWENYAEHMIEIMNQAPGFENIAEEGDFIPRPEERPLTKFEARGHRLGHGVWDIKFKRTA
>NZ_CP009467.1|WP_005425798.1|3304070_3305099_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAILASEGVEVTEIGNKDVGLPAALVFSCETELSEAQAGKIAASSIYYALFEVREDGLLRPIQAPAFNTFPESMSQILRYTGKTNEQFTRLMVNLGVSAANTGSAQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINQKWVQEIQTFIVKFMKNGRFKHKVSKEKRTSGGKKVADGFVVEAAADKDDYNKGNLQTMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEEPYIGYLHRVDQSINRNIIVAIKP
>NZ_CP009467.1|WP_050908140.1|3303047_3303968_-|glutaminase-B
MKPTAQILTDILAEVRPLIGQGKVADYIPALAKVPNTKLGIAVYTNEGEVIKAGDAEESFSIQSISKALSLTLAMCLYKQEEIWCRVGKEPSGQAFNSMIQLEMEQGIPRNPFINAGAIVVADLLQSRLSAPRQRLLEFARQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPTQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAAWSPELDASGNSLAGTKALELLAERIGRSIF
>NZ_CP009467.1|WP_069687481.1|3301671_3302844_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALLEDLDTDIEKYRLNEAPRPLHSIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRISIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFEQGHEKLAAAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLMAYQNMVKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDYIDTTGLPLSSIQETIDWALEMGYLSETETHWQITEKGKLFLNDLLEAFMVEEE
>NZ_CP009467.1|WP_045371830.1|3301050_3301653_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQENLEKLLKAMEGVPEADRTARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQVSQ
>NZ_CP009467.1|WP_005425804.1|3300513_3300945_+|DUF4426-domain-containing-protein
MSKWITALLISLLSLPSMAGQFKTMKDIEVHYIAFNSTFLTPKIARSYDIKRNGYNAVLNISVLDSASLGKPAVEAKISGQAKNLIGQTQKLTFREVKEGDAIYYLAELGITNEETFTFDIDVKAGNKGSGKLKFTQKFYVEE
>NZ_CP009467.1|WP_005425805.1|3300155_3300446_+|YggU-family-protein
MSEAVWHDGEDVVLRLYIQPKASRDKIVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKVAKGLVHIEKGELGRHKQIRIESPVQIPTEIKAII
>NZ_CP009467.1|WP_069687482.1|3309770_3311396_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILIALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEKMAVEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMIFVAAPLDPQLHGTSFHDFRDGDGNSVGQLILDVLGRKTGQIVEYTWTQKLPDGTIEEKHSIAEKTPHWNWVVGTGIGFNEVNARFWSTAQWQLALCLAIAGAILGGLIISIRKMINLLGGEPNDVREAVQAVAQGDIQTSFEYTAPKDSIYGAVQEMSQSLAKMVTNLDESMHALRSELSAVESRSNSIADLTMSQQQSTAMIATAMTEMASSANHVASSASDTAQNTDEADKQSQHTQSLIHSTVDNIQGLATQLNTASKAVADLDQDVNSIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQQMISNLQEGSRNAIHTMEICAETSESTVTESMKASEALQQIVTALESITAMSQQIATAAAEQTQVSDDIAHRINLIEESGSQLNTVVTESQSSTQTLASLADELEGWVNKFSVKH
>NZ_CP009467.1|WP_009697574.1|3312294_3313731_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MMQQIQSETLRVLFESLSSQDGIAVINPATEQELIRLKPSSLDELDVQIETCKAAQVEWEKLSAKVRSASLKKWFQLLVEHTEDIANIITLEQGKPLSESRGEVAYGASFVEWFAEEAKRAYGEVIPAPAVDRRLSTIKQPVGVCAAITPWNFPIAMITRKAAPALAAGCGMIIKPSELTPLTALAVVELAHQAGIPKALLSTVVSEQAAEFGLVLSTDPRIKKISFTGSTRVGKILMKQASDTVKAASMELGGNAPFIVFDDADLEAAANGLIASKFRNAGQTCVCTNRLYVHQNVKEAFLTKLLDKVTSLTVGNGLEKNTTLGPVITMASKHRLEAVIDQAVQEGAAMLNLPQKRSGRFMEPVILDNVEQGMAIVQQELFGPVLPVISFDDDEQVLSMANDTEYGLACYFYTDSLKRIIKFSEGLEYGMVGVNEGIISTEVAPFGGIKESGIGREGAKQGMDEYLETKYICLGGLS
>NZ_CP009467.1|WP_009698789.1|3320584_3321835_-|HD-GYP-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQEQVEMIRHLGVKFVYFNPEQSDASPLPANQPQVEVTQDNTLDLEAQKLWKEKQKRIEKLSAYRRRVIQCEKEFERSLARMRSVMTKIRNRPVDAVGEAQQLIDDIVDKLMCDDNVTLHLMNGKNEFEDIYFHSLNVAVIAMMIGRAKGYSAEQLKALSFAALFHDMGKIKIPTAILRKQVPLTEPESNYLKLHTKYGLDMANQIEDFPDSAKTVIAQHHELRDGSGYPEGLKGDEIDELAQVIIVANAFDNLCHTSIAAEQKIPYTALSHLYKNCKHLYKEENLNILIKFMGVFPPGTVVQLSNNMVGLVISVNASHLLFPNVLVYDPAVPRTQAPIIDLASKDIKIVNAIHPSKLPEKIKEYLNPRSRISYFFDSDE
>NZ_CP009467.1|WP_069687483.1|3321980_3322979_-|LacI-family-DNA-binding-transcriptional-regulator
MARIKDVAELAGVNRSTVSRIINGEGKFREETRKKVEAAMAELNYRPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMEQVQTELDMHKKFLITAQGHHSAEGEREAIQRFNDLRCDGYVLHSRYLSDDDLRELAKLPTPFVLLDRYVEGIEERCVTFNHHHASRIAVEHLIAGGHQKIVCIAGPSQRQNSLLRKRGYIDAVKTAGIDIDESWCEEGNYGRQSGYDAMAALYRRHPDLTAVFSCSEEMTVGAMQFLHEHRISVPKQISLVSFDSVDLCESLYPAVSAVHFPISDMARVAVQTLIGLIKEQPLMTQPEFEAQLKLRKADRIIT
>NZ_CP009467.1|WP_069687484.1|3323081_3323837_-|chitin-disaccharide-deacetylase
MKVIFNADDFGLTPGVNKGIIKAHQQGVVQSTTMMVGMDAERHALDLAKQNPNLNVGVHLRFTTGIPLTGHPNLTRGRTQFVSYDELWKIQDFEEEVVYQEAVAQVEAFLKLGLPLSHLDSHHHAHTHPQLLPVIRKVAQKYKVPLRGSGLCHIENSVKYFFTAEFYDQGVSLEGIMKHLLSLKAQYDVVEVMCHPAEADQSLLSKSSYAQQREVELQVLTSPVFKQELAQHGMAITDYSALVSSSEVASV
>NZ_CP009467.1|WP_069687485.1|3323854_3325177_-|6-phospho-beta-glucosidase
MPRNAIKLAIIGGGSSYTPELVEGVIKRLEFLPVKQMHFVDIELGAEKLEIIKGLAQRMIDKAGADIEIKAGFDRREAIKDADFVMTQFRVGGLTARANDERIPIKYDVIGQETTGPGGFAKALRTIPVILDICKDIEELSPHAWMLNFTNPAGLVSEAVSKYSNVKSIGLCNVPVSMEMMIAEMMDCEPKELQLEFAGLNHLVWVLKAWLKGEDVTQTVLEKVGDGANFSMKNIWEEPWDPAFLKALGAIPCPYHRYFYQTDAMLAEEKQSAGEQGTRAEQVMETESALFKLYQDPNLDHKPKELEERGGAYYSDASLNLVDAIYNNRNSIHVVNVLNNGAINGLPDSAVIECSAVIGSWGAKPLAVGELSSNIKGLLHQVKAYEQLAIEAAVEGSYEKALMALTNNPLVPDIGRAKSILDEILEVNAAYLPQFKLTTL
>NZ_CP009467.1|WP_005448800.1|3325187_3325499_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MEQELVVMEIICNAGEARSLSYEALRLSREKDFTAAEEKLSQAKECINKAHLIQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAQEMAVEIVALNKQLAAR
>NZ_CP009467.1|WP_009698793.1|3325546_3326881_-|PTS-sugar-transporter-subunit-IIC
MKLYDAIIGIVEKHIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVGSFILIFAFPPFAEDTTFALGRIWLDFATTHFDTIMMPFNMSMGIMTIFVSLGVAYSLAKAYKMDGITSAVLSLMCFLLVAAPAKDGALAMKHMGGTGIFTAVMCAFFAVELYRFMKKHNITIRMPEQVPPAIARSFEVLLPVLAVFLTLYPLSIFVQTQYDMLIPDAVMAMFKPLISASNTLPAIIGALLVCQLLWFAGIHGAAIVVGLLSPIFLTNISANIDAFVAGQPIPNVFTQPFWDFYIFIGGSGATLALVMLMSFSRSAHLKSIGRMSAVPGFFQINEPVIFGSPVVMNPILFIPFVFAPIVNATIAYFAVQLGFVGMGVATTPWTTPALIGASWGSGWTFSPVLLVIGLLILDLFIYLPFFKMFEKQVMEQELPMSKESKDAEQPSGEGVTA
>NZ_CP009467.1|WP_005448803.1|3326969_3327275_-|PTS-sugar-transporter-subunit-IIB
MKKILLCCSAGMSTSMLVKKMEQAAEKQGLECKIDALSVNAFDEAIKEYDVCLLGPQVRFQLEELRKTAQEHGKNIDAISPQAYGMMKGEEVLQQALELIN
>NZ_CP009467.1|WP_005448805.1|3327679_3328129_+|type-III-secretion-system-chaperone
MSTLIEQLFQELVTDLGIDTLQPNEDGHCTLMVDETLLLDIELDPKRERLILTSLVGPLSSQQGIKQLSSLMQFNKALYKELNMSLSLETHTASIVLTYSVDAGLCTVFDLESALSCFISQTEKCRHLLESTQEDSPPKNSMLNTAICV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP009467.1	3308893-3308935	0	1.0
NZ_CP009467_1	1.2\|3309333\|79\|NZ_CP009467\|PILER-CR	3309333-3309411	79	NZ_CP009467.1	3308977-3309055	21	0.734

1. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to position: 3308893-3308935, mismatch: 0, identity: 1.0

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccattctttt	Protospacer
*******************************************

2. spacer 1.2|3309333|79|NZ_CP009467|PILER-CR matches to position: 3308977-3309055, mismatch: 21, identity: 0.734

tcgtgtcggtggttcgattccgcctcgaggcaccatatttggtgcacttgcttaaagcaa	CRISPR spacer
tcgtgtcggtggttcgattccgcctcgaggcaccatatttggtgcgcttgcttaaagtaa	Protospacer
*********************************************.***********.**

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103819-103861	5	0.884
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35424-35466	5	0.884
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296497-296539	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	KU052038	Escherichia phage SerU-LTIIb, partial genome	1162-1204	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	KU052038	Escherichia phage SerU-LTIIb, partial genome	3068-3110	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	LN997803	Escherichia coli phage phi467	15122-15164	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1925-1967	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52074-52116	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52080-52122	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52085-52127	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52084-52126	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13641-13683	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	MH494197	Escherichia phage CMSTMSU, complete genome	196768-196810	6	0.86
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85813-85855	7	0.837
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	KY653118	Morganella phage IME1369_01, complete genome	694-736	7	0.837
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NC_049942	Escherichia phage JLK-2012, complete sequence	23522-23564	10	0.767
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	LC494302	Escherichia phage SP27 DNA, complete genome	76609-76651	11	0.744
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17115-17157	11	0.744
NZ_CP009467_1	1.1\|3309248\|43\|NZ_CP009467\|PILER-CR	3309248-3309290	43	NC_027364	Escherichia phage PBECO 4, complete genome	207828-207870	11	0.744

1. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 5, identity: 0.884

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatcaagtc	Protospacer
*************************************.   *.

2. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.884

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagccggcaccaatcaagt	Protospacer
***************************.******** **   *

3. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

4. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

5. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

6. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

7. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccagaatgcg	Protospacer
************************************   * .

8. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

9. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

10. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

11. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

12. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcacaaatcagcc	Protospacer
********************************** * **  ..

13. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcacaaatcagcc	Protospacer
********************************** * **  ..

14. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 7, identity: 0.837

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccaaatgcgg	Protospacer
************************************  . .

15. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 7, identity: 0.837

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgactccggtagccggcaccatattaaa	Protospacer
******************.********.********* .*

16. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 10, identity: 0.767

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
atcaggtcgccagttcgattccggtagccggcaccatatgcgg	Protospacer
* .*****.******************.********* . .

17. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 11, identity: 0.744

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
gaaaggtcaccagttcgattccggtagtcggcacaaaataaag	Protospacer
.. ******************************* *  .

18. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 11, identity: 0.744

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
gaaaggtcaccagttcgattccggtagtcggcacaaaataaag	Protospacer
.. ******************************* *  .

19. spacer 1.1|3309248|43|NZ_CP009467|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 11, identity: 0.744

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
gaaaggtcaccagttcgattccggtagtcggcacaaaataaag	Protospacer
.. ******************************* *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

815577 : 822644

Faustovirus(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005447719.1\|815577_816792_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	9.7e-32	30.2
WP_005424883.1\|816829_817213_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	5.4e-53	78.2
WP_005424893.1\|817286_817610_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.0e-25	51.4
WP_005447715.1\|817665_818181_+	co-chaperone HscB	NA	NA	NA	NA
WP_069686842.1\|818202_820056_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.7e-110	39.8
WP_005424889.1\|820069_820408_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_005424887.1\|820452_820647_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_005447710.1\|820819_822118_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	9.1e-36	34.7
WP_005440311.1\|822218_822644_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	2.7e-21	40.6

DBSCAN-SWA_2

908985 : 915669

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005447599.1\|908985_910125_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.9e-62	41.7
WP_038898513.1\|910142_911393_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	8.6e-100	48.5
WP_005424846.1\|911520_911970_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_038898514.1\|911977_913102_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.9e-45	35.7
WP_029789187.1\|913113_913767_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.1e-34	38.0
WP_005447594.1\|913919_915029_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.8e-64	40.1
WP_005440184.1\|915198_915669_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_3

1827868 : 1889836

uncultured_Caudovirales_phage(28.57%)

plate,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009696959.1\|1827868_1829200_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_005451918.1\|1829226_1829709_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_069687095.1\|1829708_1830647_-	FHA domain-containing protein	NA	NA	NA	NA
WP_009696956.1\|1830650_1831379_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069687096.1\|1831466_1834073_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	1.3e-81	27.6
WP_039842122.1\|1834130_1835060_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_069687097.1\|1835081_1836833_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_005451929.1\|1836825_1837248_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_069687098.1\|1837247_1838642_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_038899054.1\|1838710_1840189_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_069687099.1\|1840188_1840692_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_005443647.1\|1840712_1841234_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_069687100.1\|1841267_1842719_-	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_038899052.1\|1842920_1843223_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_069687101.1\|1843219_1843828_-	hypothetical protein	NA	NA	NA	NA
WP_050908591.1\|1843827_1845810_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.5e-09	30.0
WP_005426534.1\|1845944_1846835_+	hypothetical protein	NA	NA	NA	NA
WP_009696948.1\|1847112_1847832_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_005443641.1\|1847844_1848741_+	methylisocitrate lyase	NA	NA	NA	NA
WP_069687102.1\|1848873_1850016_+	2-methylcitrate synthase	NA	NA	NA	NA
WP_069687103.1\|1850148_1852758_+	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_069687104.1\|1852781_1853969_+	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_069687105.1\|1854030_1855911_+	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	2.9e-67	32.0
WP_069687106.1\|1856071_1856554_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_069687107.1\|1856754_1858299_+\|protease	trypsin-like serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	1.6e-26	34.3
WP_050937475.1\|1858594_1860028_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_009696940.1\|1860082_1860892_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_029789727.1\|1861056_1861707_+	7-carboxy-7-deazaguanine synthase QueE	A0A1B0Z0A9	Vibrio_phage	3.5e-12	27.7
WP_017188076.1\|1861721_1862420_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	2.3e-78	63.3
WP_050924853.1\|1862376_1864344_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.8e-12	32.5
WP_005451971.1\|1864535_1864889_-	DUF2750 domain-containing protein	NA	NA	NA	NA
WP_005451972.1\|1864995_1865616_-	OmpA family protein	NA	NA	NA	NA
WP_009696936.1\|1865618_1866929_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_069687108.1\|1867333_1875688_+	tandem-95 repeat protein	NA	NA	NA	NA
WP_158515396.1\|1875689_1875839_+	hypothetical protein	NA	NA	NA	NA
WP_069687109.1\|1876037_1884737_+	VWA domain-containing protein	NA	NA	NA	NA
WP_009697745.1\|1884800_1885229_-	hypothetical protein	NA	NA	NA	NA
WP_069687110.1\|1885435_1889836_-\|protease	SslE/AcfD family lipoprotein zinc metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

3231036 : 3248736

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005452121.1\|3231036_3233619_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.0e-78	37.7
WP_009698765.1\|3233761_3234229_-	recombination regulator RecX	NA	NA	NA	NA
WP_050907766.1\|3234435_3235479_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	3.1e-111	60.4
WP_050907765.1\|3235680_3236163_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.8e-26	47.5
WP_069687471.1\|3236248_3238810_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.7e-33	22.7
WP_069687472.1\|3238903_3239887_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	4.5e-35	34.8
WP_009698767.1\|3239967_3240891_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	2.4e-06	36.4
WP_017189122.1\|3240905_3241532_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-37	53.3
WP_009698768.1\|3241531_3242308_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	7.0e-68	54.1
WP_038899661.1\|3242307_3243351_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_009698769.1\|3243396_3243873_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_050907763.1\|3243887_3244598_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	1.8e-06	24.0
WP_005452106.1\|3244599_3244881_-	cell division protein FtsB	NA	NA	NA	NA
WP_005425372.1\|3245716_3247018_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	3.5e-136	60.3
WP_005449808.1\|3247095_3248736_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	9.4e-155	51.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage