CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP012167	Enterobacter hormaechei subsp. steigerwaltii strain 34998 chromosome, complete genome	1 crisprs	DEDDh,csa3,WYL,DinG,cas14j,cas3	1	6
NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	0 crisprs	PD-DExK	0	1
NZ_CP010381	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-4.921kb, complete sequence	0 crisprs	NA	0	0
NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	1 crisprs	csa3	1	3
NZ_CP010383	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-106.409kb, complete sequence	0 crisprs	NA	0	1
NZ_CP010382	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012167_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012167_1

1583994-1584082

Orphan

I-F

Consensus_repeat	Method
GTTCACTGCCGGGCAGGCAGCTTAGAAAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012167_1

>merge|NZ_CP012167|1|1583994-1584082|CRISPRCasFinder
GTTCACTGCCGGGCAGGCAGCTTAGAAATACGGCGACACCGACACGCGCCAGCGTGTTTTGTTCACTGCCGGGCAGGCAGCTTAGAAAT

>NZ_CP012167|1|1|1583994-1584082|CRISPRCasFinder
GTTCACTGCCGGGCAGGCAGCTTAGAAAT	ACGGCGACACCGACACGCGCCAGCGTGTTTT
GTTCACTGCCGGGCAGGCAGCTTAGAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012167.1\|WP_017384851.1\|1580955_1581957_-\|low-specificity-L-threonine-aldolase	unknown	unknown	gnl\|CDD\|236710
NZ_CP012167.1\|WP_039271219.1\|1579508_1580945_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187556
NZ_CP012167.1\|WP_039271212.1\|1592129_1593245_+\|macrolide-transporter-subunit-MacA	unknown	unknown	gnl\|CDD\|183211
NZ_CP012167.1\|WP_015570988.1\|1587295_1588195_-\|lysine-exporter-LysO-family-protein	unknown	unknown	gnl\|CDD\|225287
NZ_CP012167.1\|WP_039271221.1\|1576429_1578256_+\|PKD-domain-containing-protein	unknown	unknown	gnl\|CDD\|381595
NZ_CP012167.1\|WP_154294646.1\|1584104_1584242_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012167.1\|WP_032653093.1\|1567863_1568502_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012167.1\|WP_039271225.1\|1568501_1570064_-\|peptidoglycan-binding-protein	unknown	unknown	gnl\|CDD\|366659
NZ_CP012167.1\|WP_017384852.1\|1578402_1579416_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223528
NZ_CP012167.1\|WP_015571003.1\|1571109_1573026_+\|type-II-secretion-system-secretin-GspD	unknown	unknown	gnl\|CDD\|274175
NZ_CP012167.1\|WP_039271214.1\|1591013_1591970_-\|DUF535-domain-containing-protein	unknown	unknown	gnl\|CDD\|377343
NZ_CP012167.1\|WP_157843885.1\|1584299_1584449_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012167.1\|WP_017384850.1\|1581995_1583714_-\|ubiquinone-dependent-pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|181661
NZ_CP012167.1\|WP_032103428.1\|1588371_1589067_-\|aquaporin-Z	unknown	unknown	gnl\|CDD\|235453
NZ_CP012167.1\|WP_022650708.1\|1575854_1576295_+\|type-III-secretion-system-invasion-protein-IagB	unknown	unknown	gnl\|CDD\|185228
NZ_CP012167.1\|WP_039271223.1\|1570364_1571096_+\|type-II-secretion-system-protein-GspC	unknown	unknown	gnl\|CDD\|273770
NZ_CP012167.1\|WP_017693710.1\|1584519_1585488_-\|NADH-oxidoreductase	unknown	unknown	gnl\|CDD\|236735
NZ_CP012167.1\|WP_039271216.1\|1585498_1587151_-\|hydroxylamine-reductase	unknown	unknown	gnl\|CDD\|235391
NZ_CP012167.1\|WP_017693708.1\|1589358_1591017_+\|ATP-dependent-endonuclease	unknown	unknown	gnl\|CDD\|226121
NZ_CP012167.1\|WP_039271209.1\|1593241_1595182_+\|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB	unknown	unknown	gnl\|CDD\|182528

Protein	Function_ID	Function_description	E-value
NZ_CP012167.1\|WP_017384851.1\|1580955_1581957_-\|low-specificity-L-threonine-aldolase	gnl\|CDD\|236710	PRK10534, PRK10534, L-threonine aldolase; Provisional.	0
NZ_CP012167.1\|WP_039271219.1\|1579508_1580945_-\|SDR-family-oxidoreductase	gnl\|CDD\|187556	cd05245, SDR_a2, atypical (a) SDRs, subgroup 2. This subgroup contains atypical SDRs, one member is identified as Escherichia coli protein ybjT, function unknown. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that generally matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.55103e-142
NZ_CP012167.1\|WP_039271212.1\|1592129_1593245_+\|macrolide-transporter-subunit-MacA	gnl\|CDD\|183211	PRK11578, PRK11578, macrolide transporter subunit MacA; Provisional.	0
NZ_CP012167.1\|WP_039271221.1\|1576429_1578256_+\|PKD-domain-containing-protein	gnl\|CDD\|381595	cd00325, chitinase_GH19, Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.	2.39359e-72
NZ_CP012167.1\|WP_015570988.1\|1587295_1588195_-\|lysine-exporter-LysO-family-protein	gnl\|CDD\|225287	COG2431, COG2431, Predicted membrane protein [Function unknown].	2.69399e-117
NZ_CP012167.1\|WP_039271225.1\|1568501_1570064_-\|peptidoglycan-binding-protein	gnl\|CDD\|366659	pfam01471, PG_binding_1, Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.	0.00506818
NZ_CP012167.1\|WP_017384852.1\|1578402_1579416_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	1.05058e-52
NZ_CP012167.1\|WP_015571003.1\|1571109_1573026_+\|type-II-secretion-system-secretin-GspD	gnl\|CDD\|274175	TIGR02517, Putative_type_II_secretion_system_protein_D, type II secretion system protein D. In Gram-negative bacteria, proteins that have first crossed the inner member by Sec-dependent protein transport can be exported across the outer membrane by type II secretion, also called the main terminal branch of the general secretion pathway. Members of this family are general secretion pathway protein D. In Yersinia enterocolitica, a second member of this family is part of a novel second type II secretion system specifically associated with virulence (See ). This family is closely homologous to the type IV pilus outer membrane secretin PilQ (TIGR02515) and to the type III secretion system pore YscC/HrcC (TIGR02516). [Protein fate, Protein and peptide secretion and trafficking].	3.40063e-180
NZ_CP012167.1\|WP_039271214.1\|1591013_1591970_-\|DUF535-domain-containing-protein	gnl\|CDD\|377343	pfam04393, DUF535, Protein of unknown function (DUF535). Family member Shigella flexneri VirK is a virulence protein required for the expression, or correct membrane localization of IcsA (VirG) on the bacterial cell surface,. This family also includes Pasteurella haemolytica lapB, which is thought to be membrane-associated.	1.15146e-126
NZ_CP012167.1\|WP_017384850.1\|1581995_1583714_-\|ubiquinone-dependent-pyruvate-dehydrogenase	gnl\|CDD\|181661	PRK09124, PRK09124, ubiquinone-dependent pyruvate dehydrogenase.	0
NZ_CP012167.1\|WP_032103428.1\|1588371_1589067_-\|aquaporin-Z	gnl\|CDD\|235453	PRK05420, PRK05420, aquaporin Z; Provisional.	8.80388e-146
NZ_CP012167.1\|WP_022650708.1\|1575854_1576295_+\|type-III-secretion-system-invasion-protein-IagB	gnl\|CDD\|185228	PRK15328, PRK15328, type III secretion system invasion protein IagB.	3.16013e-88
NZ_CP012167.1\|WP_039271223.1\|1570364_1571096_+\|type-II-secretion-system-protein-GspC	gnl\|CDD\|273770	TIGR01713, Type_II_secretion_system_protein_C, type II secretion system protein C. This model represents GspC, protein C of the main terminal branch of the general secretion pathway, also called type II secretion. This system transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	2.41205e-31
NZ_CP012167.1\|WP_017693710.1\|1584519_1585488_-\|NADH-oxidoreductase	gnl\|CDD\|236735	PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional.	0
NZ_CP012167.1\|WP_039271216.1\|1585498_1587151_-\|hydroxylamine-reductase	gnl\|CDD\|235391	PRK05290, PRK05290, hybrid cluster protein; Provisional.	0
NZ_CP012167.1\|WP_017693708.1\|1589358_1591017_+\|ATP-dependent-endonuclease	gnl\|CDD\|226121	COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair].	0
NZ_CP012167.1\|WP_039271209.1\|1593241_1595182_+\|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB	gnl\|CDD\|182528	PRK10535, PRK10535, macrolide ABC transporter ATP-binding protein/permease MacB.	0

>NZ_CP012167.1|WP_017384850.1|1581995_1583714_-|ubiquinone-dependent-pyruvate-dehydrogenase
MKQTVAAYIAKTLEQAGVKRIWGVTGDSLNGLSDSLNKMKTIEWMPTRHEEVAAFAAGAEAQLTGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAILNRGVSVVVLPGDVALKAAPETATTHWYSAPQPTITPAEEELKKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKLKAPVVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLILLGTQFPYRAFYPTDAKIIQIDINPGSIGAHSKVDMALIGDIKSTLAALLPLLEEKTDRKFLDKALSDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFADDDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAKATAPERQVVAMCGDGGFSMLMGDFLSVAQMKLPLKIVVFNNSVLGFVAMEMKAGGYLTDGTELHDTNFARIAEACGITGIRVEKASEVDDALQRAFTIDGPVLVDVVVAKEELAIPPQIKLEQAKGFSLYMLRAIISGRGDEVIELAKTNWLR
>NZ_CP012167.1|WP_017384851.1|1580955_1581957_-|low-specificity-L-threonine-aldolase
MIDLRSDTVTRPGRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAPDGSLPLAKVAAKIKADDIHFARTKLLSLENTHNGKVLPREYLKAAWDFTRERKLGLHVDGARIFNAVVEYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNADYIRRANRWRKMTGGGMRQAGILAAAGLYALKNNVSRLKDDHDNAAWMAAQLREIGADVMRHDTNMLFVRVGDEHAAALGDFMKARGVLINASPVVRLVMHLDVNREQLTEVVKHWQAFLQR
>NZ_CP012167.1|WP_039271219.1|1579508_1580945_-|SDR-family-oxidoreductase
MPQRILVLGASGYIGQHLTTALSQQGHQVLAAARNTERLQKLHLPGVTCHNVDLNWPKALPALLEGVDTLYYLVHSMGEGGDFIAHERQVAMNVRDALRQTPVKQVIFLSSLQAPEHEQSDHLRARQLTAETLRSAHIPVTELRAGIIVGAGSAAFEVMRDMVYNLPVLTPPRWVRSRTTPIALENLLHYLVALLDHPAEQHRVLEAAGPEVLSYQAQFEHFMRVSGRRRWLIPIPFPTRWISVWFLNVITSVPPTTAKALIQGLKHDLLADDRALRALIPQELIRFDDAVRNTLKEEEKLVNSSDWGYDAQAFARWRPEYGYYPKQAGCTVKTTASLAALWEVVNQIGGKERYFFGNILWQTRGALDLLVGHRLAKGRPAHPWLKVGDTVDSWKVIIVEPEKQLALLFGMKAPGLGRLCFTLKDNGDHRELDVRAWWHPHGMPGLFYWLLMIPAHLFIFRGMAKRIAQLAEEKRENN
>NZ_CP012167.1|WP_017384852.1|1578402_1579416_-|NAD(P)-dependent-oxidoreductase
MKVLVTGATSGLGRNAVEFLRNKGISVRATGRNEAMGKLLQKMGAEFVHADLTELVSSQAKVMLAGIDTLWHCSSFTSPWGTQEAFDLANVRATRRLGEWAVAWGVRNFIHISSPSLYFDYHHHRDIQEDFRPARFACEFARSKAAGEEVIDLLAQSNPHTRFTVLRPQSLFGPHDKVFIPRLAQMMHHYGSVLLPRGGDALVDMTYYENAVHAMWLASQPECDKLVSGRAYNITNGEPCTLRSIVQRLIDELKIDCRIRSVPYPMLDMIARSMERFGSKSAKEPALTHYGVSKLNFDFTLDISRAENELGYKPIVSLDEGIVRTAAWLRDHGKLHR
>NZ_CP012167.1|WP_039271221.1|1576429_1578256_+|PKD-domain-containing-protein
MNKRTLLSVLIAGACVAPFMAQAANLKETSSEPYTIKASDLAKKEKELTDFPLMASVKETIQTLDNAQVELIEPGRAANPDNVKRVEGIVKASDWEYLFPLRAQAYTYSNFLKAVGKFPALCKTYNDGRDSDAICRKELATMFAHFAQETGGHESWRPEAEWRQALVHVREMGWSEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNYNYGPFSEAMYGDVRTLLDKPELVADTWLNLASAIFFFAYPQPPKPSMLQVIDGTWQPNDHDKANGLVPGFGVTTQIINGGVECGGPTEIAQSQNRIKYYKEFANYLKVPVPANEVLGCANMKQFDEGGAGALKIYWEQDWGWSADTPDGKTYSCQLVGYQTPFSAFKEGDYSKCVQKFFNVKIVNDDGSSVTPDETPVTPTPTPSGDETPAPTPTPTPDETPVEPVVVNHAPVAQIAGPIGAVEAGAQVSLSAEGSTDPDGNKLTYTWRSQDGQTVTGQDKAVVTFTAPESATAQQYEVSLTVSDGELSSTTSYLLNVKAKAATPSGEDTSYPAWSANSKYNAGDIVNNHGKLFQCKPFPYSGWCNNSPTYYEPGAGLAWAEAWTAL
>NZ_CP012167.1|WP_022650708.1|1575854_1576295_+|type-III-secretion-system-invasion-protein-IagB
MKKLILLLLIISQSALANCWDKAAHYYHVDPYLLYAIANVESGMNPYAVGQNRDGTRDVGLMQINSSHFTALESRGIDEYRLITEPCTSIMVGASILSGMIRVYGYNWEAVGAYNAGLKKENYPQRMKYAHKVWAKYQQLKLAARY
>NZ_CP012167.1|WP_015571003.1|1571109_1573026_+|type-II-secretion-system-secretin-GspD
MKKFPWACVALTALSLYSSSLLAANFSASFKNTDIREFIDTVGRNLNKTILVDPSVQGTVSVRTYNVLTEDEYYQFFLSVLDLYGLSVIPMDNGMVKVVRSSVARTAGAPLADSKNPGKGDEIITRVVRMENVPVRELAPLLRQLNDATGIGNVVHFEPSNVLLLTGKASVVNRLVDLVQRVDKDGIQRREIIPLRFASAKELSDMLNNLNNEEQKGQNAPQLATKVVADDETNSLVISGSEDARARTRSLIHQLDREQNNEGNTRVFYLKYASATKVVPVLTGIGEQLKDKPGAAKAKTASASTDLNITADESTNSLVITAQPNVMNSLEKVIDKLDIRRPQVLVEAIIAEVQDGNGLDLGVQWTSKHGGVQFGATGLPISQIKNGTMKGASFTGLATGFFNGDFGALVTALSTDGKNDILSTPSVVTLDNKEASFNVGQDVPVLSGSQTTSGDNVFNSVERKTVGTKLKIVPQINDGDMIHLKIEQEVSSVDNSATEDSSLGPTFNTRTINNEVMVHSGQTVVLGGLMENVTKQSVSKVPLLGDIPLVGQLFRYTSQDTSKRNLMVFIHTTVLRDDDNYSAASKEKYDQIRVRQMQRVEEKKLGIVEPSDNAVLPAFPAASTAPVKTHAARNPFKE
>NZ_CP012167.1|WP_039271223.1|1570364_1571096_+|type-II-secretion-system-protein-GspC
MFLLLIFCGQQGYLTFKDYKKVMNKFANSDLQPLKKTREDKPFTLFTAAVRQENLSAAAKPPLAAEIEGIVRSDDAWLSFAVIKTPGGQRSYREGEPLAGFNDAFIQEINKDNVVVNYEGATQVLALNKPDYFKGGVESGPVTKSTKDAGAESVHLDDYLVLKPIIEKGRLEGYSINPRNASAFYSQSGLEKGDVAIQVNSVDMTDEAKAKSIIANWSKMKEAEVIVRRHAHLENIRVNVLNN
>NZ_CP012167.1|WP_039271225.1|1568501_1570064_-|peptidoglycan-binding-protein
MYQSHFNFKNPPFRTITRLSGDFLVPYHQDVFNLLKEKTQLAGIIGLFCDDAPLLGLFIDALKASNHTVLAINAFPKLSASSLLYKLNPGTKAIKDRMQAVDAVLRQWQEGKAKSRVVTIAHAEAMKESCREVLGTLLTRAQELNFRLAVVLTGNADQEILLKQPELREYTHTHHALRPLTCREYLSYVQAQCEEHGCENSPLPPARVRKMHTLTKGNISKLNALAHLSMLAAWTERAAQVSPRHLRLAAGEILPAQKHGKRLATVGLFASVLFAACGWYLTSSIGARLPIQLPVPVSWKQQTPKPEAAVVPVIDNEMVNQPDAMHQLYLMWGYDASADDALCQNAAKVNLMCKQGNASPEALAQQGYPWVSELKTSGHLNYAVVARVGDTSIDLLMNNRTWQVSRSWFNRHATGNFTQLHRLTPEGKDAIGAASDSKDMAWLDQQLSLALSQPETHAQIWTTEMMKRTREFQQKMHLHVDGIPGEDTLMQLMRVTNSTPGVLIQATRTTPDAKMQEKKA
>NZ_CP012167.1|WP_032653093.1|1567863_1568502_-|hypothetical-protein
MSTICLAAQRSYTTGEAVWFSYRLPSLKNVFGKTALWLVGLCVMLVVGLYMHVYWNLHHPAPEPVNASVAKPETQLSDMHYVYVSKPFPHPQPKAAPVPVDVPSMQDLPINSDDGDWQQAPDGAVPHDASRDTLPGTEAHEHDNAPASTGSEESSLTELFKQALKEQEQDYSQGKIPAPPVDETQDNSQASVKNSGNSRSPFSEKGDGGSRY
>NZ_CP012167.1|WP_154294646.1|1584104_1584242_-|hypothetical-protein
MQASAFAFGTSVGPVSVSATGLFAGWHYVYPAYIVPTACTAVNRG
>NZ_CP012167.1|WP_157843885.1|1584299_1584449_+|hypothetical-protein
MRWPAWAKSPVALTLAGLTEVPKANALACMGKKPGGADAYRAYRSYKGK
>NZ_CP012167.1|WP_017693710.1|1584519_1585488_-|NADH-oxidoreductase
MTMPTSQCPWRMQVHHIHQETPDVWTLSLLCHDYYPYRAGQYALVSVRNSADTLRAYTISSTPGVSEYITLTVRRIDDGAGSEWLTRDVKRGDYIWLSDAQGEFTCDDKTEDKFLLLAAGCGVTPIMSMRRWLAKYRPQANVQVIFSVRSPEDVIFAEEWRNYPVTLVAEHNATHGFVAGRLSRELLQSVPDIANRIVMTCGPAPYMEIVEKEVKALGVTRFFKEQFFTPVAEAATSGMKFTKLQPAQTFFGRVGTTLLEALESNNVPVAAACRAGVCGCCKTKVVSGEYTVTSTMTLTDAEIAEGYVLACSCHPQGDLVLA
>NZ_CP012167.1|WP_039271216.1|1585498_1587151_-|hydroxylamine-reductase
MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIAALQGLSAWAFKAREYGIVDHYVDSFAPRAFFSTLTNVNFDSPRIVGYAREAIALREALKAQCLNADASARVDNPMAELQLVSDDLGELQRQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNAIYAQYHKIMAWLGTWPSDMNALLECSMEIGQMNFKVMSILDAGETSTYGHPTPTQVNVKATEGKCILISGHDLKDLYNLLKQTEGTGVNVYTHGEMLPAHGYPELRKFKHLIGNYGSGWQNQQVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPDVSHLEGDDFGPVIAQAQQMAGFPYSEIPHLITVGFGRETLLGAADSLIDLVSREKLRHIFLIGGCDSARGERNYFTDFATRVPEDCLILTLACGKYRFNKLDFGNIEGLPRLVDAGQCNDAYSAIILAVTLAEKLGCGVNDLPLSLVLSWFEQKAIVILLTLLSLGVTNIVTGPTAPGFLTPDLLAILNEKFGLRSVTNVEDDMKQLLSA
>NZ_CP012167.1|WP_015570988.1|1587295_1588195_-|lysine-exporter-LysO-family-protein
MFSGLLIILLPLIVGYLIPLRHESALKLINRFLSWIVYVILFFMGISLAFLDNLATNLLSILHYSAVTVVVILLCNIAALFWLERTIPWKNHHHQEKLPSRIAMALESLKLCGVVVLGFLLGLTGWAFLQHATEASEYTLIFLLFLIGIQLRNNGMTLKQIVLNRRGMMVAVIVVASSLAGGVINAFILDLPLKTSLAMASGFGWYSLSGILLTESFGPVIGSAAFFNDLARELIAIMLIPGLVRRSRSTALGLCGATSMDFTLPVLQRSGGLEMVPAAIVHGFILSLLVPILMAFFSA
>NZ_CP012167.1|WP_032103428.1|1588371_1589067_-|aquaporin-Z
MFRKLAAECFGTFWLVFGGCGSAVLAAAFPELGIGFVGVALAFGLTVLTMAFAVGHISGGHFNPAVTLGLWAGGRFPAKDIIGYIIAQVIGGIIAAAVLYVIASGKAGFDAAASGFASNGFGEHSPGGYSMLSAIVIEIVLTAGFLLVIHGATDKYAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWLFWVMPIIGGILGGVLYRTLLEKHD
>NZ_CP012167.1|WP_017693708.1|1589358_1591017_+|ATP-dependent-endonuclease
MLLERVEIVGFRGINRLSLQLEQNNVLIGENAWGKSSLLDALTLLLSPEENLYHFVHDDFWFPPGDVNGREKHLHIILTFRESEPGRHRVRRFRPMSPCWVPCEDGFQRIFYRLEGEMAQNDGVLTLREFLDEKGNPIPLDNIDELARHLIRLSPVLRLRDARFMRRIRNGTVPNMPEVEVTARELDFLARELVSRPQNLTDGQIRQGLSAMVQLLEHYFSEQGTGQARHRLMRRRSHDEQRSWRYLDIINRMIDRPGGRTHRVILLGLFSTLLQAKGTVRLDRDARPLLLVEDPETRLHPIMLSVAWHLLNLLPLQRVTTTNSGELLSLTPVEYVCRLVRESSRVTAYRLGPGGLNAEDGRRIAFHIRFNRASSLFARCWLLVEGETETWVINELARQCGHHFDAEGIKVIEFAQSGLKPLIKFARRMGIEWHVLVDGDEAGKKYAATVRSLLNNDREEEREHLTALPAMDMEHFMYRQGFDDVFHRVAMIPVDVPMNMRRVIAKAIHRSSKPDLAIEVATEAGRRGVESVPTLLRKMFSRVLWLARGRAD
>NZ_CP012167.1|WP_039271214.1|1591013_1591970_-|DUF535-domain-containing-protein
MSSIVDTPYSTLPQPKSGWQLFKSLASGSLTPGLAWQNPAYRRKFMLRSLATPFTTARLLGNLAKQPRLMQILRVQPGLPCRLHRPWLTVNMGRQTTLDALNDHYEMMSRHLPASLLNGYLSSQGIMLVTLTGKEEQQFSVRLNADAFLDKEGEATLTFCDHQNTVLAELTFTLCTYQGKPTLFIGGMQGAKAHVPHEHIQLATKACHGLFPKRLLVEAVMTLAGAFPVEQILAVSNATHIYRSWRYRKKKEGKLLADYDSFWRSLGGQQQDNGNFALPLTMPRKPMEEIASKKRSEYRRRYALLDSLLQQVSQATAR
>NZ_CP012167.1|WP_039271212.1|1592129_1593245_+|macrolide-transporter-subunit-MacA
MNLKGKRRKLFLLLAVVVLAGGFWLWKVLNAPVPQYQTLIVRPGELQQNVLATGKLDALRKVDVGAQVSGQLKTLSVEIGDKVKKGQLLGVIDPEQAQNQIREVEATLMELRAQRAQAQAERNLAQVTLTRQQALAKTQSISKQDLDTAATELAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTQIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPGQKAWFTVLGDPQTRYEGVLKDILPTPEKVNDAIFYYARFEVPNPQGVLRLDMTAQVHIQLTGVKNVLTVPLSALGESAGDNRYKVKVLRNGETREREVVIGARNDTDVVVVKGLEEGEEVVTSETLPGAAQ
>NZ_CP012167.1|WP_039271209.1|1593241_1595182_+|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB
MTALLELNDIRRSYPSGDGPVEVLKGISLRVEAGEMVAIVGASGSGKSTLMNILGCLDKPTSGTYRVAGTDVSTLDGDALAKLRREHFGFIFQRYHLLSHLSAAQNVEVPAVYAGVERKKRLERAKALLTRLGLEERVDYQPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILHQLRDQGHTVIIVTHDPQVAAQAERIIEIHDGELVSNPPPRQSRAAAPKEALPASTGWGQFSSGFREALTMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQLVLADIRAIGTNTIDVYPGKDFGDDEPQYQQALKYDDLAAIQKQPWVNSATPAVSQNLRLRYGNIDVAASANGVSGDYFNVYGMTFSEGATFNAEQLAGRAQVVVLDANSRRQLFPNNTRVVGEVILVGNMPATVIGVAEEKQSMFGSSKILRVWLPYSTISGRIMGQSWLNSITVRVKEGYDSALAEQQLERLLTLRHGKKDFFTWNMDGLLKTAEKTTRTLQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGAMGIALSMMIAFALQLFLPGWEIGFSPMAILTAFLCSTFTGILFGWLPARNAARLDPVDALARE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	JF974302	Vibrio phage VBpm10, * SEQUENCING IN PROGRESS *, 8 unordered pieces	21037-21067	6	0.806
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592513	Vibrio phage 1.142.O._10N.261.49.E11, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592412	Vibrio phage 1.028.O._10N.286.45.B6, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592527	Vibrio phage 1.159.O._10N.261.46.F12, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592588	Vibrio phage 1.217.O._10N.261.45.A1, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592589	Vibrio phage 1.219.O._10N.261.45.E2, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592524	Vibrio phage 1.156.O._10N.261.45.A6, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592669	Vibrio phage 2.159.A._10N.261.46.F12, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592670	Vibrio phage 2.159.B._10N.261.46.F12, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	MG592507	Vibrio phage 1.136.O._10N.261.45.E11, partial genome	26631-26661	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1534665-1534695	7	0.774
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	62534-62564	8	0.742
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	NZ_CP035511	Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence	283146-283176	8	0.742
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	22328-22358	9	0.71
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	475099-475129	9	0.71
NZ_CP012167_1	1.1\|1584023\|31\|NZ_CP012167\|CRISPRCasFinder	1584023-1584053	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	714186-714216	10	0.677

1. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to JF974302 (Vibrio phage VBpm10, *** SEQUENCING IN PROGRESS ***, 8 unordered pieces) position: , mismatch: 6, identity: 0.806

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcattgt	Protospacer
**********.** ********* *..** *

2. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592513 (Vibrio phage 1.142.O._10N.261.49.E11, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

3. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592412 (Vibrio phage 1.028.O._10N.286.45.B6, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

4. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592527 (Vibrio phage 1.159.O._10N.261.46.F12, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

5. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592588 (Vibrio phage 1.217.O._10N.261.45.A1, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

6. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592589 (Vibrio phage 1.219.O._10N.261.45.E2, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

7. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592524 (Vibrio phage 1.156.O._10N.261.45.A6, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

8. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592669 (Vibrio phage 2.159.A._10N.261.46.F12, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

9. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592670 (Vibrio phage 2.159.B._10N.261.46.F12, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

10. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to MG592507 (Vibrio phage 1.136.O._10N.261.45.E11, partial genome) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
acggcgacactgaaacgcgccagagcatagt	Protospacer
**********.** ********* *..*  *

11. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgacaccgacacgcgccag----cgtgtttt	CRISPR spacer
acggcgagaccgtcacgcgccaggtgccggg----	Protospacer
******* **** **********    ** *

12. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
gcggcgacaccgacactcgcccgcgatctca	Protospacer
.*************** **** ***  .*.

13. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to NZ_CP035511 (Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
tcggcgatgccgacacgcgccagcagttcta	Protospacer
 ******..***************.  *.*

14. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
ccggcgacatcgacacgcggcagcccaggat	Protospacer
 ********.********* **** ..   *

15. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
ccggcgacaccgacacccggcagcccaggat	Protospacer
 *************** ** **** ..   *

16. spacer 1.1|1584023|31|NZ_CP012167|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.677

acggcgacaccgacacgcgccagcgtgtttt	CRISPR spacer
ggggcgactccgacccgcgccagcgccgcag	Protospacer
. ****** ***** **********.  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1094956 : 1166954

Burkholderia_virus(39.13%)

tRNA,capsid,tail,integrase,plate,protease,transposase

attL 1092638:1092655|attR 1166210:1166227

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1092638:1092655	attL	NA	NA	NA	NA
WP_039271530.1\|1094956_1095346_-	DNA-binding protein	Q6QIE8	Burkholderia_phage	1.0e-30	54.2
WP_039271528.1\|1095342_1095768_-	regulatory protein GemA	A4JWM5	Burkholderia_virus	4.4e-24	47.7
WP_039271526.1\|1095768_1096005_-	hypothetical protein	NA	NA	NA	NA
WP_071888794.1\|1095994_1096210_-	hypothetical protein	NA	NA	NA	NA
WP_114042598.1\|1096206_1096896_-	DUF2786 domain-containing protein	A0A1W6DYA0	Aeromonas_phage	6.5e-25	35.8
WP_080373376.1\|1096895_1097387_-	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	4.8e-30	65.0
WP_039271522.1\|1097390_1097594_-	hypothetical protein	NA	NA	NA	NA
WP_039271520.1\|1097583_1097796_-	hypothetical protein	NA	NA	NA	NA
WP_006118595.1\|1097874_1098486_-	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	1.2e-75	68.5
WP_023214064.1\|1098503_1098773_-	hypothetical protein	NA	NA	NA	NA
WP_039271516.1\|1098775_1099942_-	AAA family ATPase	A4JWN1	Burkholderia_virus	1.4e-120	60.6
WP_039271514.1\|1099952_1101722_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	3.1e-228	67.8
WP_006687266.1\|1101725_1102634_-	DUF3102 domain-containing protein	A4JWN3	Burkholderia_virus	6.3e-76	55.4
WP_000042842.1\|1102643_1102949_-	helix-turn-helix domain-containing protein	Q5ZR02	Pseudomonas_phage	9.2e-24	58.0
WP_001041677.1\|1102945_1103170_-	hypothetical protein	NA	NA	NA	NA
WP_039271512.1\|1103258_1103669_+	helix-turn-helix transcriptional regulator	A0A2I7S9A5	Vibrio_phage	9.0e-06	39.2
WP_039271510.1\|1103704_1104238_+	hypothetical protein	NA	NA	NA	NA
WP_039271508.1\|1104285_1105056_-	DNA adenine methylase	A2I2Y7	Vibrio_virus	2.0e-99	65.3
WP_039271506.1\|1105304_1105655_+	membrane protein	A4JWP3	Burkholderia_virus	1.5e-22	53.9
WP_039271504.1\|1105657_1106380_+	transglycosylase SLT domain-containing protein	Q5ZQZ1	Pseudomonas_phage	2.2e-63	60.3
WP_039271502.1\|1106369_1107023_+	lipoprotein	J9SVN7	Pseudomonas_phage	6.9e-08	30.2
WP_020803495.1\|1107019_1107352_+	hypothetical protein	Q6QIC4	Burkholderia_phage	1.1e-17	47.7
WP_039271498.1\|1107344_1107656_+	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	9.4e-32	62.6
WP_000124057.1\|1107655_1108201_+	DUF3486 family protein	A4JWJ3	Burkholderia_virus	1.2e-58	67.6
WP_023304065.1\|1108197_1109721_+	hypothetical protein	A4JWJ4	Burkholderia_virus	9.9e-183	62.2
WP_039271496.1\|1109720_1111217_+	DUF935 domain-containing protein	A4JWJ5	Burkholderia_virus	8.2e-174	61.3
WP_032438840.1\|1111197_1112019_+\|capsid	minor capsid protein	Q6QIB9	Burkholderia_phage	9.0e-98	61.9
WP_000135510.1\|1112021_1112480_+	phage virion morphogenesis protein	Q6QIB8	Burkholderia_phage	3.8e-29	43.0
WP_039271494.1\|1112694_1113792_+	hypothetical protein	A4JWJ9	Burkholderia_virus	7.8e-97	50.1
WP_039271492.1\|1113805_1114759_+	hypothetical protein	A4JWK0	Burkholderia_virus	8.9e-65	43.6
WP_039271490.1\|1114769_1115126_+	DUF2190 family protein	NA	NA	NA	NA
WP_039271488.1\|1115127_1115574_+	DUF1320 domain-containing protein	A4JWK2	Burkholderia_virus	7.9e-32	51.7
WP_023304058.1\|1115573_1116038_+	hypothetical protein	Q6QIB2	Burkholderia_phage	5.7e-41	52.3
WP_023229447.1\|1116034_1116289_+	hypothetical protein	NA	NA	NA	NA
WP_039271483.1\|1116278_1117706_+\|tail	tail protein	A4JWK5	Burkholderia_virus	7.5e-217	78.4
WP_001062395.1\|1117705_1118227_+\|tail	phage major tail tube protein	A4JWK6	Burkholderia_virus	1.0e-67	68.8
WP_039271481.1\|1118229_1118523_+	hypothetical protein	A0A1B1PEE7	Pectobacterium_phage	1.5e-10	43.5
WP_032438844.1\|1118512_1118794_+	hypothetical protein	NA	NA	NA	NA
WP_039271477.1\|1118892_1119207_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_001148841.1\|1119172_1119310_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_039271475.1\|1119402_1122081_+\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	1.7e-166	45.3
WP_039271473.1\|1122080_1122965_+\|tail	phage tail protein	A4JWL1	Burkholderia_virus	3.4e-50	47.0
WP_006687305.1\|1122961_1123177_+\|tail	bacteriophage tail fiber protein	Q6QIA3	Burkholderia_phage	1.2e-17	57.1
WP_039271469.1\|1123164_1124334_+	phage late control D family protein	Q6QIA2	Burkholderia_phage	2.7e-87	49.1
WP_039271467.1\|1124333_1124846_+\|plate	phage baseplate assembly protein V	A4JWL4	Burkholderia_virus	7.2e-21	44.0
WP_039271466.1\|1124900_1125248_+\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	2.3e-34	63.3
WP_039271463.1\|1125238_1126342_+\|plate	baseplate J/gp47 family protein	A4JWL6	Burkholderia_virus	1.7e-107	54.3
WP_039271462.1\|1126334_1126913_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	7.5e-67	66.3
WP_053337469.1\|1126915_1128214_+	hypothetical protein	A4JWL8	Burkholderia_virus	7.2e-25	37.8
WP_039271460.1\|1128213_1128612_+\|tail	phage tail fiber protein	A0A0F7LDZ0	Escherichia_phage	6.6e-14	44.7
WP_032636412.1\|1129501_1130083_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	7.6e-67	72.1
WP_080373377.1\|1130052_1130265_-	DUF2496 domain-containing protein	NA	NA	NA	NA
WP_017383213.1\|1130277_1130805_-	primosomal replication protein N''	NA	NA	NA	NA
WP_015571246.1\|1130855_1131233_+	DUF454 family protein	NA	NA	NA	NA
WP_000127359.1\|1131384_1131936_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	45.9
WP_017694393.1\|1132024_1133953_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	7.9e-44	42.9
WP_003858972.1\|1134006_1134339_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_006809843.1\|1134338_1134944_+	recombination protein RecR	NA	NA	NA	NA
WP_015571245.1\|1135054_1136929_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	7.8e-113	36.3
WP_006809841.1\|1137147_1137792_+	adenylate kinase	NA	NA	NA	NA
WP_017383216.1\|1137916_1138879_+	ferrochelatase	NA	NA	NA	NA
WP_032104066.1\|1138941_1140246_+	inosine/guanosine kinase	NA	NA	NA	NA
WP_017383218.1\|1140339_1142016_-	Kef family K(+) transporter	NA	NA	NA	NA
WP_015571242.1\|1142248_1143469_-	MFS transporter	NA	NA	NA	NA
WP_017383219.1\|1143633_1145286_+	bifunctional UDP-sugar hydrolase/5'-nucleotidase	NA	NA	NA	NA
WP_010428207.1\|1145375_1145855_-\|tRNA	Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK	NA	NA	NA	NA
WP_039271455.1\|1146053_1146848_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_039271453.1\|1146898_1149397_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	2.6e-108	37.3
WP_017383222.1\|1149505_1149916_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_039271451.1\|1149912_1150365_-	NfeD family protein	NA	NA	NA	NA
WP_003858941.1\|1150361_1151276_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_015571236.1\|1151430_1152285_-	hypothetical protein	NA	NA	NA	NA
WP_015571235.1\|1152427_1153099_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	2.7e-23	33.3
WP_017383223.1\|1153091_1153874_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_003858935.1\|1153925_1154780_-	co-chaperone YbbN	NA	NA	NA	NA
WP_006809829.1\|1154838_1155648_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_039272174.1\|1155628_1156261_-\|protease	multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1	NA	NA	NA	NA
WP_039272172.1\|1156231_1156918_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-33	36.4
WP_039271448.1\|1156914_1159329_+	ABC transporter permease	NA	NA	NA	NA
WP_017383228.1\|1159511_1160657_+	porin	NA	NA	NA	NA
WP_039271446.1\|1161324_1162395_-\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
WP_003858922.1\|1162479_1163547_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003858921.1\|1163543_1164053_-	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_039271444.1\|1164172_1164895_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_039271442.1\|1164898_1165393_-	peptidylprolyl isomerase B	NA	NA	NA	NA
WP_017383232.1\|1165568_1166954_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-44	34.8
1166210:1166227	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1595741 : 1667117

Enterobacteria_phage(17.24%)

tRNA,protease,integrase,tail

attL 1651869:1651885|attR 1662265:1662281

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006174393.1\|1595741_1596062_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	44.9
WP_006809407.1\|1596089_1598369_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.0
WP_002211347.1\|1598573_1598792_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_023296218.1\|1599076_1599781_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_039271207.1\|1599826_1601548_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	F2Y2R6	Organic_Lake_phycodnavirus	2.7e-19	27.8
WP_039271205.1\|1601547_1603314_-	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	F2Y302	Organic_Lake_phycodnavirus	3.6e-11	27.7
WP_039271203.1\|1603428_1604397_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.4e-60	42.7
WP_000228469.1\|1604940_1605435_+	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_039271201.1\|1605570_1609239_+	hypothetical protein	S5VNE3	Mycobacterium_phage	2.6e-88	49.2
WP_003858270.1\|1609366_1609981_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_023296220.1\|1609990_1611334_+	replication-associated recombination protein RarA	G3MBE0	Bacillus_virus	4.3e-81	40.6
WP_003858266.1\|1611426_1612719_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.7e-93	45.2
WP_039271199.1\|1612930_1615375_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	1.8e-218	49.6
WP_039271197.1\|1615385_1616003_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	3.1e-74	58.6
WP_017693703.1\|1616004_1616868_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003858254.1\|1617142_1618291_+	MFS transporter	NA	NA	NA	NA
WP_017384833.1\|1618413_1618935_+	membrane protein	NA	NA	NA	NA
WP_003858250.1\|1618971_1619712_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.4e-20	26.1
WP_015570975.1\|1619915_1622198_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.1e-161	41.9
WP_017384832.1\|1622249_1623107_-	formate transporter FocA	NA	NA	NA	NA
WP_039271194.1\|1623511_1625272_-	30S ribosomal protein S12 methylthiotransferase accessory factor YcaO	NA	NA	NA	NA
WP_017693700.1\|1625399_1626092_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_039271192.1\|1626254_1627343_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	7.0e-82	46.5
WP_032103946.1\|1627411_1628695_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_015570968.1\|1628880_1629564_+	(d)CMP kinase	NA	NA	NA	NA
WP_003858235.1\|1629675_1631349_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_003858233.1\|1631519_1631807_+	integration host factor subunit beta	A7KV42	Bacillus_phage	5.5e-10	40.2
WP_023303392.1\|1632019_1634284_+	ComEC family protein	NA	NA	NA	NA
WP_003858227.1\|1634320_1636069_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	6.7e-58	30.5
WP_039271189.1\|1636065_1637043_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_039271188.1\|1637086_1638316_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003858220.1\|1638361_1638544_+	protein YcaR	NA	NA	NA	NA
WP_017693695.1\|1638540_1639287_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_003858216.1\|1639429_1640323_+	YcbJ family phosphotransferase	NA	NA	NA	NA
WP_015570963.1\|1640299_1641079_-	envelope biogenesis factor ElyC	NA	NA	NA	NA
WP_039271186.1\|1641199_1641979_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
WP_015570962.1\|1641982_1643305_+	chromosome partition protein MukF	NA	NA	NA	NA
WP_033487281.1\|1643285_1643990_+	chromosome partition protein MukE	NA	NA	NA	NA
WP_017693693.1\|1643989_1648438_+	chromosome partition protein MukB	NA	NA	NA	NA
WP_039271185.1\|1648617_1650441_+	L,D-transpeptidase	NA	NA	NA	NA
WP_077221074.1\|1650607_1651168_+	YcbK family protein	NA	NA	NA	NA
WP_017693691.1\|1651188_1651836_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
1651869:1651885	attL	NA	NA	NA	NA
WP_017384820.1\|1651889_1653080_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_072134628.1\|1653264_1654320_-	porin OmpF	Q1MVN1	Enterobacteria_phage	2.3e-90	50.1
WP_015570955.1\|1654929_1656330_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.9e-79	37.3
WP_015570954.1\|1656498_1657701_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	7.6e-45	31.9
WP_032665345.1\|1657885_1659178_-\|integrase	site-specific integrase	S4TSP2	Salmonella_phage	7.2e-243	95.6
WP_015570952.1\|1659222_1659471_-	excisionase family protein	S4TND0	Salmonella_phage	5.4e-38	91.4
WP_039271183.1\|1659846_1660236_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	2.1e-44	68.0
WP_032665369.1\|1660634_1660982_+	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	5.2e-55	92.2
WP_032665371.1\|1661036_1661507_+\|tail	phage tail protein	A0A220NRQ0	Escherichia_phage	9.7e-81	98.1
WP_032622503.1\|1661561_1661963_+\|tail	phage tail protein	K7P7C2	Enterobacteria_phage	1.3e-65	95.5
WP_032622502.1\|1661986_1662250_+	DUF4035 domain-containing protein	K7P7L5	Enterobacteria_phage	2.7e-40	93.1
WP_050595326.1\|1664371_1665121_+	hypothetical protein	G8C7K5	Escherichia_phage	3.3e-91	68.8
1662265:1662281	attR	NA	NA	NA	NA
WP_039271179.1\|1665117_1665948_-\|tail	tail fiber domain-containing protein	A0A192Y7T9	Enterobacteria_phage	9.3e-34	31.1
WP_032665862.1\|1666030_1666579_+	recombinase family protein	A0A1S6L009	Salmonella_phage	4.5e-77	80.0
WP_032665393.1\|1666694_1667117_+	hypothetical protein	K7P834	Enterobacteria_phage	6.0e-21	44.1

DBSCAN-SWA_3

1923180 : 1959642

Salmonella_phage(25.81%)

tRNA,integrase,lysis,tail

attL 1931404:1931423|attR 1957733:1957752

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857814.1\|1923180_1925109_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.9e-128	37.1
WP_023616141.1\|1925112_1925655_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.8e-15	32.9
WP_001124225.1\|1925752_1925950_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_000124850.1\|1926000_1926357_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_001386830.1\|1926479_1926524_+	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_003857809.1\|1926661_1927645_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	9.9e-35	43.2
WP_032648054.1\|1927660_1930048_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003857805.1\|1930052_1930352_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_039271034.1\|1930455_1931436_+	vitamin B12 ABC transporter permease BtuC	NA	NA	NA	NA
1931404:1931423	attL	NA	NA	NA	NA
WP_032665949.1\|1931502_1932723_-\|integrase	site-specific integrase	A0A0U2JGI6	Escherichia_phage	9.8e-117	51.9
WP_039271032.1\|1932722_1932938_-	DUF1233 family excisionase	A0A0U2RY08	Escherichia_phage	2.2e-19	60.6
WP_039271030.1\|1933002_1933242_-	DUF4060 family protein	M9P0E0	Enterobacteria_phage	2.7e-23	67.9
WP_032666135.1\|1933276_1934389_-	recombinase RecT	H6WRX0	Salmonella_phage	1.7e-160	76.7
WP_039271028.1\|1938043_1938739_+	phage replication protein P	G8C7U6	Escherichia_phage	3.0e-78	59.4
WP_080373385.1\|1938834_1939983_+	DNA cytosine methyltransferase	M1PSQ0	Streptococcus_phage	4.1e-32	29.0
WP_039271026.1\|1939943_1940948_-	hypothetical protein	NA	NA	NA	NA
WP_039271022.1\|1940940_1942359_-	histidine kinase	NA	NA	NA	NA
WP_006811588.1\|1942804_1943038_+	DinI family protein	A0A0M4REN2	Salmonella_phage	5.2e-27	79.2
WP_039271020.1\|1943442_1944042_+	DUF1367 family protein	H6WRY7	Salmonella_phage	1.3e-98	87.3
WP_032645668.1\|1944047_1944248_+	hypothetical protein	H6WRY8	Salmonella_phage	3.7e-21	66.7
WP_039271017.1\|1944250_1944532_+	DUF1364 family protein	K7P7Q1	Enterobacteria_phage	9.3e-47	98.9
WP_039271015.1\|1944528_1944885_+	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	3.1e-63	94.9
WP_039271013.1\|1944881_1945019_+	YlcG family protein	A0A0M5M7B2	Salmonella_phage	2.1e-07	71.1
WP_039271011.1\|1945018_1945834_+	antitermination protein	K7P7B9	Enterobacteria_phage	8.3e-128	84.9
WP_039271009.1\|1945992_1946364_-	hypothetical protein	NA	NA	NA	NA
WP_039271007.1\|1946479_1946704_+\|lysis	lysis protein	M9NZI9	Enterobacteria_phage	2.2e-30	87.8
WP_039271005.1\|1946681_1947176_+	lysozyme	M9P0E5	Enterobacteria_phage	2.1e-89	96.3
WP_039271003.1\|1947172_1947640_+\|lysis	lysis protein	A0A1V0E5Q6	Salmonella_phage	4.2e-52	67.1
WP_039271001.1\|1947674_1948283_+	DUF2441 domain-containing protein	I6PCV9	Cronobacter_phage	9.7e-73	60.4
WP_039270999.1\|1948527_1948884_-	hypothetical protein	NA	NA	NA	NA
WP_114042602.1\|1949618_1950392_+\|tail	phage minor tail protein L	G8C7R1	Escherichia_phage	2.5e-142	93.4
WP_017694300.1\|1951471_1951705_+	hypothetical protein	E4WL42	Enterobacteria_phage	3.0e-30	77.9
WP_072051410.1\|1952291_1953053_+\|tail	phage tail protein	G8C7K5	Escherichia_phage	1.8e-92	67.5
WP_039270992.1\|1952997_1953576_-\|tail	tail fiber domain-containing protein	A0A2I6PD03	Escherichia_phage	6.6e-47	53.6
WP_039272126.1\|1953707_1954265_+	recombinase family protein	A0A1S6L009	Salmonella_phage	3.5e-77	78.7
WP_039270990.1\|1954437_1954857_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.4e-35	56.7
WP_039270988.1\|1954858_1956127_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	8.1e-231	92.4
WP_032666022.1\|1956269_1956677_+	cell envelope integrity/translocation protein TolA	NA	NA	NA	NA
WP_039270984.1\|1956743_1957415_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	5.3e-80	60.0
WP_017384653.1\|1957798_1958350_+	glutathione peroxidase	NA	NA	NA	NA
1957733:1957752	attR	NA	NA	NA	NA
WP_039270982.1\|1958349_1959105_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2K9L407	Tupanvirus	2.2e-10	25.7
WP_017693586.1\|1959177_1959642_+	membrane protein	A0A1V0DZX6	Clostridioides_phage	2.3e-13	36.7

DBSCAN-SWA_4

2898629 : 2907876

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032103476.1\|2898629_2899241_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	1.6e-14	29.3
WP_039270442.1\|2899280_2900261_-	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
WP_039270440.1\|2900452_2901457_+	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	9.5e-33	28.7
WP_023294998.1\|2901505_2902672_-	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	1.6e-111	53.5
WP_023294999.1\|2902925_2904332_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	5.2e-37	28.3
WP_023295000.1\|2904467_2905016_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	9.1e-54	54.4
WP_032682169.1\|2905026_2905917_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	2.8e-28	31.3
WP_023295002.1\|2905929_2906796_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	8.3e-110	66.0
WP_032103484.1\|2906811_2907876_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.4e-104	54.4

DBSCAN-SWA_5

3342171 : 3425921

Escherichia_phage(43.1%)

tRNA,coat,tail,integrase,terminase,holin,protease

attL 3361516:3361530|attR 3430039:3430053

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015572157.1\|3342171_3342897_-\|tRNA	tRNA (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ	NA	NA	NA	NA
WP_003860668.1\|3343029_3343833_+	inositol-1-monophosphatase	NA	NA	NA	NA
WP_039270184.1\|3343894_3344875_-	nickel/cobalt transporter	NA	NA	NA	NA
WP_023304222.1\|3344865_3345504_-	DUF1007 family protein	NA	NA	NA	NA
WP_015572154.1\|3345629_3346907_+	stationary phase inducible protein CsiE	NA	NA	NA	NA
WP_017692912.1\|3346907_3348047_-	3-phenylpropionate MFS transporter	NA	NA	NA	NA
WP_015572152.1\|3348219_3348642_+	DoxX family protein	NA	NA	NA	NA
WP_003860678.1\|3348695_3349949_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.0e-100	53.4
WP_023325074.1\|3350253_3351444_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_003860685.1\|3351524_3351863_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_015572150.1\|3351943_3353281_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	2.0e-09	33.0
WP_039270180.1\|3353277_3354030_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_003860691.1\|3354026_3355460_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	8.8e-16	26.8
WP_039270178.1\|3355992_3359880_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	4.5e-131	59.3
WP_039270175.1\|3360147_3361698_+	membrane-bound lytic murein transglycosylase MltF	NA	NA	NA	NA
3361516:3361530	attL	NA	NA	NA	NA
WP_039270173.1\|3361585_3362092_-\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_017383550.1\|3362149_3362785_-	acid phosphatase AphA	NA	NA	NA	NA
WP_015572146.1\|3362788_3364153_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_015572145.1\|3364162_3365059_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_032649116.1\|3365177_3366026_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003860704.1\|3366082_3366343_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-17	51.2
WP_015572144.1\|3366339_3366720_-	holo-ACP synthase	NA	NA	NA	NA
WP_015572143.1\|3366719_3367451_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_015572142.1\|3367526_3368234_-	DNA repair protein RecO	NA	NA	NA	NA
WP_003860709.1\|3368251_3369157_-	GTPase Era	NA	NA	NA	NA
WP_003860711.1\|3369153_3369834_-	ribonuclease III	A0A2P0VNZ5	Tetraselmis_virus	9.6e-21	39.0
WP_032649119.1\|3370057_3371032_-	signal peptidase I	NA	NA	NA	NA
WP_003860714.1\|3371047_3372853_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.1e-23	25.9
WP_039270169.1\|3373684_3373951_+	DinI family protein	K7PKM2	Enterobacterial_phage	8.9e-39	93.2
WP_080373380.1\|3374082_3375219_-\|tail	tail fiber domain-containing protein	A0A2I6PID3	Escherichia_phage	7.4e-50	36.6
WP_039270167.1\|3375280_3376246_-	hypothetical protein	G1CSU0	Cronobacter_virus	4.3e-59	40.5
WP_039270165.1\|3376250_3380105_-	DUF1983 domain-containing protein	G8C7R4	Escherichia_phage	0.0e+00	76.5
WP_039270163.1\|3380160_3380760_-\|tail	tail assembly protein	G8C7R3	Escherichia_phage	8.3e-101	95.0
WP_032621517.1\|3380747_3381479_-	C40 family peptidase	G8C7R2	Escherichia_phage	2.8e-151	98.4
WP_080373381.1\|3381491_3382265_-\|tail	phage minor tail protein L	G8C7R1	Escherichia_phage	5.1e-143	94.9
WP_039270157.1\|3382261_3382612_-	hypothetical protein	G8C7R0	Escherichia_phage	2.6e-54	92.2
WP_127365414.1\|3382699_3383086_-	hypothetical protein	NA	NA	NA	NA
WP_039270153.1\|3383142_3386298_-\|tail	phage tail tape measure protein	G8C7Q6	Escherichia_phage	0.0e+00	72.1
WP_016247126.1\|3386297_3386585_-	hypothetical protein	I6PD79	Cronobacter_phage	1.2e-17	61.5
WP_039270151.1\|3386602_3386941_-	hypothetical protein	G8C7Q5	Escherichia_phage	5.6e-54	92.9
WP_080373387.1\|3387005_3387689_-	DUF1983 domain-containing protein	S4TNN5	Salmonella_phage	3.4e-34	47.2
WP_039270149.1\|3387961_3388894_-\|tail	major tail protein	G8C7Q3	Escherichia_phage	1.4e-166	99.0
WP_025759418.1\|3388940_3389387_-	hypothetical protein	G8C7Q2	Escherichia_phage	5.1e-71	90.6
WP_039270145.1\|3389376_3389976_-	hypothetical protein	G8C7Q1	Escherichia_phage	1.0e-98	89.9
WP_039270143.1\|3389977_3390331_-	hypothetical protein	G8C7Q0	Escherichia_phage	1.2e-51	89.7
WP_039270141.1\|3390332_3390815_-	hypothetical protein	G8C7P9	Escherichia_phage	5.7e-84	95.6
WP_039270139.1\|3390817_3391051_-	hypothetical protein	G8C7P8	Escherichia_phage	4.0e-19	68.8
WP_039270137.1\|3391090_3392227_-\|coat	coat protein	G8C7P7	Escherichia_phage	4.2e-194	92.1
WP_039270135.1\|3392244_3392997_-	hypothetical protein	G8C7P6	Escherichia_phage	1.4e-116	87.6
WP_039270133.1\|3393104_3393314_-	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	3.7e-16	60.6
WP_039270131.1\|3393317_3394424_-	phage Mu F like family protein	G8C7P5	Escherichia_phage	5.3e-186	89.1
WP_039270129.1\|3394425_3395829_-	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	2.3e-255	95.5
WP_039270127.1\|3395833_3397318_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	9.1e-250	82.9
WP_039025437.1\|3397317_3397833_-	hypothetical protein	A0A0H5AUE2	Pseudomonas_phage	5.2e-51	62.2
WP_039270119.1\|3397998_3398217_-	hypothetical protein	NA	NA	NA	NA
WP_023330226.1\|3398434_3398899_+\|protease	retroviral-like aspartic protease	NA	NA	NA	NA
WP_023303625.1\|3398881_3399043_-	hypothetical protein	NA	NA	NA	NA
WP_039270116.1\|3399484_3400036_+\|protease	Clp protease	NA	NA	NA	NA
WP_045621094.1\|3400249_3400531_-	hypothetical protein	G8C7W1	Escherichia_phage	7.2e-23	65.6
WP_039270113.1\|3400532_3401162_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	1.9e-111	95.2
WP_023306758.1\|3401161_3401440_-\|holin	phage holin family protein	G8C7V9	Escherichia_phage	9.6e-36	87.4
WP_023306759.1\|3401429_3401819_-	phage membrane protein	G8C7V8	Escherichia_phage	2.3e-59	94.5
WP_151548461.1\|3402093_3402477_-	hypothetical protein	NA	NA	NA	NA
WP_039270106.1\|3403044_3403860_-	antitermination protein	K7P7B9	Enterobacteria_phage	7.0e-127	84.1
WP_039270104.1\|3403859_3403997_-	YlcG family protein	A0A0M5M7B2	Salmonella_phage	5.4e-08	76.3
WP_039270102.1\|3403993_3404350_-	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	3.4e-62	94.9
WP_017692886.1\|3404346_3404628_-	hypothetical protein	K7P7Q1	Enterobacteria_phage	1.6e-46	98.9
WP_039270100.1\|3404630_3404831_-	hypothetical protein	H6WRY8	Salmonella_phage	2.8e-21	66.7
WP_017693509.1\|3404836_3405436_-	DUF1367 family protein	A0A0M4QX23	Salmonella_phage	2.7e-99	87.8
WP_006811588.1\|3405840_3406074_-	DinI family protein	A0A0M4REN2	Salmonella_phage	5.2e-27	79.2
WP_039270096.1\|3406217_3408197_-	DNA methyltransferase	H9C171	Pectobacterium_phage	2.9e-203	53.2
WP_039270094.1\|3408193_3408451_-	hypothetical protein	NA	NA	NA	NA
WP_053337477.1\|3409093_3409561_-	hypothetical protein	A0A076G839	Escherichia_phage	1.9e-07	43.2
WP_039270092.1\|3409557_3409818_-	DUF977 family protein	H6WRX9	Salmonella_phage	1.5e-27	71.1
WP_039270089.1\|3409821_3410508_-	hypothetical protein	NA	NA	NA	NA
WP_039270087.1\|3410519_3411212_-	phage replication protein P	G8C7U6	Escherichia_phage	3.5e-79	60.0
WP_039270085.1\|3411195_3412188_-	replication protein	A5VW95	Enterobacteria_phage	1.4e-49	75.0
WP_032665960.1\|3412361_3412610_-	hypothetical protein	NA	NA	NA	NA
WP_039270083.1\|3412625_3413168_-	hypothetical protein	M9NZI6	Enterobacteria_phage	1.9e-48	55.6
WP_017693529.1\|3413521_3413935_+	helix-turn-helix domain-containing protein	A0A1B5FPF4	Escherichia_phage	8.2e-07	42.4
WP_039270078.1\|3414334_3414550_-	hypothetical protein	NA	NA	NA	NA
WP_039270076.1\|3414670_3414877_+	hypothetical protein	NA	NA	NA	NA
WP_039270074.1\|3414876_3415074_+	DUF1482 family protein	NA	NA	NA	NA
WP_154816539.1\|3415078_3415243_+	hypothetical protein	K7PGY4	Enterobacteria_phage	1.5e-20	84.9
WP_039270070.1\|3415383_3418359_+	hypothetical protein	K7P6V4	Enterobacteria_phage	0.0e+00	65.2
WP_039272080.1\|3418370_3419483_+	recombinase RecT	H6WRX0	Salmonella_phage	1.8e-162	77.8
WP_039270068.1\|3419517_3420222_+	hypothetical protein	M1F3E2	Salmonella_phage	6.0e-42	44.8
WP_017692869.1\|3420208_3420451_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	7.8e-34	93.6
WP_039270066.1\|3420497_3420782_+	excisionase Xis	H6WRW8	Salmonella_phage	1.8e-34	75.0
WP_039270064.1\|3420860_3421328_-	hypothetical protein	NA	NA	NA	NA
WP_039270062.1\|3421576_3422806_-\|integrase	site-specific integrase	H6WRW7	Salmonella_phage	3.5e-239	98.5
WP_006811609.1\|3423237_3423714_-	SoxR-reducing system protein RseC	NA	NA	NA	NA
WP_023304255.1\|3423710_3424664_-	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
WP_015572138.1\|3424663_3425314_-	anti-sigma-E factor RseA	NA	NA	NA	NA
WP_006176728.1\|3425345_3425921_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	8.2e-05	28.1
3430039:3430053	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3986815 : 3993045

Escherichia_phage(33.33%)

plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015571912.1\|3986815_3988660_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
WP_017384024.1\|3988762_3989269_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
WP_108376613.1\|3989678_3990038_-\|plate	baseplate J-like protein	A0A0F7LCQ9	Escherichia_phage	4.3e-44	78.0
WP_039269723.1\|3990043_3990394_-\|plate	baseplate assembly protein	A0A0M4RE59	Salmonella_phage	4.4e-38	70.7
WP_039269721.1\|3991095_3991866_-	hypothetical protein	NA	NA	NA	NA
WP_039269719.1\|3992014_3992464_-	phage virion morphogenesis protein	O80313	Escherichia_phage	1.4e-47	66.0
WP_039269717.1\|3992456_3992924_-\|tail	phage tail protein	A0A218M4K6	Erwinia_phage	8.0e-59	68.4
WP_017382984.1\|3992886_3993045_-	hypothetical protein	A0A218M4L1	Erwinia_phage	1.5e-14	75.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012169

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012169_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012169_1

39984-40118

Orphan

Consensus_repeat	Method
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012169_1

>merge|NZ_CP012169|1|39984-40118|CRISPRCasFinder
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCACCTCCTACTTGCGTGTCAGAACTCATCCTTCAACCCCGTCTGGAATATCGATTCCACACGCCGGATTTAACTGGGACCATGGTCCCAC

>NZ_CP012169|1|1|39984-40118|CRISPRCasFinder
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCAC	CTCCTACTTGCGTGTCAGAACTCATCCTTCAACCCCGTC
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCATGGTCCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012169.1\|WP_032662169.1\|32134_32545_-\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350229
NZ_CP012169.1\|WP_000842134.1\|43776_44886_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP012169.1\|WP_001039466.1\|42497_43682_+\|tetracycline-efflux-MFS-transporter-Tet(D)	unknown	unknown	gnl\|CDD\|340946
NZ_CP012169.1\|WP_023327689.1\|37513_38680_+\|plasmid-partitioning-protein-SopA	unknown	unknown	gnl\|CDD\|184261
NZ_CP012169.1\|WP_004201280.1\|47319_47793_+\|trimethoprim-resistant-dihydrofolate-reductase-DfrA14	unknown	unknown	gnl\|CDD\|238127
NZ_CP012169.1\|WP_013087127.1\|33734_34265_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012169.1\|WP_001389365.1\|48422_49187_+\|IS6-like-element-IS6100-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP012169.1\|WP_032662167.1\|32541_32772_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
NZ_CP012169.1\|WP_072199628.1\|40294_40975_-\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|179607
NZ_CP012169.1\|WP_001067855.1\|41042_41747_-\|IS6-like-element-IS26-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP012169.1\|WP_015572055.1\|35762_36773_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP012169.1\|WP_001067855.1\|45375_46080_-\|IS6-like-element-IS26-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP012169.1\|WP_013087126.1\|33313_33604_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012169.1\|WP_032662174.1\|29491_30514_-\|helicase-UvrD	unknown	unknown	gnl\|CDD\|350690
NZ_CP012169.1\|WP_032662171.1\|30498_32061_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|173776
NZ_CP012169.1\|WP_015572054.1\|34283_35060_+\|phage-integrase-family-protein	unknown	unknown	gnl\|CDD\|334163
NZ_CP012169.1\|WP_023352616.1\|41793_42402_-\|tetracycline-resistance-transcriptional-repressor-TetR(D)	unknown	unknown	gnl\|CDD\|172294
NZ_CP012169.1\|WP_013087134.1\|38679_39645_+\|ParB/RepB/Spo0J-family-plasmid-partition-protein	unknown	unknown	gnl\|CDD\|184254
NZ_CP012169.1\|WP_001144737.1\|48013_48280_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	gnl\|CDD\|368576
NZ_CP012169.1\|WP_000845048.1\|46150_47164_-\|class-1-integron-integrase-IntI1	unknown	unknown	gnl\|CDD\|185315

Protein	Function_ID	Function_description	E-value
NZ_CP012169.1\|WP_032662169.1\|32134_32545_-\|PIN-domain-containing-protein	gnl\|CDD\|350229	cd09881, PIN_VapC4-5_FitB-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC4 and VapC5, and Neisseria gonorrhoeae FitB and related proteins. This family includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This family belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	4.70668e-41
NZ_CP012169.1\|WP_000842134.1\|43776_44886_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP012169.1\|WP_001039466.1\|42497_43682_+\|tetracycline-efflux-MFS-transporter-Tet(D)	gnl\|CDD\|340946	cd17388, MFS_TetA, Tetracycline resistance protein TetA and related proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of tetracycline resistance proteins similar to Escherichia coli TetA(A), TetA(B), and TetA(E), which are metal-tetracycline/H(+) antiporters that confer resistance to tetracycline by an active tetracycline efflux, which is an energy-dependent process that decreases the accumulation of the antibiotic in cells. TetA-like tetracycline resistance proteins belongs to the Eukaryotic Solute carrier 46 (SLC46)/Bacterial Tetracycline resistance (TetA) -like (SLC46/TetA-like) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.08286e-146
NZ_CP012169.1\|WP_023327689.1\|37513_38680_+\|plasmid-partitioning-protein-SopA	gnl\|CDD\|184261	PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional.	0
NZ_CP012169.1\|WP_004201280.1\|47319_47793_+\|trimethoprim-resistant-dihydrofolate-reductase-DfrA14	gnl\|CDD\|238127	cd00209, DHFR, Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate which is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication, inhibitors of DHFR (such as Methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis.	1.49291e-53
NZ_CP012169.1\|WP_032662167.1\|32541_32772_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	1.20731e-10
NZ_CP012169.1\|WP_001389365.1\|48422_49187_+\|IS6-like-element-IS6100-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.97603e-67
NZ_CP012169.1\|WP_015572054.1\|34283_35060_+\|phage-integrase-family-protein	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	9.41107e-39
NZ_CP012169.1\|WP_072199628.1\|40294_40975_-\|DUF4113-domain-containing-protein	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	4.99848e-165
NZ_CP012169.1\|WP_001067855.1\|41042_41747_-\|IS6-like-element-IS26-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
NZ_CP012169.1\|WP_015572055.1\|35762_36773_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	0.000207968
NZ_CP012169.1\|WP_001067855.1\|45375_46080_-\|IS6-like-element-IS26-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
NZ_CP012169.1\|WP_001144737.1\|48013_48280_+\|plasmid-mobilization-relaxosome-protein-MobC	gnl\|CDD\|368576	pfam05713, MobC, Bacterial mobilisation protein (MobC). This family consists of several bacterial MobC-like, mobilisation proteins. MobC proteins belong to the group of relaxases. Together with MobA and MobB they bind to a single cis-active site of a mobilising plasmid, the origin of transfer (oriT) region. The absence of MobC has several different effects on oriT DNA. Site- and strand-specific nicking by MobA protein is severely reduced, accounting for the lower frequency of mobilisation. The localized DNA strand separation required for this nicking is less affected, but becomes more sensitive to the level of active DNA gyrase in the cell. In addition, strand separation is not efficiently extended through the region containing the nick site. These effects suggest a model in which MobC acts as a molecular wedge for the relaxosome-induced melting of oriT DNA. The effect of MobC on strand separation may be partially complemented by the helical distortion induced by supercoiling. However, MobC extends the melted region through the nick site, thus providing the single-stranded substrate required for cleavage by MobA.	3.4368e-05
NZ_CP012169.1\|WP_032662174.1\|29491_30514_-\|helicase-UvrD	gnl\|CDD\|350690	cd17932, DEXQc_UvrD, DEXQD-box helicase domain of UvrD. UvrD is a highly conserved helicase involved in mismatch repair, nucleotide excision repair, and recombinational repair. It plays a critical role in maintaining genomic stability and facilitating DNA lesion repair in many prokaryotic species including Helicobacter pylori and Escherichia coli. UvrD is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.74563e-07
NZ_CP012169.1\|WP_032662171.1\|30498_32061_-\|AAA-family-ATPase	gnl\|CDD\|173776	cd01026, TOPRIM_OLD, TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family. The bacteriophage P2 OLD protein, which has DNase as well as RNase activity, consists of an N-terminal ABC-type ATPase domain and a C-terminal Toprim domain; the nuclease activity of OLD is stimulated by ATP, though the ATPase activity is not DNA-dependent. Functional details on OLD are scant and further experimentation is required to define the relationship between the ATPase and Toprim nuclease domains. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). The conserved glutamate may act as a general acid in strand cleavage by nucleases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.	3.83508e-20
NZ_CP012169.1\|WP_023352616.1\|41793_42402_-\|tetracycline-resistance-transcriptional-repressor-TetR(D)	gnl\|CDD\|172294	PRK13756, PRK13756, TetR family transcriptional regulator.	5.40352e-132
NZ_CP012169.1\|WP_013087134.1\|38679_39645_+\|ParB/RepB/Spo0J-family-plasmid-partition-protein	gnl\|CDD\|184254	PRK13698, PRK13698, ParB/RepB/Spo0J family plasmid partition protein.	0
NZ_CP012169.1\|WP_000845048.1\|46150_47164_-\|class-1-integron-integrase-IntI1	gnl\|CDD\|185315	PRK15417, PRK15417, integron integrase.	0

>NZ_CP012169.1|WP_013087134.1|38679_39645_+|ParB/RepB/Spo0J-family-plasmid-partition-protein
MKRAPVIPKHTVKDIRPETEPSAAPAAPMVDSLIARVGAMARGNTILLPVCGREVKFILEAIPGESVETASRVWSGNERDQELLTEDALDDLIPSFMLSGQQTPAFGRRVEGVIEIADGSRRRKAAILTSSDYRVLVGDLDDEQMMALSRLGNDYRPVSAYERGNRYAQRLENDFNGNISALAEAENISRKIITRCINTAHLPKSVVALFTHPGELSARSGETLYKAFSGKEALLLQRTQQLHEQKKAGVIFESEEVIGLLTDVLKEPSGKKVNLNTRHQFVPGATALYKGDKVIFNLDKSRLPAECIEKIESILRDLQKV
>NZ_CP012169.1|WP_023327689.1|37513_38680_+|plasmid-partitioning-protein-SopA
MGLMETLDQCITAGHEMTKAIAIAQFNDDSPEARKITRRWRVGEAADLIGVSSQAIRDAEKAGRLPHPDMEMRGRVEQRVGYTIEQINHMRDVFGTRLRRPDDSVPPVIAVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAEDTLLPFYLGERDDAAYAVKATCWPGLDIIPSCLALHRIETELMGRFDNGKLPTEPHMMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDLLKNVDLQGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR
>NZ_CP012169.1|WP_015572055.1|35762_36773_-|replication-initiation-protein
MAMENNELPLNLQEVNKTTGEVVKLDVNSASTVQPVALMRLGLFVPTLKSTSRSKTNRKNVTDATEELVQLSIARSEGYTDVRITGSRLDMDTDFKVWLGIIRSMYDFGVKDDTLKLSFVEFVKMCGFDSRRSNKKMRDRISNSLFKLASVTLKFQSETKGWTTHLVQSAYYDITADVVEIRAEPKLFELYQMDRRVLLRLKAIDALQRKESAQALYTYIESLPQNPAPISMKRMRDRLNLTSNLYTQNHTVRKAMAQLKDIGYLDYTEFKRGRATYFSVHYRNPKLISSKVVVPREPEEEVPEQNYDEVIKALKAAGIDPQKLAKALASVKPGND
>NZ_CP012169.1|WP_015572054.1|34283_35060_+|phage-integrase-family-protein
MMPALPGHSGAFSSAQLPVAIDYPAALALRQMALVQDELPKYLLAPEVSALLHYVPDLHRKMLLTTLWNTGARINEALALTRSDFSLAPPYPFVQLATLKQRVEKAARTAGRAPAGSQPHRNVPLSDPQYARQLEMMVATLKIPLERRNKRTGRTEKVRIWEITDRTVRTWLGEAVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFSMAEADAVAMLKKR
>NZ_CP012169.1|WP_013087127.1|33734_34265_+|hypothetical-protein
MCKLTGFIMGLTILLGVTARDAGAATLSEMRMVNASQKPGMVIICSRTSEIPQKGESPVRIESLLRGVVLQNDGDRMMFDVTYTQRNAEESIPFRTEKYRLTTELEATRQKMAIDPETIELSLPRARGLEETFLAGMKASPVSFEDYTNYRVKSATEYLILPGPASPDAPVMHCTL
>NZ_CP012169.1|WP_013087126.1|33313_33604_+|hypothetical-protein
MNMKITLSVLFEALIILGHDRVWMEESEFEHIYGYGCYREIHTWDDRTVAWWDDADDTWYLSTEVDVITPFLGPLPKKEGELSEEKCFQLMTLGRY
>NZ_CP012169.1|WP_032662167.1|32541_32772_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMAERGDVVSDEGRVNL
>NZ_CP012169.1|WP_032662169.1|32134_32545_-|PIN-domain-containing-protein
MNKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITWAEVSLASQEAGPAAQKLADAFAARLDAILPWDRTAVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
>NZ_CP012169.1|WP_032662171.1|30498_32061_-|AAA-family-ATPase
MPLITRLMLQNFKKFPELDLRFTHDRNILVGDNESGKSTILLALDLVLSDSRHRVEALGVESLLSQSAVRHFQEGERRAELLPVLTADVFLSNGGDPDLNGRQNLAGIDADGLRMRIAPMTEEYGQDIHNVLQQDPDNFPYEYYSVRFSTFSGGHFAGFRRYLRHLLLDSARIDNEHAAQEYTRTVYSVNVPVADRYRLENSYRQQKMLFCTRHLSAINDTLETYQFGVRSGAKSGLEANLDITEDGISIRHRGKGRQCFIKTEFALQRHQQQGELHALLLEEPENHLSHVSMKRLVNQLATERQTQVFIATHSSHISSRLDLRKAILLGSTRPVLMNELSAETAAFFMKAPDNNVLEFALARRALLVEGDAEFILIEAFYRRLYGRAPEDDGVHIIAIGGTSFRRYLELARLLENRVAALRDNDGNYQQNCDERYADVLCSRTRAFADRDNTRSTFEICLYQDNAALCDALFRGTRRTLTVQEYMLANKAEAAFRLLQLHAEELTVPDYIQEALAWIRE
>NZ_CP012169.1|WP_032662174.1|29491_30514_-|helicase-UvrD
MDKRVIFAVAGSGKTTLLIRRLSEDRRTLILTFTVNNEAHLRAQIIRRFGFIPDGIRVMTWFEFLHGFCFRPFLQERLASRGLSFDRPPPGIPRTNARHYQDPAGRLYHRRLAHLLTARGLLPDIRTRLARYYDELLVDEVQDFAGHDFDFLLELCRAEITVLCCGDFYQHTFDTSRDGNVNSALHDDITRYEARFAAAGFMVDRNTLNRTWRCSTSVCEFITGQLNIRIAAHGIHATLIETITDAERTAALHADNTVIKLFYREHHRYGCYSMNWGVSKGLDHFQDVCIVMGPAHWKLLTRQELAALPPSSRNRLYVACSRARGNIYFVPETHLRRFRN
>NZ_CP012169.1|WP_072199628.1|40294_40975_-|DUF4113-domain-containing-protein
MGIRTALDLALTNPAFIRKNFSVVLERTVRELNGESCMSLEEAPPTKQQIVCSRSFGEKITEYDSLRQAVCQYAERASEKLRKERQYCRHISVFIKTSPFAVKEPYYGNVATEKLLTPTQDTRDIIAAATTALERIWKDGHLYAKAGVMLNDFTGSGVSQLQLFDERPPRPHSSELMKVLDGINHSGLGQIWFAGRGIAPSWQMKRDMLSPAYTTRWKDIPVARIR
>NZ_CP012169.1|WP_001067855.1|41042_41747_-|IS6-like-element-IS26-family-transposase
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>NZ_CP012169.1|WP_023352616.1|41793_42402_-|tetracycline-resistance-transcriptional-repressor-TetR(D)
MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAAPDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFGHCCK
>NZ_CP012169.1|WP_001039466.1|42497_43682_+|tetracycline-efflux-MFS-transporter-Tet(D)
MNKPAVIALVITLLDAMGIGLIMPVLPSLLREYLPEADVANHYGILLALYAVMQVCFAPLLGRWSDKLGRRPVLLLSLAGAAFDYTLLALSNVLWMLYLGRIISGITGATGAVAASVVADSTAVSERTAWFGRLGAAFGAGLIAGPAIGGLAGDISPHLPFVIAAILNACTFLMVFFIFKPAVQTEEKPAEQKQESAGISFITLLKPLALLLFVFFTAQLIGQIPATVWVLFTESRFAWDSAAVGFSLAGLGAMHALFQAVVAGALAKRLSEKTIIFAGFIADATAFLLMSAITSGWMVYPVLILLAGGGIALPALQGIISAGASAANQGKLQGVLVSLTNLTGVAGPLLFAFIFSQTQQSADGTVWLIGTALYGLLLAICLLIRKPAPVAATC
>NZ_CP012169.1|WP_000842134.1|43776_44886_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFGPGLPLEIVEIDVAPPKKGEVLVKISHTGVCHTDAYTLSGDDPEGLFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECDFCTSGKTNLCVAVRETQGKGVMPDGTSRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPQANAEQVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGGIGLAVVQGARQAKAGRIFAIDTNPSKFELAKQFGATDCINPNDYDKPVQQVLVEMTKWGVDHTFECIGNVNVMRSALESAHRGWGQSVIIGVAGAGKEISTRPFQLVTGRVWKGTAFGGVKGRTQLPGMVEDAMSGKIELAPFVTHTMELDKINEAFDLMHDGKSIRTVIHY
>NZ_CP012169.1|WP_001067855.1|45375_46080_-|IS6-like-element-IS26-family-transposase
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>NZ_CP012169.1|WP_000845048.1|46150_47164_-|class-1-integron-integrase-IntI1
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER
>NZ_CP012169.1|WP_004201280.1|47319_47793_+|trimethoprim-resistant-dihydrofolate-reductase-DfrA14
MKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLSTIDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
>NZ_CP012169.1|WP_001144737.1|48013_48280_+|plasmid-mobilization-relaxosome-protein-MobC
MPVLTDEEVNTVRESCRQLGAIGRNLNQVARALNIEFRESDKLKQEAIEKLAERIDQHLDHVSELFDKTWSRWHDCHFQKTTAPVDWA
>NZ_CP012169.1|WP_001389365.1|48422_49187_+|IS6-like-element-IS6100-family-transposase
MTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEMLAERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREGKLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQARPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP012428	Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence	20127-20165	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NC_014107	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence	48095-48133	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	40032-40070	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	40032-40070	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP042541	Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence	40032-40070	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP031723	Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence	50311-50349	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP042567	Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence	40032-40070	0	1.0
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	100226-100264	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1315-1353	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1402-1440	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP031569	Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence	7815-7853	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP050011	Citrobacter sp. Y3 plasmid unnamed2, complete sequence	27572-27610	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP019840	Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence	70340-70378	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP022149	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence	50338-50376	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP009855	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence	14593-14631	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP008907	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence	83191-83229	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	65584-65622	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_LT991956	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2	52487-52525	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP029719	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence	1341-1379	1	0.974
NZ_CP012169_1	1.1\|40032\|39\|NZ_CP012169\|CRISPRCasFinder	40032-40070	39	NZ_CP039454	Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence	72766-72804	3	0.923

1. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP012428 (Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

2. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NC_014107 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

3. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP046273 (Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

4. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP012169 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

5. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP042541 (Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

6. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP031723 (Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

7. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP042567 (Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

8. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

9. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

10. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

11. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP031569 (Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

12. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP050011 (Citrobacter sp. Y3 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

13. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP019840 (Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

14. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP022149 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

15. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP009855 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

16. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP008907 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

17. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

18. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_LT991956 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

19. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP029719 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

20. spacer 1.1|40032|39|NZ_CP012169|CRISPRCasFinder matches to NZ_CP039454 (Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence) position: , mismatch: 3, identity: 0.923

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtttcagaactcatccgtcaaccccgcc	Protospacer
************* ************* *********.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

34283 : 57016

Escherichia_phage(28.57%)

transposase,integrase

attL 45324:45383|attR 54108:54928

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015572054.1\|34283_35060_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.0e-52	91.2
WP_015572055.1\|35762_36773_-	replication initiation protein	J9Q7H0	Salmonella_phage	6.3e-85	55.2
WP_023327689.1\|37513_38680_+	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	5.5e-218	94.3
WP_013087134.1\|38679_39645_+	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	9.8e-136	76.9
WP_072199628.1\|40294_40975_-	DUF4113 domain-containing protein	F1C5A5	Cronobacter_phage	1.6e-79	62.8
WP_001067855.1\|41042_41747_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_023352616.1\|41793_42402_-	tetracycline resistance transcriptional repressor TetR(D)	NA	NA	NA	NA
WP_001039466.1\|42497_43682_+	tetracycline efflux MFS transporter Tet(D)	NA	NA	NA	NA
WP_000842134.1\|43776_44886_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.8e-33	30.2
45324:45383	attL	NA	NA	NA	NA
WP_001067855.1\|45375_46080_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000845048.1\|46150_47164_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_004201280.1\|47319_47793_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
WP_001144737.1\|48013_48280_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_001389365.1\|48422_49187_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_004098817.1\|49447_50662_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_001288432.1\|50695_52129_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
WP_001749967.1\|52510_52717_-	hypothetical protein	NA	NA	NA	NA
WP_000893479.1\|52721_53231_-	restriction endonuclease	NA	NA	NA	NA
WP_001067855.1\|53410_54115_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000427619.1\|56011_57016_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
54108:54928	attR	NA	NA	NA	NA

DBSCAN-SWA_2

60189 : 113876

uncultured_Caudovirales_phage(40.91%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001120891.1\|60189_60729_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000027057.1\|60938_61799_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001235713.1\|61981_62539_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_001143760.1\|62702_65708_+\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	100.0
WP_004118529.1\|65872_66700_-	universal stress protein	NA	NA	NA	NA
WP_001549885.1\|66718_68197_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.6e-198	74.0
WP_001549886.1\|68679_69033_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	5.9e-22	57.1
WP_001549887.1\|69128_70412_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	2.9e-175	74.6
WP_001549888.1\|70461_70890_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	70.7
WP_004118521.1\|70947_71670_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.5e-96	73.0
WP_001067855.1\|71878_72583_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_013087136.1\|73229_73661_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.0e-28	53.3
WP_077681920.1\|73892_74864_+	StbA family protein	A0A222YXF2	Escherichia_phage	8.2e-74	47.4
WP_013087138.1\|74866_75529_+	Mediator of plasmid stability	NA	NA	NA	NA
WP_013087139.1\|75532_75796_+	hypothetical protein	NA	NA	NA	NA
WP_013087140.1\|75824_76028_+	hypothetical protein	NA	NA	NA	NA
WP_013087142.1\|76402_76870_+	hypothetical protein	NA	NA	NA	NA
WP_013087143.1\|77392_78085_+	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	7.5e-29	36.7
WP_013087144.1\|78081_78303_+	hypothetical protein	NA	NA	NA	NA
WP_013087145.1\|78358_78781_+	DUF1380 family protein	NA	NA	NA	NA
WP_013087148.1\|79137_79566_+	antirestriction protein	NA	NA	NA	NA
WP_013087149.1\|79608_80019_+	DUF1380 family protein	NA	NA	NA	NA
WP_071888820.1\|80069_80267_+	hypothetical protein	NA	NA	NA	NA
WP_013087154.1\|81001_81274_+	hypothetical protein	NA	NA	NA	NA
WP_013087155.1\|81317_81683_+	hypothetical protein	NA	NA	NA	NA
WP_013087156.1\|81750_83763_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_032669078.1\|83800_84235_+	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
WP_013087158.1\|84231_84963_+	plasmid SOS inhibition protein A	NA	NA	NA	NA
WP_013087159.1\|84959_85190_+	hypothetical protein	NA	NA	NA	NA
WP_032669168.1\|85231_85411_+	hypothetical protein	NA	NA	NA	NA
WP_087654045.1\|85632_87001_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.2e-78	69.7
WP_012540252.1\|87219_87570_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	5.3e-23	50.9
WP_012540111.1\|87617_87980_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_032669083.1\|87997_89749_+	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_012540054.1\|89796_91086_+	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	4.6e-173	74.5
WP_013087165.1\|91098_91524_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.5e-51	71.4
WP_032669087.1\|91892_93431_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.4e-277	93.6
WP_000612626.1\|93479_93827_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.6e-62	100.0
WP_000839182.1\|93823_94228_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	1.6e-68	97.8
WP_013087167.1\|94681_96439_-	arsenical pump-driving ATPase	NA	NA	NA	NA
WP_013087168.1\|96459_96822_-	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_013087169.1\|96897_97443_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_013087170.1\|97451_98165_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.1e-95	72.3
WP_013087171.1\|98166_98490_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_012540086.1\|98790_99057_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_013087172.1\|99044_99530_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000589001.1\|99948_101289_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_032072095.1\|101544_101967_-	nickel resistance OB fold protein NcrY	NA	NA	NA	NA
WP_004196366.1\|102128_103259_-	Ni(II)/Co(II) efflux transporter permease subunit NcrC	NA	NA	NA	NA
WP_004196355.1\|103271_103541_-	nickel-sensing transcriptional repressor NcrB	NA	NA	NA	NA
WP_004196314.1\|103646_104945_-	MFS transporter	NA	NA	NA	NA
WP_004196325.1\|105178_105937_-	hypothetical protein	NA	NA	NA	NA
WP_004196315.1\|105990_106911_-	hypothetical protein	NA	NA	NA	NA
WP_004196359.1\|106973_107345_-	hypothetical protein	NA	NA	NA	NA
WP_008460269.1\|107745_108669_+	chromate resistance protein	NA	NA	NA	NA
WP_008460270.1\|108622_110002_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	1.6e-27	64.6
WP_013087175.1\|110032_110722_-	hypothetical protein	NA	NA	NA	NA
WP_008460272.1\|110735_111473_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_009651956.1\|111516_111882_-	hypothetical protein	NA	NA	NA	NA
WP_000627495.1\|112853_113876_+\|transposase	IS21-like element ISSen3 family transposase	A0A2L1IVA1	Escherichia_phage	1.9e-174	85.3

DBSCAN-SWA_3

159705 : 199348

Escherichia_phage(23.08%)

transposase,protease,integrase

attL 168419:168435|attR 202484:202500

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013087234.1\|159705_160683_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	1.7e-47	39.7
WP_013087235.1\|160915_162067_+	hypothetical protein	NA	NA	NA	NA
WP_000627495.1\|163326_164349_+\|transposase	IS21-like element ISSen3 family transposase	A0A2L1IVA1	Escherichia_phage	1.9e-174	85.3
WP_001531258.1\|164345_165128_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	6.1e-136	96.5
WP_032662300.1\|166070_167570_-	kinase	NA	NA	NA	NA
WP_013087238.1\|167595_169233_-	protein phosphatase 2C domain-containing protein	NA	NA	NA	NA
168419:168435	attL	NA	NA	NA	NA
WP_013087239.1\|169232_170273_-	VWA domain-containing protein	NA	NA	NA	NA
WP_013087240.1\|170358_170997_-	VWA domain-containing protein	NA	NA	NA	NA
WP_000116681.1\|170996_171638_-	TerD family protein	NA	NA	NA	NA
WP_001388628.1\|171660_172299_-	VWA domain-containing protein	NA	NA	NA	NA
WP_001176767.1\|172762_173230_-	tellurium resistance protein TerW	NA	NA	NA	NA
WP_000506888.1\|173247_174456_-	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_000797363.1\|174466_175423_-	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_001182415.1\|175422_176502_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	7.3e-39	34.4
WP_001040062.1\|176503_177277_-	hypothetical protein	NA	NA	NA	NA
WP_001282603.1\|177269_178412_-	hypothetical protein	A0A172Q0Y1	Acinetobacter_phage	1.5e-29	34.5
WP_001035171.1\|178421_179480_-	hypothetical protein	NA	NA	NA	NA
WP_000254136.1\|179801_180383_+	tellurium resistance protein TerZ	K4JRX3	Caulobacter_phage	6.3e-13	30.0
WP_001054787.1\|180382_181540_+	tellurium resistance protein TerA	NA	NA	NA	NA
WP_000007448.1\|181562_182018_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_000255079.1\|182040_183081_+	tellurium resistance membrane protein TerC	K7QKE8	Escherichia_phage	2.2e-77	48.0
WP_000116677.1\|183129_183708_+	tellurium resistance membrane protein TerD	A0A2P1N0L4	Streptomyces_phage	3.3e-06	40.0
WP_000301242.1\|183775_184351_+	TerD family protein	K4JRX3	Caulobacter_phage	8.7e-31	41.6
WP_001053338.1\|184779_186021_+	tellurium resistance protein TerF	NA	NA	NA	NA
WP_000077926.1\|186583_186865_-	hypothetical protein	NA	NA	NA	NA
WP_000398480.1\|186914_187106_-	hypothetical protein	NA	NA	NA	NA
WP_001371937.1\|187197_187569_-	hypothetical protein	NA	NA	NA	NA
WP_072199635.1\|187663_188632_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.1e-182	98.1
WP_000341066.1\|188977_189370_+	hypothetical protein	NA	NA	NA	NA
WP_000427623.1\|190058_191063_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_000429838.1\|191162_191597_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001294667.1\|191668_192019_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000735441.1\|192034_192310_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_000654684.1\|192312_192558_+	mercury resistance system transport protein MerF	NA	NA	NA	NA
WP_000136268.1\|192554_194201_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.0e-39	28.3
WP_003465059.1\|194217_194583_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_001087809.1\|194579_194816_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_000904941.1\|194868_195483_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	6.6e-37	50.3
WP_013087245.1\|195543_196761_-	TniQ family protein	NA	NA	NA	NA
WP_003465065.1\|196757_197666_-	AAA family ATPase	NA	NA	NA	NA
WP_003465068.1\|197668_199348_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	2.6e-06	25.4
202484:202500	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP012168

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

132880 : 201578

Escherichia_phage(20.83%)

transposase,integrase

attL 141455:141514|attR 193609:195203

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039272368.1\|132880_133885_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	1.3e-42	35.5
WP_039272366.1\|134248_134500_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024134513.1\|134509_135817_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_039272364.1\|135813_136308_+	hypothetical protein	NA	NA	NA	NA
WP_051479470.1\|136482_137412_-	hypothetical protein	NA	NA	NA	NA
WP_001166628.1\|137420_137876_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001294656.1\|137947_138313_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000732275.1\|138328_138604_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_000522996.1\|138631_139057_+	organomercurial transporter MerC	NA	NA	NA	NA
WP_000209296.1\|139095_140781_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
WP_001277466.1\|140798_141164_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_001087807.1\|141160_141397_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
141455:141514	attL	NA	NA	NA	NA
WP_001067855.1\|141518_142223_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
141455:141514	attL	NA	NA	NA	NA
WP_001162012.1\|142472_143030_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
WP_039272359.1\|143335_144349_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
WP_001206316.1\|144494_145286_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000131886.1\|145452_146352_+	aminoglycoside N-acetyltransferase AAC(3)-VIa	NA	NA	NA	NA
WP_000535481.1\|146558_146879_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	1.0e-17	47.9
WP_000719078.1\|146934_148572_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.8e-174	60.6
WP_001137772.1\|148760_150290_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001137513.1\|150557_151793_+\|transposase	IS256-like element ISEc58 family transposase	A0A218MNI5	uncultured_virus	2.8e-42	42.8
WP_000679427.1\|152010_152358_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|152351_153191_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_004883563.1\|153318_153591_+	hypothetical protein	NA	NA	NA	NA
WP_000427623.1\|153772_154777_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_000184001.1\|155004_156210_+	chromate efflux transporter	NA	NA	NA	NA
WP_000130000.1\|156220_156526_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001389365.1\|156752_157517_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001137892.1\|158009_158594_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000004159.1\|158593_159832_-	MFS transporter	NA	NA	NA	NA
WP_000219391.1\|159828_160734_-	Mph(A) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001067855.1\|160855_161560_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000046891.1\|161859_162195_-	thermonuclease family protein	G8DH70	Emiliania_huxleyi_virus	2.8e-05	35.7
WP_001515734.1\|162437_163001_+\|transposase	transposase	NA	NA	NA	NA
161565:162385	attR	NA	NA	NA	NA
WP_001348195.1\|163065_163440_+	cupin domain-containing protein	NA	NA	NA	NA
161565:162385	attR	NA	NA	NA	NA
WP_001097412.1\|163463_164027_+	hypothetical protein	NA	NA	NA	NA
WP_000948429.1\|165046_166246_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000957857.1\|166255_166444_-	hypothetical protein	NA	NA	NA	NA
WP_000018330.1\|166800_167616_+	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	4.3e-161	98.9
WP_000027057.1\|168098_168959_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001217881.1\|169141_169699_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.0e-93	98.4
WP_004152397.1\|173106_174426_+\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_015062847.1\|174675_175557_-	carbapenem-hydrolyzing class A beta-lactamase KPC-4	A0A1B0VBP7	Salmonella_phage	1.1e-74	52.5
WP_004152394.1\|175943_176723_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_001141270.1\|177581_177857_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_000842086.1\|177887_178997_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	3.7e-30	28.1
WP_000235177.1\|179038_179437_+	VOC family protein	NA	NA	NA	NA
WP_009652884.1\|179502_180339_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_000470624.1\|180366_181002_-	recombinase family protein	NA	NA	NA	NA
WP_000124025.1\|181169_184157_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.4e-294	53.6
WP_004152392.1\|184757_187787_-\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004152391.1\|187896_189612_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_022650072.1\|190611_191244_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.0e-77	67.2
WP_000376623.1\|191750_192251_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000259031.1\|192378_193218_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000679427.1\|193211_193559_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_001749986.1\|193781_194234_-	NAD(+)--rifampin ADP-ribosyltransferase Arr-3	NA	NA	NA	NA
WP_000186237.1\|194318_194951_-	type B-3 chloramphenicol O-acetyltransferase CatB3	A0A2R8FE91	Brazilian_cedratvirus	4.1e-26	41.2
WP_001334766.1\|195088_195919_-	oxacillin-hydrolyzing class D beta-lactamase OXA-1	NA	NA	NA	NA
WP_063840321.1\|196049_196604_-	fluoroquinolone-acetylating aminoglycoside 6'-N-acetyltransferase AAC(6')-Ib-cr5	NA	NA	NA	NA
WP_039272634.1\|197955_198549_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.2e-40	49.7
WP_039272567.1\|198545_201578_+\|transposase	Tn3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP010383

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

58056 : 65078

Escherichia_phage(33.33%)

integrase

attL 53570:53583|attR 74353:74366

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
53570:53583	attL	NA	NA	NA	NA
WP_022650030.1\|58056_58749_-	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	5.7e-29	36.7
WP_022650031.1\|59145_59613_-	hypothetical protein	NA	NA	NA	NA
WP_080332517.1\|59590_59848_-	DUF1472 domain-containing protein	NA	NA	NA	NA
WP_022650032.1\|59978_60407_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.3e-28	51.6
WP_022650033.1\|60406_61678_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	2.9e-156	63.7
WP_022650034.1\|61681_62071_-	hypothetical protein	NA	NA	NA	NA
WP_022650035.1\|62075_63047_-	hypothetical protein	A0A222YXF2	Escherichia_phage	2.2e-66	42.9
WP_022650036.1\|63283_63922_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	5.8e-44	44.9
WP_022650037.1\|63921_64200_+	hypothetical protein	NA	NA	NA	NA
WP_022650038.1\|64298_65078_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	3.5e-51	89.3
74353:74366	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP010382

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010382_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010382_1

22368-22465

Orphan

Consensus_repeat	Method
AGATAAATCCCCCCCCCTAAACCGAGATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010382_1

>merge|NZ_CP010382|1|22368-22465|CRISPRCasFinder
AGATAAATCCCCCCCCCTAAACCGAGATATATTACCCCCCCCTAGCAAGATAAATTGCCCCCCTAACCGAGATAAATCCCCCCCCCTAAACCAAGATA

>NZ_CP010382|1|1|22368-22465|CRISPRCasFinder
AGATAAATCCCCCCCCCTAAACCGAGATA	TATTACCCCCCCCTAGCAAGATAAATTGCCCCCCTAACCG
AGATAAATCCCCCCCCCTAAACCAAGATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010382.1\|WP_015060075.1\|16965_17262_-\|conjugal-transfer-protein-TraM	unknown	unknown	gnl\|CDD\|368210
NZ_CP010382.1\|WP_020323151.1\|24566_24896_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374591
NZ_CP010382.1\|WP_032449362.1\|20175_20784_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP010382.1\|WP_020323144.1\|21421_22303_+\|plasmid-encoded-RepA-protein	unknown	unknown	gnl\|CDD\|309782
NZ_CP010382.1\|WP_001642212.1\|26543_26966_+\|ArdB-protein	unknown	unknown	gnl\|CDD\|377006
NZ_CP010382.1\|WP_032416643.1\|19400_19709_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_020323160.1\|25575_26364_-\|SprT-like-family-protein	unknown	unknown	gnl\|CDD\|370932
NZ_CP010382.1\|WP_032449363.1\|27824_28205_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_032416642.1\|18711_19062_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227596
NZ_CP010382.1\|WP_020323175.1\|27082_27274_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_020323168.1\|20949_21282_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_000957857.1\|22825_23014_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_032416645.1\|19172_19397_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_032449361.1\|18390_18708_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP010382.1\|WP_020323149.1\|25012_25546_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236362
NZ_CP010382.1\|WP_032449364.1\|28253_28538_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_000948429.1\|23023_24223_+\|IS91-family-transposase	unknown	unknown	gnl\|CDD\|377437
NZ_CP010382.1\|WP_020323174.1\|27277_27841_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010382.1\|WP_032416587.1\|17508_18291_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381613
NZ_CP010382.1\|WP_006118530.1\|19993_20179_+\|ribbon-helix-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|289422

Protein	Function_ID	Function_description	E-value
NZ_CP010382.1\|WP_015060075.1\|16965_17262_-\|conjugal-transfer-protein-TraM	gnl\|CDD\|368210	pfam04956, TrbC, TrbC/VIRB2 family. Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure. This family also contains several VIRB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species.	0.00593557
NZ_CP010382.1\|WP_020323151.1\|24566_24896_+\|hypothetical-protein	gnl\|CDD\|374591	pfam16509, KORA, TrfB plasmid transcriptional repressor. KORA is a family of Gram-negative bacterial proteins that act as global repressors of genes involved in plasmid replication, conjugative transfer and stable inheritance in the IncP group of plasmids. KORA operates as a symmetric dimer, and contacts the DNA via the helix-turn-helix region at the N-terminus.	2.69416e-20
NZ_CP010382.1\|WP_032449362.1\|20175_20784_-\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	4.55012e-61
NZ_CP010382.1\|WP_020323144.1\|21421_22303_+\|plasmid-encoded-RepA-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	1.86101e-26
NZ_CP010382.1\|WP_001642212.1\|26543_26966_+\|ArdB-protein	gnl\|CDD\|377006	pfam03230, Antirestrict, Antirestriction protein. This family includes various protein that are involved in antirestriction. The ArdB protein efficiently inhibits restriction by members of the three known families of type I systems of E. coli.	2.16047e-18
NZ_CP010382.1\|WP_020323160.1\|25575_26364_-\|SprT-like-family-protein	gnl\|CDD\|370932	pfam10263, SprT-like, SprT-like family. This family represents a domain found in eukaryotes and prokaryotes. The domain contains a characteristic motif of the zinc metallopeptidases. This family includes the bacterial SprT protein.	5.57072e-11
NZ_CP010382.1\|WP_032416642.1\|18711_19062_+\|hypothetical-protein	gnl\|CDD\|227596	COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only].	0.00565211
NZ_CP010382.1\|WP_032449361.1\|18390_18708_+\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	3.19518e-11
NZ_CP010382.1\|WP_000948429.1\|23023_24223_+\|IS91-family-transposase	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	5.78906e-70
NZ_CP010382.1\|WP_020323149.1\|25012_25546_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	1.58918e-85
NZ_CP010382.1\|WP_032416587.1\|17508_18291_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381613	cd16892, LT_VirB1-like, VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	5.40103e-69
NZ_CP010382.1\|WP_006118530.1\|19993_20179_+\|ribbon-helix-helix-domain-containing-protein	gnl\|CDD\|289422	pfam12651, RHH_3, Ribbon-helix-helix domain. This short bacterial protein contains a ribbon-helix-helix domain that is likely to be DNA-binding.	2.78035e-11

>NZ_CP010382.1|WP_020323144.1|21421_22303_+|plasmid-encoded-RepA-protein
MAEDRKQLTKRQQKAIDTAALIRQEPPQGDDMAFTHSILCQVGLPRSKVEGREFMRRSGDAWLVVQAGWLDEGNGPVEQPLPYGAMPRLTFAWISSYALRNKTREIAIGHSASEFLRLMGMELQGARHRTLRIQMQALAACRLQLGFKGRTYNGQPVEQFDAWLKDGDTKQLTLWPGTLTLSEGYYNGLIESAVPLDNRALHVLKGSALALDIYAWLAHRLHRIEGRPVMLYWMKLREQFAQEYSGKNADKDFKRAFMPALKQVLSVYPAAKVDQVKGGLLLYSSPPPIPYKS
>NZ_CP010382.1|WP_020323168.1|20949_21282_-|hypothetical-protein
MTERQQNRNICVVGKVKDGMTIDTSKIKIEDVSERVISIDDSFNTEDATLSLRTVMRNVATRIYLPSVLKGACPAFEAWADKRSVGEKLPRGKYFKSREFIRQFKIQNYV
>NZ_CP010382.1|WP_032449362.1|20175_20784_-|recombinase-family-protein
MYIFGYLRASAHDQDASRAQQRLKAFALEHNHRVAGWYVENASGASLQRPELMRLLNDAEKGDLILIEQVDRLSRLDDEGWQQLKRMMQEKNLAIISLDLPTSYAALMPHGSDEFTRSMLTAINSMMLDMLAAIARKDYTDRRRRQQEGVRKAKEKGVYRGRMPDQNKHDLIRSLRHQGKSISETARLAGVSERTVTRVSKS
>NZ_CP010382.1|WP_006118530.1|19993_20179_+|ribbon-helix-helix-domain-containing-protein
MAEPYLKNRRRFTSSLDNQLVPLFDALAAKTRIPKSRLLDEAIEDLLVKHGVPGKQVDSQN
>NZ_CP010382.1|WP_032416643.1|19400_19709_+|hypothetical-protein
MKKLIPAIIAAALLSGCATQNDAVALSNRISDQQKQINALSVRLQSAEHRLSQQESAFRSEQTQNSSYCYLNGVKYSQGSVFAGRICDGSSGSAAWRLYSHR
>NZ_CP010382.1|WP_032416645.1|19172_19397_+|hypothetical-protein
MAGKLQGNEATSGPDCVMGRQSFFEIRIYTPYYNPGATAAARKVFLSSCPMTTISENKNTLELIIQRYGRSFQE
>NZ_CP010382.1|WP_032416642.1|18711_19062_+|hypothetical-protein
MGNVIEFKRPKGERNQKDKMPKRGILLWFKKTALSLKNNLFTYSKSCCCICLFFVSAASRKLLKLIATLSIVLFLVEWFMGRLGAPEFYNLLFLMGLLLVINVISTSCIKWIRGNV
>NZ_CP010382.1|WP_032449361.1|18390_18708_+|H-NS-histone-family-protein
MLVPLQSEKRPKGTPVYRDPENPFNTWSGYGKRPVWLQERLSDGYLLDEMKLPGAVVDRDTKSPRYRDPANPDNTWTGVGRRPKWLVELLENGVDLDDLKIRERE
>NZ_CP010382.1|WP_032416587.1|17508_18291_-|lytic-transglycosylase-domain-containing-protein
MKKTWCLIAVCISGLSFQGVAHAASASDTIASLAARCAPDVSPLTMAYIVGHESGNNPYFINVNRGASLKRQPQTEAEAVEVANRLIKNLKKDESIDMGLAMINSNNLSSLGITVEQVFKPCINLRASQTILKDCYSTALKSNPPGQIALRHALSCYNTGSQVRGISNGYVTKVINVAKQSDLKIPTLLPDGQNEEAESQPVSAKGATFEGEHDAFTGESDSGGDVFSQDNTDAFLTKAEQKGSEVMNDKNLSPVAVSNN
>NZ_CP010382.1|WP_015060075.1|16965_17262_-|conjugal-transfer-protein-TraM
MVTFFKNNGFALLVALLCIAAPELALAAGGADTGASTGNNIKSWLDTWIPIACTIGVIVSFLVWLFHLISAGFMFRLAIAMVGIGSASYLVSLTGIGS
>NZ_CP010382.1|WP_000957857.1|22825_23014_+|hypothetical-protein
MLTRKSIDTVLLSVGAEKLSQREWDWMKMLKPMDPPPAMVTTSILKRRGDTAALTLLQDTGV
>NZ_CP010382.1|WP_000948429.1|23023_24223_+|IS91-family-transposase
MLSGFTPRPLKRLFTANQCWTSFLDAGGLRDIEVEAVTKMLACGTRILGVKEFGCDNPDCQHVKYLTNSCGSRACPSCGKKATDLWTATQLNRLPDCDWVHLVFTLPDTLWPVFESNRWLLNDVCRLAVENLLYAARKRGLEPGIFCAIHTYGRRLNWHPHVHVSVTCGGLNKHGQWKKLSFLKDAMRSRWMWNMRQLLLKAWSEGMAMPESLSHITTESQWRSLVLKSGGKYWHVYMSKKTAGGRNTARYLGRYLKKPPIAASRLAHYNGGASLSFRYLDHKTGETATETLTQRELVARLKQHIPEKFFKMVRYFGFLANRVCGEKLPQVYRALGMDKPEPVAKVCYAQMVKQFLSRDPFECVLCGCRMVYRRAIAGLNVSGLKKNARDISLLRYMPA
>NZ_CP010382.1|WP_020323151.1|24566_24896_+|hypothetical-protein
MARKQTRSMTQEEWDRLLPAMQTFTHLSTEIGHSVLVKGESNKDVAERVGRTKQNVGSTVKRIWDLYQSVAVDFEGEKLRKVDVWLPEKMALKVLKEAEKYAINQNKTE
>NZ_CP010382.1|WP_020323149.1|25012_25546_+|single-stranded-DNA-binding-protein
MASRGVNKVILVGNLGQDPEMRYMPNGGAVANLRLATSESWRDKATGEQKEVTEWHTVVIFGKLAEIAGEYLRKGSQVYIEGQLRTRKWQDKDQQDRYSTEVVVSMNGVMQMLGGRQGGGAPAGQGGQQQFSGGGAPAAAPGTQGQQPQQGAMPDFEDDIPFAPVTLPFPNHAIHAL
>NZ_CP010382.1|WP_020323160.1|25575_26364_-|SprT-like-family-protein
MTLPTPETYEELQHAYDFFDERLFNNELPPCLITLQREKRTYGYCSFQRFVGRESGQMVDEIAMNPVFFSIRTIKATLSSLVHEMVHQWQYHFGKAGRRGYHNKEWSAMMERIGLMPSDTGQPGGRKVGQSMAHYIITGGAFDRACDELLTRNFQLSWMDRFPPFQPKPGAPQSPSGKGYIDDENDDREYPPDDDYTDEPGELDNEIIEAMKFVSPPPETPVNKSNRAKYTCPVCHVNLWGKPGLVVFCGGEHCEKAELQPS
>NZ_CP010382.1|WP_001642212.1|26543_26966_+|ArdB-protein
MANTVTAKIYGPAQKMRFLPYAFAEFYLQAENYVCSFMKKYAVGYDGGCWEYITYENGACAFIAPDGYQLTLPNYFDEPVSAKEAGIIVALYAYSHFCCVAFERGWQRVNETMAERYHTLRDFTETLPPESQSRIFRAID
>NZ_CP010382.1|WP_020323175.1|27082_27274_+|hypothetical-protein
MASVRFWPDIQETIFPPLQVPEGKRRVVRCRCGINDWNEDGRWLGEYCCASCGQYIQVFEKKD
>NZ_CP010382.1|WP_020323174.1|27277_27841_+|hypothetical-protein
MAFDFKKEDAAKYGREVYRAFRSKGNHRWDTCVFVNESGAYSAVFRHSFRKKVIEDGKEIRRNVIDDEIVVAAPDAGSFTRAKFPQLADAKELKQSGFFARLRFVAEASAYREAWPGHDGGVVLIWEGKAYGWKNCLRDAHHERPGAIAIDTNGHVFIAEGGNEYDGAKCWVAMTGDITEGDNGDKS
>NZ_CP010382.1|WP_032449363.1|27824_28205_+|hypothetical-protein
MVIKVNGVALLAILFISATAMAGIKSPIKVVSLIDFRGDNQELMVRDTESQCDYHVAVTKSEKNIEWLGVTLPQSRWEFVVDRRKCGDIIERVNMQIVPDTKIKTLPIEAGSVYYIYPDWDAFSQK
>NZ_CP010382.1|WP_032449364.1|28253_28538_+|hypothetical-protein
MEQPTDMFSMYLKFIPVILAVIFWIYCLSSKYSLSRMETMRQLKRWYDLPRASATENKEETLNNMIAAEQKRAALSFRTAIVFTAIAIFWLVYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP026279	Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence	23224-23263	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_KT148595	Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence	976-1015	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	169583-169622	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP029112	Escherichia coli strain AR436 plasmid unnamed3, complete sequence	16875-16914	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP026232	Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence	7925-7964	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP010382	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence	22397-22436	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP027617	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence	51791-51830	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP026184	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence	14118-14157	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP011646	Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence	74625-74664	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP027125	Escherichia coli strain AR_0374 plasmid unnamed3	38535-38574	0	1.0
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP026205	Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence	22855-22894	1	0.975
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP019907	Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence	8399-8438	4	0.9
NZ_CP010382_1	1.1\|22397\|40\|NZ_CP010382\|CRISPRCasFinder	22397-22436	40	NZ_CP017587	Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ06, complete sequence	38093-38132	4	0.9

1. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP026279 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

2. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_KT148595 (Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

3. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

4. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP029112 (Escherichia coli strain AR436 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

5. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP026232 (Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

6. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP010382 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

7. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP027617 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

8. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP026184 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

9. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP011646 (Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

10. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP027125 (Escherichia coli strain AR_0374 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

11. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP026205 (Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence) position: , mismatch: 1, identity: 0.975

-tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
atatta-ccccccctagcaagataaattgcccccctaaccg	Protospacer
 ***** **********************************

12. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP019907 (Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.9

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
aaattaccccccctagcaagataaattgcccccctaaccg	Protospacer
 * *  **********************************

13. spacer 1.1|22397|40|NZ_CP010382|CRISPRCasFinder matches to NZ_CP017587 (Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ06, complete sequence) position: , mismatch: 4, identity: 0.9

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
aaattaccccccctagcaagataaattgcccccctaaccg	Protospacer
 * *  **********************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage