CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP012163	Enterobacter roggenkampii strain 35734 plasmid p35734-109.753kb, complete sequence	0 crisprs	NA	1
NZ_CP010360	Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence	0 crisprs	PD-DExK	0
NZ_CP012162	Enterobacter roggenkampii strain 35734 chromosome 1, complete sequence	1 crisprs	DEDDh,csa3,WYL,DinG,cas3,RT,PD-DExK	12
NZ_CP012164	Enterobacter roggenkampii strain 35734 plasmid p35734-8.452kb, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4910 : 67309

Escherichia_phage(26.67%)

transposase,integrase

attL 14512:14564|attR 67310:67362

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152397.1\|4910_6230_+\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_004152396.1\|6479_7361_-	carbapenem-hydrolyzing class A beta-lactamase KPC-3	A0A1B0VBP7	Salmonella_phage	2.8e-73	52.2
WP_004152394.1\|7747_8527_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004152392.1\|9656_12686_-\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004152391.1\|12795_14511_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
14512:14564	attL	NA	NA	NA	NA
WP_000509966.1\|15380_15986_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_004194048.1\|16645_17827_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.9e-120	64.2
WP_000091613.1\|18253_18568_-	hypothetical protein	NA	NA	NA	NA
WP_000215515.1\|18822_19179_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001293886.1\|19168_19570_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_001247892.1\|19566_19857_-	nucleotidyltransferase	NA	NA	NA	NA
WP_003100881.1\|19931_22898_+\|transposase	Tn3-like element ISPa38 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.2
WP_157877506.1\|22976_23177_+	hypothetical protein	NA	NA	NA	NA
WP_016162063.1\|23213_23918_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	9.0e-139	99.6
WP_000427623.1\|24044_25049_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_017694781.1\|25758_26049_-	hypothetical protein	NA	NA	NA	NA
WP_017694271.1\|26102_26786_-	ParA family protein	NA	NA	NA	NA
WP_087451024.1\|27236_28356_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_032666417.1\|28693_29185_+	hypothetical protein	NA	NA	NA	NA
WP_017694266.1\|29679_29919_-	hypothetical protein	I6PD82	Cronobacter_phage	1.6e-18	52.6
WP_032666420.1\|30368_30800_+	hypothetical protein	NA	NA	NA	NA
WP_032666421.1\|30831_31359_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	3.3e-21	38.2
WP_032666422.1\|31351_32098_-	hypothetical protein	NA	NA	NA	NA
WP_032666423.1\|32112_34020_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_032666424.1\|34728_35121_-	H-NS histone family protein	NA	NA	NA	NA
WP_032666425.1\|35117_37319_-	type IA DNA topoisomerase	NA	NA	NA	NA
WP_032666426.1\|37315_37624_-	hypothetical protein	NA	NA	NA	NA
WP_032666427.1\|37599_37935_-	hypothetical protein	NA	NA	NA	NA
WP_000683352.1\|37961_38279_-	hypothetical protein	NA	NA	NA	NA
WP_050010006.1\|38369_38771_-	hypothetical protein	NA	NA	NA	NA
WP_044598044.1\|38757_39807_-	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_032666428.1\|39810_41007_-	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_001045307.1\|41003_41897_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_001293055.1\|41889_42576_-	type IV secretion system protein	NA	NA	NA	NA
WP_032666429.1\|42785_43793_-	type IV secretion system protein	NA	NA	NA	NA
WP_000769859.1\|43810_44095_-	EexN family lipoprotein	NA	NA	NA	NA
WP_088555714.1\|44106_44817_-	type IV secretion system protein VirB5	NA	NA	NA	NA
WP_017694776.1\|44841_47592_-	ATPase	NA	NA	NA	NA
WP_050010005.1\|47601_47901_-	conjugal transfer protein TrbC	NA	NA	NA	NA
WP_000958205.1\|47911_48574_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_001112907.1\|48576_48792_-	hypothetical protein	NA	NA	NA	NA
WP_032666431.1\|48784_49093_-	hypothetical protein	NA	NA	NA	NA
WP_077950058.1\|49406_50321_+	response regulator	NA	NA	NA	NA
WP_032666432.1\|50324_51308_+	hypothetical protein	NA	NA	NA	NA
WP_032666433.1\|51300_51789_+	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_032666434.1\|51785_53504_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	2.1e-27	28.0
WP_017694275.1\|54100_54463_+	hypothetical protein	NA	NA	NA	NA
WP_004152397.1\|57709_59029_+\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_004152396.1\|59278_60160_-	carbapenem-hydrolyzing class A beta-lactamase KPC-3	A0A1B0VBP7	Salmonella_phage	2.8e-73	52.2
WP_004152394.1\|60546_61326_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004199214.1\|61322_62348_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
WP_004152392.1\|62454_65484_-\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004152391.1\|65593_67309_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
67310:67362	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012162

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012162_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012162_1

4143969-4144045

Orphan

Consensus_repeat	Method
GACTGAGTTCGGTATCCGAACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012162_1

>merge|NZ_CP012162|1|4143969-4144045|CRISPRCasFinder
GACTGAGTTCGGTATCCGAACCCTGTTTTTTAGCGACGATTCCTGGCCGTTTATGACTGAGTTCGGTTTCCGAACCC

>NZ_CP012162|1|1|4143969-4144045|CRISPRCasFinder
GACTGAGTTCGGTATCCGAACCC	TGTTTTTTAGCGACGATTCCTGGCCGTTTAT
GACTGAGTTCGGTTTCCGAACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012162.1\|WP_044597652.1\|4153527_4155966_+\|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA	unknown	unknown	gnl\|CDD\|236644
NZ_CP012162.1\|WP_004115567.1\|4141923_4142478_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012162.1\|WP_039265473.1\|4151719_4152046_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012162.1\|WP_004115557.1\|4136854_4137520_-\|integrating-conjugative-element-protein-PilL,-PFGI-1-class	unknown	unknown	gnl\|CDD\|163460
NZ_CP012162.1\|WP_004115563.1\|4138792_4139263_-\|DUF3577-domain-containing-protein	unknown	unknown	gnl\|CDD\|371899
NZ_CP012162.1\|WP_004115579.1\|4148033_4149404_-\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|273206
NZ_CP012162.1\|WP_004115574.1\|4145042_4145633_-\|DUF2857-domain-containing-protein	unknown	unknown	gnl\|CDD\|378591
NZ_CP012162.1\|WP_004115560.1\|4137888_4138131_-\|DUF4160-domain-containing-protein	unknown	unknown	gnl\|CDD\|379344
NZ_CP012162.1\|WP_004115565.1\|4139898_4141908_-\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP012162.1\|WP_004115576.1\|4145639_4146350_-\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP012162.1\|WP_004115558.1\|4137656_4137905_-\|DUF2442-domain-containing-protein	unknown	unknown	gnl\|CDD\|378424
NZ_CP012162.1\|WP_023294538.1\|4152303_4152906_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99777
NZ_CP012162.1\|WP_004115554.1\|4136099_4136858_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236892
NZ_CP012162.1\|WP_004115562.1\|4138195_4138732_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236362
NZ_CP012162.1\|WP_004115581.1\|4149396_4150272_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP012162.1\|WP_004115569.1\|4142479_4143205_-\|TIGR03761-family-integrating-conjugative-element-protein	unknown	unknown	gnl\|CDD\|378089
NZ_CP012162.1\|WP_023326053.1\|4150923_4151742_+\|DUF4225-domain-containing-protein	unknown	unknown	gnl\|CDD\|372865
NZ_CP012162.1\|WP_004115572.1\|4144797_4145046_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012162.1\|WP_004115577.1\|4146342_4148037_-\|chromosome-partitioning-protein-ParB	unknown	unknown	gnl\|CDD\|213858
NZ_CP012162.1\|WP_154816772.1\|4143273_4143447_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP012162.1\|WP_044597652.1\|4153527_4155966_+\|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA	gnl\|CDD\|236644	PRK10049, pgaA, outer membrane protein PgaA; Provisional.	0
NZ_CP012162.1\|WP_004115557.1\|4136854_4137520_-\|integrating-conjugative-element-protein-PilL,-PFGI-1-class	gnl\|CDD\|163460	TIGR03748, conj_PilL, conjugative transfer region protein, TIGR03748 family. This model describes the conserved N-terminal region of a variable length protein family associated with laterally transfered regions flanked by markers of conjugative plasmid integration and/or transposition. Most members of the family have the lipoprotein signal peptide motif. A member of the family from a pathogenicity island in Salmonella enterica serovar Dublin strain was designated PilL for nomenclature consistency with a neighboring gene for the pilin structural protein PilS. However, the species distribution of this protein family tracks much better with markers of conjugal transfer than with markers of PilS-like pilin structure. [Mobile and extrachromosomal element functions, Plasmid functions].	9.20309e-47
NZ_CP012162.1\|WP_004115563.1\|4138792_4139263_-\|DUF3577-domain-containing-protein	gnl\|CDD\|371899	pfam12101, DUF3577, Protein of unknown function (DUF3577). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 143 to 307 amino acids in length.	4.87835e-79
NZ_CP012162.1\|WP_004115579.1\|4148033_4149404_-\|replicative-DNA-helicase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP012162.1\|WP_004115574.1\|4145042_4145633_-\|DUF2857-domain-containing-protein	gnl\|CDD\|378591	pfam11198, DUF2857, Protein of unknown function (DUF2857). This is a bacterial family of uncharacterized proteins.	9.02647e-77
NZ_CP012162.1\|WP_004115560.1\|4137888_4138131_-\|DUF4160-domain-containing-protein	gnl\|CDD\|379344	pfam13711, DUF4160, Domain of unknown function (DUF4160).	7.33131e-17
NZ_CP012162.1\|WP_004115576.1\|4145639_4146350_-\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	1.94287e-09
NZ_CP012162.1\|WP_004115565.1\|4139898_4141908_-\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP012162.1\|WP_004115558.1\|4137656_4137905_-\|DUF2442-domain-containing-protein	gnl\|CDD\|378424	pfam10387, DUF2442, Protein of unknown function (DUF2442). This family of bacterial and fungal proteins has several members annotated as being putative molybdopterin-guanine dinucleotide biosynthesis protein A; however this could not be verified. Hence the function is not known. This family also includes the DUF3532 that was found to be related and was merged into this family. Members of this family also fall into the NE0471 N-terminal domain-like superfamily, a family of proteins with a unique fold in SCOP:143880.	7.40983e-20
NZ_CP012162.1\|WP_023294538.1\|4152303_4152906_-\|hypothetical-protein	gnl\|CDD\|99777	cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain. For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization. For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental nitrate or nitrite is present under anerobic conditions. FixJ is involved in the transcriptional activation of nitrogen fixation genes. The group also includes small proteins which lack an N-terminal signaling domain, such as Bacillus subtilis GerE. GerE is dimeric and acts in conjunction with sigmaK as an activator or a repressor modulating the expression of various genes in particular those encoding the spore-coat. These LuxR family regulators may share a similar organization of their target binding sites. For example the LuxR dimer binds the lux box, a 20bp inverted repeat, GerE dimers bind two 12bp consensus sequences in inverted orientation having the central four bases overlap, and the NarL dimer binds two 7bp inverted repeats separated by 2 bp.	1.14876e-05
NZ_CP012162.1\|WP_004115554.1\|4136099_4136858_-\|hypothetical-protein	gnl\|CDD\|236892	PRK11281, PRK11281, mechanosensitive channel MscK.	0.000329068
NZ_CP012162.1\|WP_004115562.1\|4138195_4138732_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	1.67596e-92
NZ_CP012162.1\|WP_004115581.1\|4149396_4150272_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	8.49471e-22
NZ_CP012162.1\|WP_004115569.1\|4142479_4143205_-\|TIGR03761-family-integrating-conjugative-element-protein	gnl\|CDD\|378089	pfam08900, DUF1845, Domain of unknown function (DUF1845). This family of proteins are functionally uncharacterized.	2.18363e-102
NZ_CP012162.1\|WP_023326053.1\|4150923_4151742_+\|DUF4225-domain-containing-protein	gnl\|CDD\|372865	pfam13988, DUF4225, Protein of unknown function (DUF4225). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 182 and 282 amino acids in length.	7.69968e-50
NZ_CP012162.1\|WP_004115577.1\|4146342_4148037_-\|chromosome-partitioning-protein-ParB	gnl\|CDD\|213858	TIGR03764, ICE_PFGI_1_parB, integrating conjugative element, PFGI_1 class, ParB family protein. Members of this protein family carry the ParB-type nuclease domain and are found in integrating conjugative elements (ICE) in the same class as PFGI-1 of Pseudomonas fluorescens Pf-5.	1.94338e-149

>NZ_CP012162.1|WP_154816772.1|4143273_4143447_+|hypothetical-protein
MNNLKPDRHRYKFAEPSSLLWRRSIAWLSTSVATGNSAHFLASTLLAKVQDFMLRCL
>NZ_CP012162.1|WP_004115569.1|4142479_4143205_-|TIGR03761-family-integrating-conjugative-element-protein
MSDGKTKGGTTASRAGALQSSVNILLHTHYAIRLWEGRKRDAPDETGVKKKRPEIISMPQAIARAGNASRDSAADNPYADMALVRLEEALQRATLKINENVSSLDAILSAVPKGVTLSEVESADPLNVSVFSRSPLGYRCVWLLVGYDQLAMKAFQAFHYGLISRSQRDAILDNGGHAVRQVYGVIQPYRTLAVTRRDIAEKTTQGLVAIERNGEPDPDVLSGKKRSSFSPPLKNTIAEEE
>NZ_CP012162.1|WP_004115567.1|4141923_4142478_-|hypothetical-protein
MIRPVFLLTSFFLLSGCATTDWAAINKQVSDTAANLKKTLGGNDSGESGGMPLMSPAGQQAMKSVDKTFSVPVDVDTAAARLKRHYKFISTQELEALRQATNDGDWKAAAEDDAHPVWDAMPGSYYKMGSDWNGRDHLDIEIEKNGSGSRLYVVYRSSSSQRLAGSGVTKLMNDVRAVAAGEKR
>NZ_CP012162.1|WP_004115565.1|4139898_4141908_-|DNA-topoisomerase-III
MQLFLCEKPSQAKDIARVLGISKREQGFISGGNIVVTWAVGHLLETASPEAYGEQYGRPWRADVLPVLPEAWKMVVKEQTKSQFTVISKLLKKASEVVIATDADREGEVIARELLEYCHYSGAVRRLWLSALDEASVKEALSSILPGEKTALLYDAGKGRSQADWLIGMNLTRLYTLKARDSGVSEVLSVGRVQTPTLAMVVNRDNEITSFVPKPWWQVHALIEKEGVRFRAGWVPVEQYCDEEKRCINPQAARAVGQLCQQQGRATVLEVTQKREKTAAPLCFDLGTLQQVCSRKFGMGANDVLAIAQSLYETHKATTYPRTDCGFLPTSMQQEIPDVLAAVAKSDPAVAPVLNQLDRKFVSRVWNDKKITAHHAIIPTRQAFDLSRLSADELKVYQLIRQHYFAQFLPLQESDVTEASFNIGGQLFRTRGKVGVVTGWKSLFQAEKDDDEEDADGDSMALPALAKGDICAVTGAEVKDMKTSPPKPFTEGTLIAAMKNAASFVSDPKLKKVLRDNAGLGTEATRAGVLETLFKRHYLEKKGKHIHSTQVARELIAALPETLTSPGMTALWEQALDDISQGKMSLAVFMQKQLQWTRHLVEKGRQDSVKITAPVTPPCPLCKGPTRKRKGKNGDFWGCIRYPDCEGIISTGKKKAAKRKKTSVKAKTE
>NZ_CP012162.1|WP_004115563.1|4138792_4139263_-|DUF3577-domain-containing-protein
MSANNTSASAKSEYFNLTIKGIGYLSNIRQVNHQNGSFLSCVINALSGPTDNPAYVRFDISVAGKEATSLIARCQKAVDEDKKVLLGFNLSNPSTDIFTLNKGDHAGEQRVSLKARLIKVDWIKIGQEMVYKTEKSDSVPPQNGSVAQQNYAENSF
>NZ_CP012162.1|WP_004115562.1|4138195_4138732_-|single-stranded-DNA-binding-protein
MSSRGVNKVILVGNLGQDPEVRYIPNGSAVATLSLATSESWRDKQSGEQKEVTEWHRVVIFGKLAEIAGEYLRKGSQVYIEGQLRTRKWTDQAGQDKYTTEVVVNIGGTMQMLGGRQSGSGQNTSSRNDWGQPQQPSGPTHSGQASGSSAGAPPMDFDDDIPFIGFGYGVPKSAIHAL
>NZ_CP012162.1|WP_004115560.1|4137888_4138131_-|DUF4160-domain-containing-protein
MPVILRINGFRFFFYSNEGNPLEPAHIHVMKAGSEAKFWLTPSVVLASNDGFNSRVLKELTGIVEDNQALFLEAWNDYFS
>NZ_CP012162.1|WP_004115558.1|4137656_4137905_-|DUF2442-domain-containing-protein
MTISAKRVSFDEATMWVELNDARTIGVPLAWFPRLLHASTEQLNSYELSPRGIHWDALDEDISIAGLLEGRGDVTHRPHKVA
>NZ_CP012162.1|WP_004115557.1|4136854_4137520_-|integrating-conjugative-element-protein-PilL,-PFGI-1-class
MKRNTSHNVFSPGRLATVLPLLLLAGCVSQPQKLQQRAPADPTPGTTVTRNVQPVSPDEYARTPEVVRYDRYLLVSTDPQAAQRDPLSQIIDIRIPSSLHPTVADALRYALRQSGYSLCATGSANGVLYRQALPAVQYQLGPMRLRTALQVLAGPAWQLEVDDVQRVVCHSLRDGYQLPVSQLPPPVSTWSAPAPSAVSQPAISAPQSVPVKPVSGGFLRK
>NZ_CP012162.1|WP_004115554.1|4136099_4136858_-|hypothetical-protein
MSEQQPFHTDPAPARKRFSWRPRRRLIWGAAGGVALAGILALGYTAFSLGISDLDERLTRLESQGSTAATVETVAALQSDVTTLRAGLQDSQKKLGEMQQELSAAAKQAGSDDAVRQSLRTLQDAQQGLETRLSALTEQLTALKSQPAPAPAAPVAAPVKKNAPAAKKPRPADTRRAAPSLRMARNAPFVLTGVEKRGAESWAAIAPRGYSSLSQVALVGEGETVAGWTLVSAGYGEATFRVNGRLTVLRAE
>NZ_CP012162.1|WP_004115572.1|4144797_4145046_-|hypothetical-protein
MKYRMVAPGLRAPHGTPPQCCQKALRQVRRFRQGARNYTRLDEKGCGYYKIDLGPFWRLLSRNEGRTWLLLSHERYNSAIRK
>NZ_CP012162.1|WP_004115574.1|4145042_4145633_-|DUF2857-domain-containing-protein
MMNSLSQAANGLLMQLVMDLRSGYLRRCESLGLNREEMQMLQGLSLEELHYLSGSEVSIISVGINHGNLVRMLQQARTEQKRLQRIDRALALGGSIELMANYFGLSSTDVAARRRIAGIDVRPGRGNALGDEENAALWRQWQKSDVEDAESADGLDVMMLAAEQMNVSLTSVWHAVRGWHKTRQPSPARTPVRKTA
>NZ_CP012162.1|WP_004115576.1|4145639_4146350_-|DUF2786-domain-containing-protein
MNNSQRQLRLLNLVRKLLKLGRSNSNAHEAGLALQRAQKLMARYGISELDAGLTSVREASSRTAPSDAEKVPEWMVTLVRGVCHAFGCRAYYSWRQTSAGYRRSVTFYGFSEKPEIAAYAFDVLTRQLKDATNSYLKTQSKRLKLATRRARAEQFRDGWVCGVREVISATDISSEEQQVMSHWLESRSMKTVTTRELKACRGADTARYQGYEAGQNARLHQGVSGRGPAAIGYRQD
>NZ_CP012162.1|WP_004115577.1|4146342_4148037_-|chromosome-partitioning-protein-ParB
MSRKSSNVGAAMLQPGRQSQAAGNISVMPAAEMPMVLTLDQLSPNPDNPRTSRNPRYDDIKASIRSRGLDTVPKVTRDPDGEPDMYIFSDGGNTRYQILSELWQETGEDRFFRVHVLFKPWPGRLQCVIGHLAENEVRGELSFIEKAQGIHKARSIYEEQMGKTVSLRQLSELLTHEGLPVHYSTVSRMEDALKYLYPWIPDLLESGLGRPQITALLALRHDAERVWDEFCLISDTGDKSFSDVFGQCCGRFNSPELWSLEMFRDELIGDLLHALPHPELDYDRWMMELDPKERNRRHHFGDPEPVSIPPANSLVTADSAGQATPAQKSVEVVQPFSSPRREISGEPVTPAPDNTPPEKLDKQHPRHEVQPDMYGAAPVISGESADVSGLVTLSDGYGEENGGEEGNGEDGLLSLLTPEPEVVLQDDAPVTNDSIWHVPAHQDDIEHLQNTAFRLAWELGEVLGCEDEILPQRDNDMSAGYVGAGEMCSEAAAFLLGLTGEAPALHPAAGVCGLPELFTGGPGEGEAPALTDEDALKLLRLLRVMRRLRELQRGLTYGEDNSDE
>NZ_CP012162.1|WP_004115579.1|4148033_4149404_-|replicative-DNA-helicase
MSEMMMPCSYEAEQAVLGGLMLDNDRWDEVILQISPEDLFSRPHRMVFRVMAELAGEGLPLDLITITERLENRGDLEQCGGFAYLAEMSKNTPSAANILAYAGVVAEKSRLRQLMTVGNSLLSDVQAPKASSAGILESAEGKLFNIAEQGAMQLNSETGVNEALDKLLTQLESMSASDGLTGTPTGFSELDAMTCGLQPGDLALLAARPSMGKTSLAMAACTAAVSAKPDDHVFVFSLEMPSEQLMMRLLAMEGRVELSRLRSGNMDDEDWARVSEATGRIIEWKNRLIIDDTSYQTPATLRARARRYVRKYGRPSLIMLDYLQLVRSPEQENRTQEIAEISRSLKALGKELGCPVLALSQLNRLVEQRADKRPNNGDLRDSGALEQDADLIMFIYRDEVYNPGTPDAGVAEIIVGKQRQGPTGTVKVKFDGRYTLFSEFQEGSYDFGYRSGRKQA
>NZ_CP012162.1|WP_004115581.1|4149396_4150272_-|ParA-family-protein
MKILPVISPKGGEGKSTFAAYLAGFLADAGLNTLLVDADYSQPTASSIFALEDESPFGLYELLMQMVSDHTQCISQTAIKNLDVIYSNDPDELLPTAMLHAADGRLRLRNILQHPFFNRYDAIIVDSKGATGVMTELSLLSSTGNVMGIVKPILPDVREFIRGSLHMLTRLKTYENYGIRLPDISILVNCIENTLLDREAMDGLAAIINEKHYDASALGNRDVYRLLDTRIEALDIFKLGHVKQQPVHRLEYKTRRKGPAAAVTMHDLACELFPEWQSHFSDVLTREVRHV
>NZ_CP012162.1|WP_023326053.1|4150923_4151742_+|DUF4225-domain-containing-protein
MDAALLNMMQSGGRNKAWAETMVNMEARKLVNTANTLSAFHLSDGLTRMKFIQEIRDLIEQQFTLARQAKSDKECMDCVKILREENYNLLEQARLLRTKAAKLYAKVEFIRENNKIVGYVISAVSVVLAGAEIAAGFTLIGTMTPLGVLAGAILVTDGANSISKEVARYATNNTTSEGLVANAAMSTAEFMGFSRENGLGVYKSISLAANAYTIFGLLRRPGTWRLFRYLPTDYYRKVSTLSRPQLTMKIAGYGVKAKIIFDLLSVSDPSQN
>NZ_CP012162.1|WP_039265473.1|4151719_4152046_-|hypothetical-protein
MTSEEALLKSGFSKRDLQKLKNNIENYGGSFDSVTHDLANRFKAMKWITIIAFIILALTLLLASRDTSLTLALTLLIVLPFIWYITPAKLGYKSWRYRKMLTNSETGR
>NZ_CP012162.1|WP_023294538.1|4152303_4152906_-|hypothetical-protein
MATSIVLVTQDRYLVRGMRIFFPDIILLDSIDRNIFDNGADEYSVLIDSRAPLRLYDYLIRHPARTKKTICCVMLDMRHREENLLSMKLFMNTSLTAPDMASLFNLVLNMKGRRLTTKWLLNLRLSTHETIMLRLLRAGMSMEEIAGELNTSVKSLYRKRMALSERLGAENFNEACLFIFKNKLLGAGGNDPWVGERSKA
>NZ_CP012162.1|WP_044597652.1|4153527_4155966_+|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA
MERSLRFSTLFFYRTPTLLFLLLLFPVLVQATESVYEQQIQQARNGNYTSFLDYLQRYQQQHALTPEHVADWLQVAAWAGHDDEVIQVWQRYSIYMPLPARGVAAVAQARRNQKAWEPALALWKEARSLAPDNDDYRIGYIKTLADARKDTLALQEARRLVAEAPSQAHLQTLAYVWLRQGKSWDRLLADTRALYVAPENHALLRERVDALTDNRVNTPALLLSQKVALAPAERRRLELNAAAESVRLADVPGRTEKERLQLAQSALNRYDALLSRWQSEPQAAEDVVLARIDRLGALYAHADYPRVISEYQDLTVARHPVPGWAIGWVISAYLQEKNAAAAFALLQRYPQYASDPQDEEHALFYAWLDTGEYPSARRYAERHTRNVPWTRYDFGSPTPQPNDRWLTGQSLRFNYLLATNALPEAEKLARRMATTAPGNQGLQIDYATLLQARGLPRAAEQTLKMAEALEPSNLELEQQQAYVAMDLQEWRQMDLLADDVVARAPRDRSARRLDRLRTVHHMSELRLNASKGLHSDNPVSGTHDLNWDATLYGPPIADNWRLFAGTRYAEGNFDEGKGSSRHLLGGIEWRPRDLQLEAELSSNHYHGANKPGARLSTTYSLTDSWQVSGSLERLSRTTPLRALRNGISANRGEGGMRWYQNERREYQFSAALSRFSDHNRRQEYTLTGKERLWQTPSLTLDLEPGIAASKNSLRDTLYYNPARDLSVTAALAVDHEMYRHYDTLWSQQFVAGGGRYWQKNQSAGAIALLGYGQRVQWNNVMDAGVMLNWDKRPYDGKRESNLSVTFDATLRF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

84613 : 94269

Enterobacteria_phage(100.0%)

integrase

attL 76895:76908|attR 95213:95226

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
76895:76908	attL	NA	NA	NA	NA
WP_044597383.1\|84613_86947_-	DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	84.4
WP_044597382.1\|86961_87282_-	DUF5375 domain-containing protein	NA	NA	NA	NA
WP_017692848.1\|87278_87506_-	hypothetical protein	NA	NA	NA	NA
WP_044597381.1\|87502_88060_-	ash family protein	Q7M2A7	Enterobacteria_phage	7.1e-30	65.2
WP_044597380.1\|88056_88323_-	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	8.0e-32	75.0
WP_044597379.1\|88860_89604_+	hypothetical protein	NA	NA	NA	NA
WP_044597378.1\|89606_89825_+	hypothetical protein	Q7M294	Enterobacteria_phage	8.6e-16	65.2
WP_044597377.1\|89853_90417_+	Polarity suppression protein	Q7M2A1	Enterobacteria_phage	1.1e-59	64.7
WP_050009967.1\|90696_93072_+	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_044597376.1\|93090_94269_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	1.6e-196	86.0
95213:95226	attR	NA	NA	NA	NA

DBSCAN-SWA_2

417911 : 469776

Stx2-converting_phage(16.67%)

transposase,protease,tRNA,integrase

attL 408744:408759|attR 466198:466213

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
408744:408759	attL	NA	NA	NA	NA
WP_044596437.1\|417911_419504_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	5.1e-174	61.6
WP_088569370.1\|419715_420989_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	6.2e-146	81.4
WP_016946740.1\|421217_421625_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.1e-15	37.8
WP_044597283.1\|422435_423665_-	EAL domain-containing protein	NA	NA	NA	NA
WP_044597282.1\|424669_425932_-\|integrase	integrase arm-type DNA-binding domain-containing protein	Q7M297	Enterobacteria_phage	4.2e-78	37.8
WP_021240733.1\|426330_426906_-	transcriptional regulator	NA	NA	NA	NA
WP_044597281.1\|426955_428647_-	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_008502950.1\|428622_428946_-	divalent cation tolerance protein CutA	NA	NA	NA	NA
WP_008502949.1\|429059_430361_-	anaerobic C4-dicarboxylate transporter	NA	NA	NA	NA
WP_003855923.1\|430476_431913_-	aspartate ammonia-lyase	NA	NA	NA	NA
WP_023616652.1\|432247_432712_+	membrane protein FxsA	NA	NA	NA	NA
WP_025911862.1\|432748_433969_-	L-methionine/branched-chain amino acid transporter	NA	NA	NA	NA
WP_003855929.1\|434148_434442_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	2.1e-12	43.3
WP_008502946.1\|434473_436117_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	6.9e-190	69.3
WP_044597280.1\|436182_437346_-	beta-aspartyl-peptidase	NA	NA	NA	NA
WP_023293466.1\|437356_437818_-	hypothetical protein	NA	NA	NA	NA
WP_044597279.1\|437798_438464_-	hypothetical protein	NA	NA	NA	NA
WP_008502942.1\|438698_439052_+	DUF4156 domain-containing protein	NA	NA	NA	NA
WP_008502941.1\|439117_440146_-	EF-P beta-lysylation protein EpmB	NA	NA	NA	NA
WP_008502940.1\|440186_440753_+	elongation factor P	NA	NA	NA	NA
WP_024907352.1\|440811_440943_+	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_003025482.1\|441051_441198_+	lipoprotein toxin entericidin B	NA	NA	NA	NA
WP_021240725.1\|441235_441835_-	response regulator transcription factor	NA	NA	NA	NA
WP_008502938.1\|442096_442414_+	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
WP_021240724.1\|442410_442941_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.4e-46	54.8
WP_044597278.1\|443071_444217_-	cephalosporin-hydrolyzing class C beta-lactamase MIR-20	NA	NA	NA	NA
WP_044597277.1\|444349_445225_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008502934.1\|445254_445614_-	fumarate reductase subunit FrdD	NA	NA	NA	NA
WP_008502933.1\|445624_446020_-	fumarate reductase subunit FrdC	NA	NA	NA	NA
WP_003855955.1\|446030_446765_-	succinate dehydrogenase/fumarate reductase iron-sulfur subunit	NA	NA	NA	NA
WP_044597276.1\|446757_448548_-	fumarate reductase (quinol) flavoprotein subunit	NA	NA	NA	NA
WP_008502931.1\|448858_449836_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	2.6e-27	30.0
WP_023616171.1\|450013_451513_+	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_008502929.1\|451550_454874_-	miniconductance mechanosensitive channel MscM	NA	NA	NA	NA
WP_023293460.1\|454893_455862_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_111986440.1\|455959_457045_-	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
WP_008502926.1\|457119_457665_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	5.3e-30	41.6
WP_023345299.1\|458431_459571_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_044597274.1\|459569_461093_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_044597273.1\|461085_461547_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_021240715.1\|461563_462904_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	8.8e-18	31.0
WP_039265371.1\|462913_464758_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.3e-59	41.2
WP_008502920.1\|464750_465701_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_008502919.1\|465786_466098_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_008502918.1\|466172_467453_+	GTPase HflX	NA	NA	NA	NA
466198:466213	attR	NA	NA	NA	NA
WP_044597272.1\|467509_468769_+\|protease	FtsH protease activity modulator HflK	A0A1L2CVV0	Pectobacterium_phage	8.0e-05	25.1
WP_008502916.1\|468771_469776_+\|protease	protease modulator HflC	NA	NA	NA	NA

DBSCAN-SWA_3

1635798 : 1716084

Shigella_phage(24.53%)

integrase,terminase,protease,head,portal,plate,capsid,transposase,holin,tail,tRNA

attL 1630880:1630896|attR 1686915:1686931

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1630880:1630896	attL	NA	NA	NA	NA
WP_008499956.1\|1635798_1636578_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
WP_044596891.1\|1636581_1637904_+	chromosome partition protein MukF	NA	NA	NA	NA
WP_008499954.1\|1637884_1638589_+	chromosome partition protein MukE	NA	NA	NA	NA
WP_044596890.1\|1638588_1643040_+	chromosome partition protein MukB	NA	NA	NA	NA
WP_044596889.1\|1643218_1645042_+	L,D-transpeptidase	NA	NA	NA	NA
WP_084831940.1\|1645207_1645768_+	YcbK family protein	NA	NA	NA	NA
WP_008499950.1\|1645788_1646436_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_008499949.1\|1646484_1647675_-	aspartate transaminase	NA	NA	NA	NA
WP_010675355.1\|1648832_1650332_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	5.8e-18	27.5
WP_010675356.1\|1650318_1651059_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.5e-32	36.9
WP_021240867.1\|1651929_1653330_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	4.2e-79	35.7
WP_044596887.1\|1653496_1654699_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.3e-44	31.9
WP_044596886.1\|1654883_1656176_-\|integrase	site-specific integrase	S4TSP2	Salmonella_phage	1.1e-238	94.2
WP_013097283.1\|1656220_1656478_-	excisionase family protein	S4TND0	Salmonella_phage	1.8e-36	90.0
WP_044596885.1\|1656461_1656833_-	hypothetical protein	NA	NA	NA	NA
WP_044596884.1\|1656847_1657426_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	8.3e-74	67.7
WP_044596883.1\|1657425_1657848_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	2.7e-45	64.0
WP_044596882.1\|1658037_1658445_-	hypothetical protein	A0A286S1Q6	Klebsiella_phage	2.7e-47	87.5
WP_044596881.1\|1658437_1658659_-	hypothetical protein	NA	NA	NA	NA
WP_044596880.1\|1658765_1659152_-	S24 family peptidase	F1C5A0	Cronobacter_phage	3.1e-40	62.4
WP_044596879.1\|1659214_1659433_-	hypothetical protein	NA	NA	NA	NA
WP_044596878.1\|1659447_1659633_-	hypothetical protein	NA	NA	NA	NA
WP_126325666.1\|1659629_1660019_-	hypothetical protein	A0A1B5FPB2	Escherichia_phage	8.2e-09	55.4
WP_102046745.1\|1660185_1660956_-	LexA family transcriptional regulator	A0A1B5FPF4	Escherichia_phage	5.3e-100	78.9
WP_044596875.1\|1661012_1661282_+	helix-turn-helix domain-containing protein	A0A1B5FPK9	Escherichia_phage	1.6e-19	57.3
WP_044596874.1\|1661302_1661596_+	hypothetical protein	A0A286S2B5	Klebsiella_phage	1.8e-29	82.5
WP_044596873.1\|1662021_1663641_+	DEAD/DEAH box helicase	F1C598	Cronobacter_phage	2.7e-279	87.0
WP_044596872.1\|1663637_1664606_+	DNA primase	F1C597	Cronobacter_phage	1.3e-156	81.5
WP_044596871.1\|1664605_1665466_+	hypothetical protein	A0A1B5FPA6	Escherichia_phage	2.3e-136	83.5
WP_044596870.1\|1665462_1666245_+	antitermination protein	F1C595	Cronobacter_phage	1.2e-107	75.6
WP_045347645.1\|1666439_1666634_+	hypothetical protein	NA	NA	NA	NA
WP_126325667.1\|1667049_1667316_-	hypothetical protein	NA	NA	NA	NA
WP_022648767.1\|1667878_1668274_+	phage membrane protein	K7PHB9	Enterobacterial_phage	9.1e-64	99.2
WP_032675093.1\|1668260_1668566_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	1.7e-41	91.4
WP_032675092.1\|1668543_1669086_+	glycoside hydrolase family 108 protein	A0A0U2I1S0	Escherichia_phage	5.2e-78	73.2
WP_032675091.1\|1669082_1669352_+	hypothetical protein	NA	NA	NA	NA
WP_044596868.1\|1669308_1669503_+	hypothetical protein	K7PM01	Enterobacterial_phage	2.0e-19	91.8
WP_032675089.1\|1669694_1670219_+	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	1.2e-71	77.6
WP_032675087.1\|1670410_1670674_+	hypothetical protein	NA	NA	NA	NA
WP_032675086.1\|1670654_1671023_+	HNH endonuclease	Q8HA82	Salmonella_phage	5.2e-45	72.2
WP_032675084.1\|1671110_1671605_+\|terminase	phage terminase small subunit P27 family	Q8HAD7	Salmonella_phage	1.1e-82	92.1
WP_032675083.1\|1671601_1673335_+\|terminase	terminase large subunit	Q8HAD6	Salmonella_phage	0.0e+00	94.5
WP_032675081.1\|1673482_1674709_+\|portal	phage portal protein	Q8SBI0	Shigella_phage	1.2e-223	91.4
WP_032675079.1\|1674701_1675301_+\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	3.0e-87	78.5
WP_032675078.1\|1675310_1676531_+\|capsid	phage major capsid protein	A0A1W6JP20	Morganella_phage	9.7e-165	74.4
WP_032675077.1\|1676604_1676928_+\|head,tail	phage gp6-like head-tail connector protein	U5P072	Shigella_phage	4.5e-37	67.9
WP_032675076.1\|1676924_1677338_+\|head	phage head closure protein	M1FJ87	Enterobacteria_phage	1.2e-47	69.3
WP_032675074.1\|1677814_1678375_+	hypothetical protein	Q8SBH4	Shigella_phage	3.9e-84	79.0
WP_032675073.1\|1678383_1678566_+	DUF2635 domain-containing protein	Q8SBH3	Shigella_phage	7.0e-11	71.1
WP_032675072.1\|1678562_1680059_+\|tail	tail sheath protein	U5P0H3	Shigella_phage	2.4e-213	75.1
WP_032675071.1\|1680058_1680415_+\|tail	tail protein	A0A192Y8K0	Salmonella_phage	2.8e-48	78.8
WP_044596867.1\|1680414_1680702_+\|tail	phage tail assembly protein	M1FPE4	Enterobacteria_phage	2.8e-22	59.8
WP_032675069.1\|1680819_1682601_+\|tail	phage tail tape measure protein	Q8W620	Enterobacteria_phage	3.5e-115	57.7
WP_032675068.1\|1682669_1683086_+	PH domain-containing protein	A0A249Y2R5	Serratia_phage	1.4e-19	40.9
WP_065365761.1\|1683134_1684556_+	DNA circularization protein	M1FPN5	Enterobacteria_phage	2.2e-168	67.7
WP_032675067.1\|1684564_1686088_+	hypothetical protein	A0A0E3M0V5	Enterobacteria_phage	5.5e-24	31.0
WP_032675066.1\|1686087_1686372_+	hypothetical protein	NA	NA	NA	NA
WP_032675065.1\|1686374_1687445_+\|plate	baseplate protein	U5P0H6	Shigella_phage	2.0e-166	79.1
1686915:1686931	attR	NA	NA	NA	NA
WP_032675064.1\|1687444_1687987_+\|plate	phage baseplate assembly protein	U5P081	Shigella_phage	4.7e-71	72.8
WP_032675063.1\|1687989_1688409_+\|tail	phage tail protein	U5P0R9	Shigella_phage	4.2e-59	79.1
WP_032675061.1\|1689449_1690031_+	YmfQ family protein	O22003	Shigella_phage	2.2e-90	78.8
WP_084832606.1\|1690869_1691214_+	hypothetical protein	U5P083	Shigella_phage	2.5e-09	54.5
WP_044596866.1\|1691872_1693330_-	hypothetical protein	A8CG94	Salmonella_phage	1.4e-24	25.9
WP_032675059.1\|1693326_1694250_-	glycosyltransferase family 2 protein	U5P087	Shigella_phage	4.0e-155	88.8
WP_032675058.1\|1694246_1694609_-	GtrA family protein	U5P0S6	Shigella_phage	3.0e-45	76.7
WP_032675057.1\|1694999_1695239_-	DinI family protein	K7PKR6	Enterobacteria_phage	9.1e-35	94.9
WP_032651183.1\|1695663_1698276_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	9.1e-19	22.0
WP_008499944.1\|1698326_1699097_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-29	38.5
WP_008499943.1\|1699093_1699885_-	aliphatic sulfonate ABC transporter permease SsuC	NA	NA	NA	NA
WP_044596865.1\|1699894_1701040_-	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_021240863.1\|1701036_1701999_-	sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008499940.1\|1701991_1702567_-	NADPH-dependent FMN reductase	NA	NA	NA	NA
WP_008499939.1\|1702815_1703826_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_021240861.1\|1703992_1704535_+	cell division protein ZapC	NA	NA	NA	NA
WP_044596864.1\|1704531_1705641_-	MOSC domain-containing protein	V5UTY8	Synechococcus_phage	9.2e-05	36.2
WP_044596863.1\|1705739_1707848_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_044596862.1\|1707860_1709768_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	7.3e-50	28.3
WP_008499934.1\|1709781_1711035_+	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
WP_044596861.1\|1711039_1712680_+	intermembrane transport protein PqiB	NA	NA	NA	NA
WP_008499932.1\|1712676_1713243_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_013097261.1\|1713498_1713666_+	ribosome modulation factor	NA	NA	NA	NA
WP_008499931.1\|1713736_1714255_-	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA	NA	NA	NA	NA
WP_044596860.1\|1714323_1716084_-\|protease	Lon protease family protein	NA	NA	NA	NA

DBSCAN-SWA_4

2190109 : 2196403

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044596700.1\|2190109_2191501_+	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	1.8e-18	32.3
WP_044596699.1\|2191677_2192574_+	GalU regulator GalF	A0A127AW70	Bacillus_phage	1.5e-42	42.2
WP_044596698.1\|2192928_2194011_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.1e-98	53.1
WP_032652661.1\|2194013_2194913_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.0e-29	34.9
WP_032655542.1\|2194963_2195842_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.0e-108	65.5
WP_032652659.1\|2195845_2196403_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.3e-51	55.0

DBSCAN-SWA_5

2681322 : 2695221

Escherichia_phage(30.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065365757.1\|2681322_2682465_+	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	8.9e-11	28.3
WP_023292275.1\|2682620_2683604_+	zinc transporter ZntB	NA	NA	NA	NA
WP_023327603.1\|2684087_2685461_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.8e-50	31.3
WP_023344312.1\|2685503_2686439_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.0e-142	95.7
WP_044596545.1\|2686488_2687727_-	DUF3596 domain-containing protein	A0A0U2JGI6	Escherichia_phage	1.4e-166	69.3
WP_014884030.1\|2687728_2687941_-	DUF1233 family excisionase	A0A0U2RY08	Escherichia_phage	4.3e-20	64.8
WP_020882485.1\|2688005_2688248_-	DUF4060 family protein	K7PHF4	Enterobacteria_phage	1.3e-33	93.6
WP_044596544.1\|2688286_2689372_-	recombinase RecT	K7PKR8	Enterobacteria_phage	1.3e-125	64.2
WP_044596543.1\|2689381_2692519_-	exodeoxyribonuclease	K7P6V4	Enterobacteria_phage	0.0e+00	64.1
WP_162230875.1\|2692762_2693089_+	hypothetical protein	NA	NA	NA	NA
WP_044596540.1\|2693488_2694376_-	serine dehydrogenasease	NA	NA	NA	NA
WP_074147907.1\|2694507_2694921_-	helix-turn-helix domain-containing protein	A0A0M4R5D1	Salmonella_phage	8.9e-46	76.9
WP_044596538.1\|2694993_2695221_+	Rha family transcriptional regulator	A0A0M4QX15	Salmonella_phage	1.1e-21	64.9

DBSCAN-SWA_6

3103050 : 3113127

Klosneuvirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044596339.1\|3103050_3105084_-	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	1.4e-19	22.6
WP_021241307.1\|3105226_3105973_+	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
WP_008502405.1\|3106064_3106751_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_044596338.1\|3106786_3107218_-	universal stress protein	A0A1W6JNV4	Morganella_phage	1.4e-17	34.5
WP_014883679.1\|3107505_3107709_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	3.4e-14	58.2
WP_044596337.1\|3107752_3109216_-	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	2.3e-43	29.7
WP_008502410.1\|3109437_3110805_-	MHS family MFS transporter	NA	NA	NA	NA
WP_044596336.1\|3110878_3111898_-	Zn-dependent oxidoreductase	E3SJ82	Synechococcus_phage	4.6e-19	27.7
WP_023292552.1\|3111912_3113127_-	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	8.2e-47	29.4

DBSCAN-SWA_7

3375591 : 3429856

Stx2-converting_phage(23.08%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021241572.1\|3375591_3376404_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_023325776.1\|3376403_3377417_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_023294134.1\|3377484_3378621_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	5.2e-19	26.9
WP_008502603.1\|3378734_3379739_+	flagella biosynthesis regulator Flk	NA	NA	NA	NA
WP_044597868.1\|3379829_3381008_-	MFS transporter	NA	NA	NA	NA
WP_008502605.1\|3381215_3382433_-	beta-ketoacyl-ACP synthase I	NA	NA	NA	NA
WP_044597867.1\|3382591_3384589_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_008502607.1\|3384686_3384962_-	YfcL family protein	NA	NA	NA	NA
WP_044597866.1\|3384975_3385521_-	elongation factor P hydroxylase	NA	NA	NA	NA
WP_044597865.1\|3385520_3386330_-	TSUP family transporter	NA	NA	NA	NA
WP_008502610.1\|3386329_3387154_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
WP_023325780.1\|3387156_3388242_-	chorismate synthase	A0A291AU41	Pandoravirus	1.5e-87	46.9
WP_008502612.1\|3388302_3389235_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_014884683.1\|3389978_3390464_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_044597864.1\|3390673_3392821_-	fatty acid oxidation complex subunit alpha FadJ	NA	NA	NA	NA
WP_044597863.1\|3392820_3394131_-	acetyl-CoA C-acyltransferase FadI	NA	NA	NA	NA
WP_023294142.1\|3394407_3394692_-	YfcZ/YiiS family protein	NA	NA	NA	NA
WP_008502618.1\|3395064_3396348_+	long-chain fatty acid transporter FadL	NA	NA	NA	NA
WP_008502619.1\|3396392_3397145_-	phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
WP_023325783.1\|3397460_3398390_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	3.3e-141	85.4
WP_007851504.1\|3400058_3400349_+\|transposase	transposase	U5P4I9	Shigella_phage	2.2e-30	93.2
WP_007851507.1\|3400516_3401599_+	DNA-binding transcriptional repressor LacI	C6ZCU4	Enterobacteria_phage	6.5e-189	98.1
WP_015386474.1\|3401720_3404795_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.7
WP_003846917.1\|3404846_3406100_+	lactose permease	NA	NA	NA	NA
WP_003846919.1\|3406156_3406327_+	hypothetical protein	NA	NA	NA	NA
WP_004118209.1\|3407263_3407527_-\|transposase	transposase	NA	NA	NA	NA
WP_015386469.1\|3407541_3407805_+	hypothetical protein	NA	NA	NA	NA
WP_004152118.1\|3408048_3408330_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004152117.1\|3408364_3408934_+	small heat shock protein sHSP20	NA	NA	NA	NA
WP_004152116.1\|3409039_3411835_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	5.2e-129	41.0
WP_004152115.1\|3411834_3412032_+	hypothetical protein	NA	NA	NA	NA
WP_023312611.1\|3412269_3413019_+	diguanylate cyclase	NA	NA	NA	NA
WP_004152113.1\|3413005_3413968_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_087451024.1\|3415861_3416982_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_013098166.1\|3417623_3417815_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_007869711.1\|3417831_3419043_+	hypothetical protein	NA	NA	NA	NA
WP_007869714.1\|3419039_3419999_-	hypothetical protein	NA	NA	NA	NA
WP_007869717.1\|3420080_3420965_+	NgrB	NA	NA	NA	NA
WP_013098169.1\|3421225_3421963_+	WYL domain-containing protein	NA	NA	NA	NA
WP_044597862.1\|3422019_3422292_+	hypothetical protein	NA	NA	NA	NA
WP_007869721.1\|3422371_3422632_+	hypothetical protein	NA	NA	NA	NA
WP_007869723.1\|3422758_3423580_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.5e-44	38.7
WP_007869725.1\|3423603_3423843_+	DUF905 domain-containing protein	NA	NA	NA	NA
WP_013098170.1\|3423946_3424405_+	antirestriction protein	A9J566	Pseudomonas_phage	1.9e-12	31.4
WP_013098171.1\|3424420_3424897_+	RadC family protein	NA	NA	NA	NA
WP_013098172.1\|3424905_3425133_+	DUF987 domain-containing protein	NA	NA	NA	NA
WP_007869729.1\|3425146_3425464_+	type IV toxin-antitoxin system YeeU family antitoxin	NA	NA	NA	NA
WP_007869731.1\|3425484_3425811_+	YkfI toxin protein	NA	NA	NA	NA
WP_044597861.1\|3426045_3427377_-	membrane protein	NA	NA	NA	NA
WP_044597860.1\|3427478_3429071_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.1e-173	61.4
WP_044596438.1\|3429101_3429452_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.3e-41	65.5
WP_016946740.1\|3429448_3429856_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.1e-15	37.8

DBSCAN-SWA_8

3763075 : 3771582

Escherichia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086538201.1\|3763075_3764092_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	5.4e-185	98.5
WP_023294397.1\|3764759_3765209_+	L-alanine exporter AlaE	NA	NA	NA	NA
WP_008502568.1\|3765241_3765586_-	YgaC family protein	NA	NA	NA	NA
WP_008502569.1\|3765746_3766073_+	DUF883 domain-containing protein	NA	NA	NA	NA
WP_008502570.1\|3766316_3766556_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.2e-11	41.9
WP_044597751.1\|3766552_3766963_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	3.9e-17	43.4
WP_044597750.1\|3766935_3769080_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	7.3e-200	49.1
WP_044597749.1\|3769089_3770049_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	6.3e-135	74.3
WP_008502574.1\|3770379_3771582_+	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.9e-27	38.3

DBSCAN-SWA_9

4022462 : 4079985

uncultured_Caudovirales_phage(23.08%)

transposase,tRNA,integrase

attL 4062646:4062664|attR 4086750:4086768

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025912470.1\|4022462_4023182_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_044597665.1\|4023320_4024379_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_008499765.1\|4024405_4024678_+	oxidative damage protection protein	NA	NA	NA	NA
WP_021242082.1\|4024802_4025879_+	membrane-bound lytic murein transglycosylase MltC	NA	NA	NA	NA
WP_008499767.1\|4026097_4027354_+	nucleoside permease	NA	NA	NA	NA
WP_044597664.1\|4027433_4028237_-	triphosphoribosyl-dephospho-CoA synthase CitG	NA	NA	NA	NA
WP_032664362.1\|4028214_4028754_-	citrate lyase holo-[acyl-carrier protein] synthase	NA	NA	NA	NA
WP_044597663.1\|4028750_4030274_-	citrate lyase subunit alpha	NA	NA	NA	NA
WP_032655004.1\|4030284_4031160_-	citrate (pro-3S)-lyase subunit beta	NA	NA	NA	NA
WP_032653346.1\|4031156_4031450_-	citrate lyase acyl carrier protein	NA	NA	NA	NA
WP_044597662.1\|4031466_4032489_-	[citrate (pro-3S)-lyase] ligase	NA	NA	NA	NA
WP_021242089.1\|4032502_4033366_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_044597661.1\|4033383_4034745_-	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_044597660.1\|4035089_4036715_+	sensor histidine kinase	NA	NA	NA	NA
WP_044597659.1\|4036704_4037397_+	response regulator	NA	NA	NA	NA
WP_044597658.1\|4037485_4039621_-	ornithine decarboxylase	NA	NA	NA	NA
WP_008499781.1\|4039803_4040517_+	DUF554 domain-containing protein	NA	NA	NA	NA
WP_004115409.1\|4040883_4041915_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_044597657.1\|4041974_4043594_-	DNA-binding domain-containing protein	NA	NA	NA	NA
WP_004115414.1\|4043660_4045136_-	AAA family ATPase	A0A075DXT4	Acinetobacter_phage	2.6e-47	31.5
WP_004115417.1\|4045296_4046682_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_025760278.1\|4047538_4047790_+	hypothetical protein	NA	NA	NA	NA
WP_032742914.1\|4047864_4049298_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.1e-103	50.5
WP_025760317.1\|4049339_4050539_-	restriction endonuclease	E5E3X4	Burkholderia_phage	1.1e-32	39.1
WP_077254457.1\|4050674_4051271_-	toll/interleukin-1 receptor domain-containing protein	A0A097BYB4	Enterococcus_phage	2.8e-08	26.6
WP_053287147.1\|4051266_4051494_+	hypothetical protein	NA	NA	NA	NA
WP_053287146.1\|4051510_4052236_-	hypothetical protein	NA	NA	NA	NA
WP_032742913.1\|4052326_4053259_-	AAA family ATPase	NA	NA	NA	NA
WP_025760314.1\|4053255_4053774_-	hypothetical protein	NA	NA	NA	NA
WP_025760313.1\|4053781_4054747_-	nucleotidyltransferase	NA	NA	NA	NA
WP_001515173.1\|4054929_4055253_+	helix-turn-helix transcriptional regulator	F8TVE5	EBPR_siphovirus	7.5e-08	41.7
WP_025760312.1\|4055255_4056122_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_000427623.1\|4056615_4057620_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_031591996.1\|4058219_4058573_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	6.9e-23	49.1
WP_031591995.1\|4058620_4058983_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_031591994.1\|4058999_4060751_+	arsenical pump-driving ATPase	NA	NA	NA	NA
WP_031591992.1\|4060797_4062087_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	3.5e-173	74.0
WP_031591991.1\|4062099_4062525_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	6.1e-50	70.0
4062646:4062664	attL	NA	NA	NA	NA
WP_032742911.1\|4062715_4063696_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.0e-184	98.5
WP_004729618.1\|4064236_4065010_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	7.3e-09	26.0
WP_001194072.1\|4065075_4065777_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_023287189.1\|4065842_4066949_-	alkene reductase	NA	NA	NA	NA
WP_008502229.1\|4067162_4067492_+	thioredoxin family protein	NA	NA	NA	NA
WP_000888080.1\|4067521_4067860_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_000210409.1\|4067864_4068446_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000108589.1\|4068587_4069145_-	OsmC family protein	NA	NA	NA	NA
WP_012695450.1\|4069331_4069916_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	9.7e-22	35.5
WP_032742905.1\|4070075_4073060_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	9.9e-304	54.1
WP_000427623.1\|4073138_4074143_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_032742903.1\|4074754_4075687_-	DUF1281 domain-containing protein	NA	NA	NA	NA
WP_032742901.1\|4075792_4076779_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	3.8e-50	39.9
WP_032742899.1\|4076879_4077527_-	hypothetical protein	NA	NA	NA	NA
WP_032742894.1\|4077608_4077974_-	hypothetical protein	NA	NA	NA	NA
WP_040118087.1\|4078069_4078429_-	hypothetical protein	NA	NA	NA	NA
WP_032742891.1\|4079085_4079985_-\|integrase	site-specific integrase	NA	NA	NA	NA
4086750:4086768	attR	NA	NA	NA	NA

DBSCAN-SWA_10

4383530 : 4486697

uncultured_Caudovirales_phage(42.86%)

protease,terminase,integrase,head,portal,capsid,transposase,tail,tRNA

attL 4412014:4412030|attR 4465029:4465045

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044597578.1\|4383530_4386386_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	7.9e-141	36.7
WP_008502817.1\|4386509_4387013_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021242270.1\|4387096_4388116_+	NAD(P)-dependent alcohol dehydrogenase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	1.1e-44	31.0
WP_044597577.1\|4388159_4389800_-	DAK2 domain-containing protein	NA	NA	NA	NA
WP_044597576.1\|4389937_4391440_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	2.6e-82	44.0
WP_100122167.1\|4391419_4392361_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	8.9e-17	34.4
WP_044597575.1\|4393048_4397509_+	glutamate synthase large subunit	NA	NA	NA	NA
WP_021242274.1\|4397518_4398937_+	glutamate synthase subunit GltD	NA	NA	NA	NA
WP_023294675.1\|4399118_4399679_-	outer membrane protein	NA	NA	NA	NA
WP_023326178.1\|4399675_4402090_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_008502827.1\|4402105_4402810_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_008502828.1\|4402930_4403608_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_025912562.1\|4404058_4404556_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.1e-26	55.8
WP_008502830.1\|4404561_4405200_-	stringent starvation protein A	NA	NA	NA	NA
WP_003860436.1\|4405508_4405901_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_003860434.1\|4405916_4406345_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_044597574.1\|4406644_4407769_-	cell division protein ZapE	NA	NA	NA	NA
WP_008502832.1\|4407958_4408357_+	DUF1043 family protein	NA	NA	NA	NA
WP_021242281.1\|4408528_4409896_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	1.3e-21	26.1
WP_008502834.1\|4409987_4411055_+	outer membrane-stress sensor serine endopeptidase DegS	NA	NA	NA	NA
WP_008502835.1\|4411111_4412050_-	malate dehydrogenase	NA	NA	NA	NA
4412014:4412030	attL	NA	NA	NA	NA
WP_008502836.1\|4412447_4412918_+	transcriptional regulator ArgR	NA	NA	NA	NA
WP_008502837.1\|4413293_4413557_+	peroxide/acid stress response protein YhcN	NA	NA	NA	NA
WP_008502838.1\|4413667_4413934_+	peroxide/acid stress response protein YhcN	NA	NA	NA	NA
WP_044597573.1\|4413995_4414268_-	hypothetical protein	NA	NA	NA	NA
WP_044597572.1\|4414313_4415768_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_008502841.1\|4415858_4417826_-	p-hydroxybenzoic acid efflux pump subunit AaeB	NA	NA	NA	NA
WP_021242282.1\|4417831_4418764_-	p-hydroxybenzoic acid efflux pump subunit AaeA	NA	NA	NA	NA
WP_003860416.1\|4418771_4418975_-	AaeX family protein	NA	NA	NA	NA
WP_044597571.1\|4419154_4420081_+	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
WP_008502844.1\|4420300_4420915_+	YagU family protein	NA	NA	NA	NA
WP_021242283.1\|4420961_4422407_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_044597570.1\|4422491_4426289_-	AsmA2 domain-containing protein	NA	NA	NA	NA
WP_008502847.1\|4426330_4427800_-	ribonuclease G	NA	NA	NA	NA
WP_021242285.1\|4427789_4428383_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_008502849.1\|4428392_4428881_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_008502850.1\|4428880_4429897_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000913396.1\|4429959_4431003_-	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3
WP_162230876.1\|4430971_4431205_+	hypothetical protein	NA	NA	NA	NA
WP_025912568.1\|4431285_4433226_-	RNase E specificity factor CsrD	NA	NA	NA	NA
WP_023294684.1\|4433408_4434383_+	oxidoreductase	NA	NA	NA	NA
WP_008502853.1\|4434460_4435462_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_008502854.1\|4435462_4436062_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_008502855.1\|4436296_4436749_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_008502856.1\|4436770_4437235_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_003860388.1\|4437245_4438595_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_021242290.1\|4438703_4438946_+	YhdT family protein	NA	NA	NA	NA
WP_044597569.1\|4438935_4440387_+	sodium/pantothenate symporter	NA	NA	NA	NA
WP_044597568.1\|4440398_4441280_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_021242291.1\|4441407_4442148_+	carbonic anhydrase family protein	NA	NA	NA	NA
WP_008502861.1\|4442478_4443444_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_000462905.1\|4443467_4443764_+	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
WP_040215040.1\|4444112_4444451_-	hypothetical protein	NA	NA	NA	NA
WP_044597567.1\|4444459_4445062_-\|tail	tail assembly protein	K7P6M0	Enterobacteria_phage	1.8e-63	65.5
WP_044597566.1\|4445075_4446737_-\|terminase	terminase large subunit	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	98.2
WP_023326190.1\|4446720_4447077_-\|terminase	phage terminase small subunit P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	4.6e-59	95.8
WP_001547822.1\|4447205_4447358_-	hypothetical protein	A0A2H4JCY9	uncultured_Caudovirales_phage	1.3e-15	84.0
WP_021538170.1\|4447350_4447794_-	HNH endonuclease	A0A2H4JAS8	uncultured_Caudovirales_phage	2.3e-79	93.9
WP_001547824.1\|4447793_4448093_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JD08	uncultured_Caudovirales_phage	3.4e-39	80.8
WP_004150961.1\|4448089_4448425_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	3.7e-26	57.8
WP_044597565.1\|4448421_4449672_-\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	4.8e-228	95.6
WP_000848270.1\|4449673_4450234_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	7.7e-101	98.4
WP_044597564.1\|4450285_4451452_-\|capsid	phage major capsid protein	A0A2H4JED2	uncultured_Caudovirales_phage	5.6e-210	97.2
WP_039671529.1\|4451728_4452199_+	hypothetical protein	NA	NA	NA	NA
WP_023293261.1\|4452245_4452581_-	hypothetical protein	NA	NA	NA	NA
WP_044597563.1\|4452923_4455059_-	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	1.4e-206	62.3
WP_001549749.1\|4455058_4455424_-	hypothetical protein	NA	NA	NA	NA
WP_040194363.1\|4455420_4455789_-	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	5.7e-52	81.1
WP_004218267.1\|4455887_4456016_+	hypothetical protein	NA	NA	NA	NA
WP_044597561.1\|4456092_4456281_-	hypothetical protein	NA	NA	NA	NA
WP_157263200.1\|4456273_4456492_-	host cell division inhibitor Icd-like protein	A0A2H4JGW3	uncultured_Caudovirales_phage	1.4e-34	94.4
WP_044597560.1\|4457042_4457822_-	ROK family transcriptional regulator	Q8HA02	Enterobacteria_phage	4.8e-40	52.0
WP_049007531.1\|4457833_4458118_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_044597559.1\|4458299_4459241_-	hypothetical protein	NA	NA	NA	NA
WP_044597558.1\|4459333_4460560_-\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	1.2e-151	62.4
WP_008502862.1\|4460925_4461090_+	DUF2556 family protein	NA	NA	NA	NA
WP_044597557.1\|4461228_4463310_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	1.7e-23	35.9
WP_008502864.1\|4463225_4463945_-	acrEF/envCD operon transcriptional regulator	NA	NA	NA	NA
WP_023294691.1\|4465484_4468598_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
4465029:4465045	attR	NA	NA	NA	NA
WP_008502867.1\|4468902_4469124_+	lipoprotein	NA	NA	NA	NA
WP_044597556.1\|4470690_4471872_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_023326203.1\|4471881_4472985_+	ABC transporter permease	NA	NA	NA	NA
WP_014171880.1\|4472992_4473751_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-19	30.3
WP_087451024.1\|4473861_4474981_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_044597555.1\|4480773_4481328_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_023345007.1\|4481303_4481552_-	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_044597554.1\|4481548_4482367_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_008503475.1\|4482371_4482944_-	L-threonylcarbamoyladenylate synthase type 1 TsaC	A0A291ATS8	Pandoravirus	4.9e-10	27.1
WP_023294698.1\|4482936_4483491_-	DNA topoisomerase type IA Zn finger domain-containing protein	NA	NA	NA	NA
WP_008503477.1\|4483517_4483991_-	DUF494 domain-containing protein	NA	NA	NA	NA
WP_044598020.1\|4483962_4485087_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_008503479.1\|4485214_4485724_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.9e-19	40.3
WP_008503480.1\|4485749_4486697_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	4.9e-07	31.3

DBSCAN-SWA_11

4631973 : 4673847

Bacillus_phage(30.77%)

transposase,integrase

attL 4631900:4631917|attR 4678057:4678074

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4631900:4631917	attL	NA	NA	NA	NA
WP_044597507.1\|4631973_4633131_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_008503109.1\|4633234_4634260_-	TerC/Alx family metal homeostasis membrane protein	K7QKE8	Escherichia_phage	7.8e-75	47.1
WP_008503110.1\|4634423_4634822_-	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_032653809.1\|4635137_4636475_+	MFS transporter	NA	NA	NA	NA
WP_039267175.1\|4636509_4637247_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_044597506.1\|4637416_4638109_+	diguanylate cyclase	E3T536	Cafeteria_roenbergensis_virus	4.3e-08	35.3
WP_008503114.1\|4638108_4639047_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	4.3e-27	31.5
WP_016946740.1\|4639414_4639822_+\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.1e-15	37.8
WP_044596438.1\|4639818_4640169_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.3e-41	65.5
WP_044596437.1\|4640199_4641792_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	5.1e-174	61.6
WP_000723069.1\|4641919_4642354_-	copper resistance system metallochaperone PcoE	NA	NA	NA	NA
WP_001211180.1\|4642571_4643972_-	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	3.2e-18	26.6
WP_001188930.1\|4643968_4644649_-	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4
WP_000998778.1\|4644703_4645633_-	copper resistance inner membrane protein PcoD	NA	NA	NA	NA
WP_000025662.1\|4645637_4646018_-	copper resistance system metallochaperone PcoC	NA	NA	NA	NA
WP_001242438.1\|4646057_4646954_-	copper resistance outer membrane transporter PcoB	NA	NA	NA	NA
WP_000925240.1\|4646953_4648771_-	multicopper oxidase PcoA	NA	NA	NA	NA
WP_001023257.1\|4649005_4649455_+	copper resistance protein	NA	NA	NA	NA
WP_000287501.1\|4649743_4650481_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.0e-12	41.0
WP_000843494.1\|4650514_4650712_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_001353604.1\|4650752_4653200_-	Ag(+)-translocating P-type ATPase SilP	A0A218MNH6	uncultured_virus	1.3e-83	35.3
WP_000758225.1\|4653326_4653767_-	hypothetical protein	NA	NA	NA	NA
WP_000574029.1\|4653853_4657000_-	Cu(+)/Ag(+) efflux RND transporter permease subunit SilA	NA	NA	NA	NA
WP_000157620.1\|4657010_4658303_-	Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB	NA	NA	NA	NA
WP_001246155.1\|4658416_4658770_-	cation efflux system protein CusF	NA	NA	NA	NA
WP_000475506.1\|4658797_4660183_-	Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC	NA	NA	NA	NA
WP_000697968.1\|4660372_4661053_+	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	2.7e-31	36.0
WP_000555736.1\|4661045_4662527_+	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.8e-27	30.1
WP_000790485.1\|4662771_4663203_+	silver-binding protein SilE	NA	NA	NA	NA
WP_000647571.1\|4663350_4663701_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	8.1e-16	61.4
WP_001239419.1\|4663869_4665696_-	AAA family ATPase	NA	NA	NA	NA
WP_001097216.1\|4666259_4666559_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044597505.1\|4666911_4667838_-	hypothetical protein	NA	NA	NA	NA
WP_001324699.1\|4667849_4669406_-\|transposase	transposase	NA	NA	NA	NA
WP_001049180.1\|4669446_4670895_-	ATP-binding protein	NA	NA	NA	NA
WP_000351437.1\|4670894_4673018_-\|transposase	transposase	NA	NA	NA	NA
WP_000090707.1\|4673004_4673847_-\|transposase	transposase	NA	NA	NA	NA
4678057:4678074	attR	NA	NA	NA	NA

DBSCAN-SWA_12

4814951 : 4929677

108

Salmonella_phage(76.19%)

protease,terminase,integrase,head,portal,plate,capsid,holin,tail,tRNA

attL 4867172:4867213|attR 4898612:4898653

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044597478.1\|4814951_4816052_+\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA
WP_008501783.1\|4816131_4816491_-	YijD family membrane protein	NA	NA	NA	NA
WP_008501784.1\|4816500_4817139_-	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_008501785.1\|4817335_4818736_+	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_044597477.1\|4818709_4819636_-	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_044597476.1\|4819931_4821305_-	argininosuccinate lyase	NA	NA	NA	NA
WP_088728450.1\|4821379_4822156_-	acetylglutamate kinase	NA	NA	NA	NA
WP_008501789.1\|4822162_4823167_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_008501790.1\|4823255_4824407_+	acetylornithine deacetylase	NA	NA	NA	NA
WP_023345106.1\|4824653_4827305_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_023326307.1\|4827400_4828249_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044597475.1\|4828235_4828592_-	PTS fructose-like transporter subunit IIB	NA	NA	NA	NA
WP_044597474.1\|4828594_4829470_-	[formate-C-acetyltransferase]-activating enzyme	NA	NA	NA	NA
WP_044597473.1\|4829435_4831733_-	formate C-acetyltransferase	A0A1S6UAD4	Serratia_phage	7.8e-06	48.1
WP_023326311.1\|4831784_4832105_-	PTS fructose-like transporter subunit IIB	NA	NA	NA	NA
WP_044597472.1\|4832119_4833199_-	PTS fructose transporter subunit EIIC	NA	NA	NA	NA
WP_044597471.1\|4833504_4836006_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	2.5e-10	25.9
WP_021242818.1\|4836020_4836683_+	fructose-6-phosphate aldolase	A0A0E3F0E2	Synechococcus_phage	8.4e-30	34.1
WP_008501794.1\|4836695_4837799_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_044597470.1\|4837890_4840071_-	catalase/peroxidase HPI	NA	NA	NA	NA
WP_008501796.1\|4840218_4841106_-	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_008501797.1\|4841332_4843765_-	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_021242813.1\|4843767_4844928_-	cystathionine gamma-synthase	NA	NA	NA	NA
WP_003862042.1\|4845204_4845522_+	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_003862040.1\|4845570_4845783_-	50S ribosomal protein L31	NA	NA	NA	NA
WP_044597469.1\|4845983_4848179_+	primosomal protein N'	NA	NA	NA	NA
WP_044597468.1\|4848298_4849324_+	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_032622950.1\|4849417_4850407_+	cell division protein FtsN	NA	NA	NA	NA
WP_008501802.1\|4850501_4851032_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_008501803.1\|4851041_4852376_+	HslU--HslV peptidase ATPase subunit	A0A173GE36	Erwinia_phage	7.1e-44	29.2
WP_008501804.1\|4852444_4853365_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_008501805.1\|4853457_4853943_+	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_008501806.1\|4854528_4854768_-	septal ring assembly protein ZapB	NA	NA	NA	NA
WP_014885705.1\|4855178_4856024_+	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	8.9e-16	29.5
WP_044597467.1\|4856045_4857554_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_023293599.1\|4857672_4858683_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_044597466.1\|4858779_4859526_+	ferredoxin--NADP(+) reductase	NA	NA	NA	NA
WP_008501811.1\|4859526_4859946_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_044597465.1\|4860058_4860655_+	DUF1454 family protein	NA	NA	NA	NA
WP_003862019.1\|4860766_4861534_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_039265638.1\|4861615_4862920_-	citrate transporter	NA	NA	NA	NA
WP_044597464.1\|4862993_4863737_-	CDP-diacylglycerol diphosphatase	NA	NA	NA	NA
WP_044597463.1\|4863844_4864834_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008501816.1\|4865052_4866015_-	6-phosphofructokinase	NA	NA	NA	NA
WP_008501817.1\|4866189_4867083_-	CDF family cation-efflux transporter FieF	NA	NA	NA	NA
4867172:4867213	attL	NA	NA	NA	NA
WP_044597462.1\|4867327_4867975_-	type VI secretion protein	NA	NA	NA	NA
WP_044597461.1\|4867971_4868304_-	hypothetical protein	NA	NA	NA	NA
WP_001251454.1\|4868405_4868648_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_044597460.1\|4868696_4869815_-	phage late control D family protein	A0A0M4REC6	Salmonella_phage	1.5e-191	99.2
WP_000224788.1\|4869972_4871166_+\|tail	tail protein	A0A0M4S6M1	Salmonella_phage	7.7e-215	94.2
WP_001207578.1\|4871178_4871694_+\|tail	phage major tail tube protein	A0A0M5M1I5	Salmonella_phage	4.2e-93	98.8
WP_000047593.1\|4871708_4872044_+	hypothetical protein	A0A0M4RCV2	Salmonella_phage	3.0e-52	99.1
WP_000763324.1\|4872052_4872169_+\|tail	GpE family phage tail protein	A0A0M3ULA8	Salmonella_phage	6.6e-15	100.0
WP_044597459.1\|4872169_4875340_+\|tail	phage tail tape measure protein	A0A0M4R2V3	Salmonella_phage	0.0e+00	74.2
WP_023276958.1\|4875350_4875800_+\|tail	phage tail protein	A0A1J0I2L5	Salmonella_phage	2.2e-74	92.6
WP_044597458.1\|4876252_4876708_-\|tail	tail assembly chaperone	K7PMC4	Enterobacterial_phage	1.2e-22	50.5
WP_071882582.1\|4876710_4878405_-	hypothetical protein	M1TAS6	Escherichia_phage	1.3e-138	72.3
WP_044597457.1\|4878401_4879010_-\|tail	phage tail protein I	E5G6N9	Salmonella_phage	4.0e-95	81.5
WP_044597456.1\|4879002_4879914_-\|plate	baseplate assembly protein	A0A0M4REB7	Salmonella_phage	5.4e-160	98.3
WP_000108898.1\|4879910_4880273_-\|plate	baseplate assembly protein	A0A0M4S6L5	Salmonella_phage	5.0e-61	100.0
WP_001052319.1\|4880269_4880899_-\|plate	phage baseplate assembly protein V	A0A0M3ULA5	Salmonella_phage	5.4e-111	97.6
WP_001337857.1\|4881056_4881701_-	phage virion morphogenesis protein	A0A0M4RCU1	Salmonella_phage	1.2e-116	98.1
WP_000917105.1\|4881661_4882156_-\|tail	phage tail protein	A0A0M4R2U5	Salmonella_phage	8.7e-80	98.0
WP_001373667.1\|4882155_4882689_-	DUF2514 family protein	A0A0M4S5V1	Salmonella_phage	5.7e-45	94.8
WP_023309713.1\|4882790_4883231_-	lysozyme	A0A0M5M782	Salmonella_phage	8.8e-76	96.6
WP_000543937.1\|4883214_4883550_-\|holin	phage holin, lambda family	A0A0M3ULH4	Salmonella_phage	2.1e-53	98.2
WP_001102549.1\|4883560_4883761_-\|tail	tail protein	A0A0M4RTN6	Salmonella_phage	1.8e-31	100.0
WP_016246752.1\|4883760_4884249_-\|head	head completion/stabilization protein	A0A0M4QWR7	Salmonella_phage	5.2e-85	97.5
WP_044597455.1\|4884351_4885200_-\|terminase	terminase	A0A0M4R523	Salmonella_phage	1.4e-133	97.5
WP_001246221.1\|4885242_4886289_-\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	9.1e-196	98.8
WP_044598013.1\|4886329_4887175_-\|capsid	GPO family capsid scaffolding protein	A0A1J0I2E9	Salmonella_phage	3.5e-153	97.2
WP_001090183.1\|4887328_4889041_+\|terminase	terminase	A0A0M4S6K7	Salmonella_phage	0.0e+00	98.4
WP_000014576.1\|4889041_4890091_+\|portal	phage portal protein	A0A0M5M1H6	Salmonella_phage	6.7e-207	100.0
WP_044597454.1\|4890486_4891125_-	hypothetical protein	NA	NA	NA	NA
WP_044597453.1\|4891128_4892127_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_044597452.1\|4892285_4894640_-	replication endonuclease	A0A0M4RTM8	Salmonella_phage	0.0e+00	86.9
WP_001048820.1\|4894636_4894816_-	hypothetical protein	NA	NA	NA	NA
WP_044597451.1\|4894815_4895787_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A0M4QWR0	Salmonella_phage	1.1e-137	81.3
WP_044597450.1\|4895788_4896001_-	hypothetical protein	A0A0M4R514	Salmonella_phage	7.3e-20	67.1
WP_044597449.1\|4896086_4896317_-	DUF2724 domain-containing protein	A0A0M4S6M9	Salmonella_phage	6.1e-36	94.7
WP_071882583.1\|4896306_4896513_-	DUF4761 family protein	A0A0M5M1I3	Salmonella_phage	2.8e-32	98.5
WP_044597448.1\|4896523_4896727_-	hypothetical protein	A0A0M3ULI0	Salmonella_phage	2.6e-30	97.0
WP_021312625.1\|4896737_4897019_-	hypothetical protein	A0A0M4RCW1	Salmonella_phage	2.0e-49	97.8
WP_016246740.1\|4897130_4897451_+	transcriptional regulator	A0A0M5M1I9	Salmonella_phage	2.9e-44	84.9
WP_016246739.1\|4897520_4898501_+\|integrase	tyrosine-type recombinase/integrase	A0A0M4RTQ0	Salmonella_phage	2.1e-186	98.8
WP_044597447.1\|4898675_4899182_-	cell-envelope stress modulator CpxP	NA	NA	NA	NA
4898612:4898653	attR	NA	NA	NA	NA
WP_006179159.1\|4899332_4900031_+	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	2.4e-06	30.3
WP_003862003.1\|4900027_4901401_+	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	5.5e-15	25.6
WP_044597446.1\|4901454_4902129_-	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
WP_003861999.1\|4902200_4902821_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	2.2e-64	59.8
WP_044597445.1\|4902983_4904249_-	MFS transporter	NA	NA	NA	NA
WP_044597444.1\|4904293_4906417_-	alpha-galactosidase	NA	NA	NA	NA
WP_023345118.1\|4906520_4907516_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_021242797.1\|4907533_4908082_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023293608.1\|4908184_4908844_+	azaleucine resistance protein AzlC	NA	NA	NA	NA
WP_023618141.1\|4908843_4909167_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_008501827.1\|4909207_4909420_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_044597443.1\|4909534_4910371_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_088728449.1\|4910742_4913793_+	formate dehydrogenase-N subunit alpha	NA	NA	NA	NA
WP_008501831.1\|4913805_4914708_+	formate dehydrogenase subunit beta	NA	NA	NA	NA
WP_008501832.1\|4914704_4915340_+	formate dehydrogenase cytochrome b556 subunit	NA	NA	NA	NA
WP_008501833.1\|4915336_4916266_+	formate dehydrogenase accessory protein FdhE	NA	NA	NA	NA
WP_050009968.1\|4916455_4918150_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_023326328.1\|4918152_4918665_+	toxin-activating lysine-acyltransferase	NA	NA	NA	NA
WP_063448628.1\|4927414_4927669_+	hypothetical protein	NA	NA	NA	NA
WP_084832492.1\|4927703_4928003_-	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_023326334.1\|4928253_4929195_-	fatty acid biosynthesis protein FabY	NA	NA	NA	NA
WP_008501836.1\|4929239_4929677_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012163

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012162

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection