CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP010370	Acinetobacter nosocomialis strain 6411 plasmid p6411-9.012kb, complete sequence	0 crisprs	NA	0
NZ_CP010369	Acinetobacter nosocomialis strain 6411 plasmid p6411-89.111kb, complete sequence	0 crisprs	WYL	1
NZ_CP010368	Acinetobacter nosocomialis strain 6411 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,csa3	3
NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	0 crisprs	csa3	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

63731 : 70050

Acinetobacter_phage(44.44%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000395699.1\|63731_64202_+	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	8.3e-56	66.4
WP_162097055.1\|64274_64421_+	hypothetical protein	NA	NA	NA	NA
WP_000152660.1\|64613_64850_+	hypothetical protein	NA	NA	NA	NA
WP_001136766.1\|65511_65967_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	4.7e-80	95.4
WP_000378528.1\|66027_66489_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.0e-55	73.8
WP_040118383.1\|66457_66649_+	hypothetical protein	NA	NA	NA	NA
WP_001258993.1\|66685_66973_-	helix-turn-helix domain-containing protein	A0A088CD40	Shigella_phage	3.3e-15	48.4
WP_000288004.1\|66959_67289_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.9e-23	64.6
WP_000453245.1\|67343_67613_-	transcriptional regulator	NA	NA	NA	NA
WP_000096286.1\|67819_68422_+	hypothetical protein	A0A0P0J0J1	Acinetobacter_phage	3.2e-36	62.2
WP_000994925.1\|68478_68697_+	hypothetical protein	A0A0R6PIC9	Moraxella_phage	4.0e-21	77.4
WP_025464206.1\|68789_68987_+	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	7.5e-11	57.1
WP_000743263.1\|69117_70050_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.9e-57	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010368_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010368_1

444506-444630

Unclear

Consensus_repeat	Method
GGTGGTGAAGATCGTCCGCGTCGTGAGTTCAACTCTGA	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NZ_CP010368_1

>merge|NZ_CP010368|1|444506-444630|CRISPRCasFinder
GGTGGTGAAGATCGTCCGCGTCGTGAGTTCAACTCTGACCGTCCACGTCGTGAAGGTGGTTTTGAAGATCGTCCAAAACGTAGCTTTGGTGGTGAAGATCGTCCACGTCGTGAGTTCAACTCTGA

>NZ_CP010368|1|1|444506-444630|CRISPRCasFinder
GGTGGTGAAGATCGTCCGCGTCGTGAGTTCAACTCTGA	CCGTCCACGTCGTGAAGGTGGTTTTGAAGATCGTCCAAAACGTAGCTTT
GGTGGTGAAGATCGTCCACGTCGTGAGTTCAACTCTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010368.1\|WP_016803860.1\|431661_432309_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010368.1\|WP_039246252.1\|450396_450798_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240046
NZ_CP010368.1\|WP_002049699.1\|448629_449643_-\|magnesium-transporter	unknown	unknown	gnl\|CDD\|213369
NZ_CP010368.1\|WP_002049738.1\|446904_447588_+\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	unknown	unknown	gnl\|CDD\|275223
NZ_CP010368.1\|WP_039246232.1\|429985_431086_+\|HPP-family-protein	unknown	unknown	gnl\|CDD\|225979
NZ_CP010368.1\|WP_004711782.1\|445313_446132_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213228
NZ_CP010368.1\|WP_022575959.1\|451428_453474_-\|ATP-dependent-DNA-helicase-RecG	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236794
NZ_CP010368.1\|WP_039249311.1\|450800_451436_-\|ComF-family-protein	unknown	unknown	gnl\|CDD\|223970
NZ_CP010368.1\|WP_002049753.1\|447614_448256_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|377516
NZ_CP010368.1\|WP_032011495.1\|439801_441706_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP010368.1\|WP_001121170.1\|438895_439498_-\|GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|234745
NZ_CP010368.1\|WP_004884612.1\|432380_434204_-\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|185635
NZ_CP010368.1\|WP_001091949.1\|446128_446905_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	unknown	unknown	gnl\|CDD\|223838
NZ_CP010368.1\|WP_039246241.1\|437817_438768_-\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|235413
NZ_CP010368.1\|WP_039246238.1\|436851_437640_-\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|234703
NZ_CP010368.1\|WP_002052345.1\|431155_431410_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP010368.1\|WP_039246236.1\|434461_436804_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010368.1\|WP_000250997.1\|448267_448555_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP010368.1\|WP_002049746.1\|449800_450382_+\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|129813
NZ_CP010368.1\|WP_002052337.1\|441827_442658_+\|inositol-monophosphatase	unknown	unknown	gnl\|CDD\|238817

Protein	Function_ID	Function_description	E-value
NZ_CP010368.1\|WP_002049738.1\|446904_447588_+\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	gnl\|CDD\|275223	TIGR04430, OM_asym_MlaD, outer membrane lipid asymmetry maintenance protein MlaD. Members of this protein family are the MlaD (maintenance of Lipid Asymmetry D) protein of an ABC transport system that seems to remove phospholipid from the outer leaflet of the Gram-negative bacterial outer membrane (OM), leaving only lipopolysaccharide in the outer leaflet. The Mla locus has long been associated with toluene tolerance, consistent with the proposed role in retrograde transport of phospholipid and therefore with maintaining the integrity of the OM as a protective barrier.	8.82466e-50
NZ_CP010368.1\|WP_039246252.1\|450396_450798_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240046	cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.4815e-38
NZ_CP010368.1\|WP_002049699.1\|448629_449643_-\|magnesium-transporter	gnl\|CDD\|213369	cd12835, EcCorA-like_1, Escherichia coli Mg2+ transporter CorA_like subgroup. A bacterial subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subgroup includes the Mg2+ transporters Escherichia coli CorA and Salmonella typhimurium CorA (which can also transport Co2+, and Ni2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.35178e-133
NZ_CP010368.1\|WP_039246232.1\|429985_431086_+\|HPP-family-protein	gnl\|CDD\|225979	COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms].	1.33301e-98
NZ_CP010368.1\|WP_004711782.1\|445313_446132_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213228	cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	2.30842e-138
NZ_CP010368.1\|WP_022575959.1\|451428_453474_-\|ATP-dependent-DNA-helicase-RecG	gnl\|CDD\|236794	PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional.	0
NZ_CP010368.1\|WP_039249311.1\|450800_451436_-\|ComF-family-protein	gnl\|CDD\|223970	COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only].	4.87713e-33
NZ_CP010368.1\|WP_002049753.1\|447614_448256_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|377516	pfam05494, MlaC, MlaC protein. MlaC is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. This family of proteins is involved in toluene tolerance, which is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation. Many proteins are involved in these processes.	1.7834e-40
NZ_CP010368.1\|WP_032011495.1\|439801_441706_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP010368.1\|WP_001121170.1\|438895_439498_-\|GTP-cyclohydrolase-II	gnl\|CDD\|234745	PRK00393, ribA, GTP cyclohydrolase II RibA.	1.62622e-123
NZ_CP010368.1\|WP_004884612.1\|432380_434204_-\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	gnl\|CDD\|185635	PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional.	0
NZ_CP010368.1\|WP_001091949.1\|446128_446905_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	6.58224e-82
NZ_CP010368.1\|WP_039246241.1\|437817_438768_-\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|235413	PRK05330, PRK05330, oxygen-dependent coproporphyrinogen oxidase.	0
NZ_CP010368.1\|WP_039246238.1\|436851_437640_-\|shikimate-dehydrogenase	gnl\|CDD\|234703	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed.	4.2531e-115
NZ_CP010368.1\|WP_002052345.1\|431155_431410_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	6.1384e-21
NZ_CP010368.1\|WP_000250997.1\|448267_448555_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	9.2231e-07
NZ_CP010368.1\|WP_002049746.1\|449800_450382_+\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|129813	TIGR00730, LOG_family_protein_YJL055W, TIGR00730 family protein. This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions. [Hypothetical proteins, Conserved].	5.13136e-62
NZ_CP010368.1\|WP_002052337.1\|441827_442658_+\|inositol-monophosphatase	gnl\|CDD\|238817	cd01639, IMPase, IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be recycled into inositol lipids; in eukaryotes IMPase plays a vital role in intracellular signaling. IMPase is one of the proposed targets of Li+ therapy in manic-depressive illness. This family contains some bacterial members of the inositol monophosphatase family classified as SuhB-like. E. coli SuhB has been suggested to participate in posstranscriptional control of gene expression, and its inositol monophosphatase activity doesn't appear to be sufficient for its cellular function. It has been proposed, that SuhB plays a role in the biosynthesis of phosphatidylinositol in mycobacteria.	5.12795e-113

>NZ_CP010368.1|WP_002052337.1|441827_442658_+|inositol-monophosphatase
MEPMVVMAARAAQTVGQELLKAHQNRHKLDLQVEEKGIDGPVTRVDRYLEQLTIDTLRKSYKNHSFLGEEFGLQEGKGHDADWCWVIDPLDGTQNFINGFPHFCISIAVQHKGVTQHGVIYDPVRDELFSASRGRGAVMNQRRIRVNVKDSLENTFLAVGHPYRAKRAGEIVSYAEQHFASLLAVTQAGAQIRRGGSAALDLAYVAAGRFDGFFELGLKPWDIAAGELIIKEAGGVVVDARGGNDSLENGQVLACSLKMLKPLMQTVVPAWDKAAK
>NZ_CP010368.1|WP_032011495.1|439801_441706_+|1-deoxy-D-xylulose-5-phosphate-synthase
MLYTEIPTQRPVTPLLDAIDHPQQLRQLEHSQLVQVADELRQYILYAAGQSGGHFGANLGVVELTVALHYCFNTPNDRLVWDVGHQAYPHKILTGRREQITTIRSKNGLAAFPAREESVFDTFGVGHSSTAISAGLGMSLARRYQNDPCEVVCIVGDGAMTAGMAFEAMNDAVAHDADLIVVLNDNDMSISCSTGGFAKHLAAIWEKGHLVNVNEHGEAYIQPHPKWTYNSRLHQSATDAADNLFKAIGFDYFGPFDGHDVNQLVQVFNALKKRKGPRLVHVYTKKGKGFAPAEADPITYHAIGKINATSGGKAPPKYSDVFGEWLCDEAAQDERLLAITPAMCEGSGMVKFAKQFPQRFFDVAIAEQHAVTLAAGMACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFGIDRAGLVGEDGPTHAGAYDYAYMRTVPNMVIMAPKDENECRQMLHTAYAYNGPAAVRYPRGAGVGVEIQKEMTVLELGKAEIVAEIKPNSDEQITVLAFGSRVMVAIEAAEQLAQKHDVGVRVVNMRFVKPLDEQMIRDLAEHTHLFVTVEEHAIMGGAGSAVNEFMAQEQIVKPIINLGLPDSFLHQASHNQMLQDCGLDAKGILNSIERAWLKQNQVV
>NZ_CP010368.1|WP_001121170.1|438895_439498_-|GTP-cyclohydrolase-II
MPIEFIATSKLPTAFGEFNISVFQDPATGEEHVALSKGLENPPTGPVLVRVHSECLTGDAFASLKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANLLLNLPADARRYDMCSIMLDHLKVKEVKLITNNPLKIQALKDQGINVVDRVPLTVGRNPFNEQYLKTKRERMDHLYQKDDF
>NZ_CP010368.1|WP_039246241.1|437817_438768_-|oxygen-dependent-coproporphyrinogen-oxidase
MQHPTSTDIQRVREFLLDLQARICAGLEQQEKAGGGTAEFIIDDWERPEGGGGRSRVLQNGTVIEKGGVMFSHINISRLPASATERHPQIAGAKAQALGVSLVIHPKNPNIPTSHANVRLFVAEREGQEPIWWFGGGFDLTPFYPDDQDVLNWHQAAYDLCKPFGDNVYAEHKQWCDDYFYLKHRDEQRGVGGLFFDDLNCWDFETCFKYIQAVGNGYLNAILPIFEKHREQPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQTGGRIESILVSLPNLAAWSYRPEWDEDSPEKRLTDYYLKPRDWLGLKEKVA
>NZ_CP010368.1|WP_039246238.1|436851_437640_-|shikimate-dehydrogenase
MTKQFAVIGNPIEQSRSPELHHAFAQKTGVDLNYQKRLAPLDGFEPSMRSFFENGGSGMNVTVPFKEQAFALCDVLTERAQIAKAVNTLWMENGKLHGDNTDGQGLVAAIQALDWNLENTTILILGAGGATRGVIYPLVQAGAKKIVIANRTLARAEQLVDDLKTAVPQAQLQAISLNDLDGDFDIVINATSASLSGDALQLPEKLQFKYAYEMAYGKPSSFLDQAKQRNVPYAEGFGMLVGQAIEAFYIWNGVKPELKDFL
>NZ_CP010368.1|WP_039246236.1|434461_436804_+|hypothetical-protein
MHLKYLSLCLFSLGLTACAQHGVRPQVASANLEQKAIQSVNAMYEYPSYDYRGNFKITVDPSQIKQNGKAENSPKLDAELQKKVDQYLGEQKVGLSKAQKQSLYAAIANEQGGLGPSARSEKVNAVLINLLNDLQFSYDGSIHYRQKMGSFNLTAKYEKPTLLVQAKLPMVLDLENYKFYVNYFGLMPYLVNKENQNNLAYIDFSKYKDFFKNVDTKKFIEYLKASSAVSYRLADPQNLQRVSLTETDRKAGAVDKIRLKTTIEELLLEVELYGQVNDKYLQKSVLGFDNQKMAEKVAKELAASEAKKGAVNKEEQKVSSDDAAAVSQELYSLINAHFDGGLSSNDAGEDNLTTAAQAPAAADASVSEDQNGSEEAAAGGVQDAQGEDAVTLTEDQCIELKSLKKPVALGDINYCQVYGIDVLDQSAASAEKVQTKSRRDTLKQTFEAYNQNQFINDEAFKALWLKHKAEIEQALPKQRNPITIDVALDDKGRAVNMTYDVAYTPAEFKHSFNIKADMQILNYGKATSIDQKQLKQAKSVAEASKGSMLENFIKGFGEKLGQGDILEHPVGTHSDVQDLDANLAVLADKTYDATHAYDKTYKAVFIAKLTAEKPSYIKYYSVQQLQEIAEVYAYWFSEEDTYNPQGKTLERITALQKKHHLEQDEQFDHELGRAVDHIVIETMQGKAGREAWQKLQKQYKQPAQLFSKQYQLEFEKQNGVSAEEKHLLSETADILGNVYVAARKQQLTEKTIQKLKPEHNEFIDYEIFRDVYKQMVAAKK
>NZ_CP010368.1|WP_004884612.1|432380_434204_-|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein
MPAYKAPLHDIRFLMNEVLDYPAHYKTLSNGESADPDTVDMILEGAADYCENVLSPLNQSGDEEGCHFDNGEVKTPKGFKEAYDQFVMGGWQGLSYPEEFGGQGLPMSLNLIKSEMMGTANWSFTMYPGLSSGCMNTILQFGTDEQKQTYMPKLVEGTWSGTMCLTEPQCGTDLGQVKTKAEPQADGTYKISGTKIFISAGEHDLTENIIHIVLARLPDAPAGTRGISLFIVPKFIPTADGGVGERNTVSCGSIEHKMGIRASATAVLNFDNATGYLIGEVNKGLHAMFTFMNTARIGTAVQGIAHAELSFQGALPYAKERMSMRALSGKKDPDKVADAIIHHADVRRMLLTQKAIAEGGRSMIYYAAQLADKMTDALTRGDQAAFEDYDDKLGFYTPILKGFLTELGLEAANHGMQVYGGHGYIKEWGMEQIVRDARISTLYEGTTGVQALDLIGRKVLLSSKGKVVREYTAEILKFCATHARNKYLRRFAWDLTKLCAQWNTLTVRIMLAARKDRDIVSSASVDFLMFSGYVMMAYFWAQQAVVASEKLEAGDGKETPEFYKAKIKVADFYFDRLLPRAQGHAESMVTTSRTLTSLPVEHFSFDY
>NZ_CP010368.1|WP_016803860.1|431661_432309_+|hypothetical-protein
MSLKWSGLLIKHLGLAAILCMALSACDANHADSKDHSALATTSKHDNSLVKSTTAVKTLDDAAGRTFLPDGAPDQTSKISESDQQYAGRYHTRISCEDNFADCETGEAEYILNLLPDGTAYWNVVHFGRISNKDGAKSAVINRLCPSLKWKVDSAAHELKIQCPTSDVNFYFNIISKQKLIVNLEKLFYSDYGKNREFLEQNYFVPTKAYVLNKE
>NZ_CP010368.1|WP_002052345.1|431155_431410_-|PspC-domain-containing-protein
MTNSGLYRSNRQSMIAGVMGGIAERFGWNANLLRIIFVLVSVMSAAFPGILVYLVLWLVIPKRQPEQVQGYQQPVRTVREEQIH
>NZ_CP010368.1|WP_039246232.1|429985_431086_+|HPP-family-protein
MSVIQPEWLQILKPNFKVLPLKERLLCGVGALCGLAISSLISWYVLGGINAWYIAPMGASSVLLFAVSTSPLAQPWNVIVGNTLAAIIGVACAQYIPDLTTAFSVAVGLAIFLMMTTDSLHPPSGAVAITAVLGGAAIYKLGFYFVFYPVLLNSLLLLGFAIFFNRLIGRHYPVTAHLNERSKDPTPTQKVSIQPKDIEYALEHHTELLDISQYDLEKIILEAQEHANERMVNQYACQDIMSRDVIKLHEDDDIHQALDKFKQVNLMSLPVVNAENHLVGTLALYEVVEWFKGAADPRNSWQHYVKQIMSRRVVTVLPTQPIQDLVPYFVEKSFNYIPVVEERKLIGIISRADMIAALQQQLNRKL
>NZ_CP010368.1|WP_004711782.1|445313_446132_+|ABC-transporter-ATP-binding-protein
MNNKTPLSTQSLIEVKNLSFNRGERVIYDNISLNIRRGQITAIMGPSGTGKTTLLRLIGGQLVPDHGEVLLDGKDIAQMSRQELFAARARMGMLFQSGALFTDMSVYENVAFPIRAHTKLSENLIAELVALKLESVGLRGTEQLMPTELSGGMNRRVALARAIALDPDLIMYDEPFAGQDPIVKGVLTRLIRSLREALDLTTIIVSHDVPETLSIADYIYVVAEGKIQGEGTPEELQKYASPFVKQFLTGSAEGPVEYQFSHQAYLDNEVRP
>NZ_CP010368.1|WP_001091949.1|446128_446905_+|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE
MNTIAWLGRLVIERIRGIGVAALMLLQIIFSLPSAGGFGRFVYQMHRVGVMSLLIITVSGLFIGLVLGLQGYSILVNVGSESMLGTMVSLTLLRELAPVVAALLFAGRAGSALTAEIGSMKQSEQLASMEMIGVDPLKQIVSPRLWAGIVSLPMLTVIFAAIGIVGGKLVGVDFLGVDEGSFWSGMQNNVQFGHDVVNGIIKSIVFALLCTWIAVFQGYACDPTPEGIATAMTRTVVYSSLCVLGFDFVLTAVMFGGI
>NZ_CP010368.1|WP_002049738.1|446904_447588_+|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD
MKSRTSELAVGIFVIIFGIALFFLAMKVSGLVGTNLSEGYTMKAQFDNVNGLKPRAKVTMSGVTIGRVDSITLDPVTRLATVTFDLDGKLTSFNAEQLKEVQKNALDELRYSSDYTQATPAQQKTMEQQLISNMSSITSIDEDAYIMVATNGLLGEKYLKIVPGGGLNYLKRGDTISNTQGTMDLEDLISKFITGGGAGKVAAGSSSSAEEKAPASTDSSAQPSFVE
>NZ_CP010368.1|WP_002049753.1|447614_448256_+|ABC-transporter-substrate-binding-protein
MNKLFKQTLTASVLSTMIAGTAFAAPSEAPPDFIKRVADGLIARLKTDHAKLQNNPALVKSIIRQNLDPYVDSQAFTRIVMGTYATNQYSTAAQRAQFETNFRNTLIENYGSAFAKYTNQTYTMRPYKATAGKNPVVTLDFNHNGDKIPVSFQLADKGSQWKIRNINVSGIDLGLQFRNQFAATVKRNGGDLNKAIATFQPDADAAVNQNKQK
>NZ_CP010368.1|WP_000250997.1|448267_448555_+|STAS-domain-containing-protein
MVQYLNQELVVSGKIDFENAEQQYQAGLAIIKKQTSFPLIVDLKQLEHGNTLALAVLVQWLRQTPQKSGLHFKNVPEKMLKIIQACHLQEDLHLV
>NZ_CP010368.1|WP_002049699.1|448629_449643_-|magnesium-transporter
MLEAFYATERGSLEDATINGGFDLHPELVWLDLIAPSQEEQQWVLDAYDQNLPTLKSLEDISSSARFYRDDDGILHISTYFLTKNKNYQVDGDAEDSSHMLAMVQTVAFILHKDRLFTLRGEKLVAFRAFRARARRNDYEMDYKDPTWILLGLLEAKLDELADILEDIHKDLEKYSTEVLNNHQREKILDLDDMITRLAQQEDMLGKAQLCLIDLRRVLTFLSRPRALGSHIYDADIRELSEDVRSLVEHDAFLFQKVRFLLDTTSGFINTEQNDTIRRFSILPSMLAPPMLIASIYGMNTEVLPFAHGKSSFIAVLLIIIGFFIGPIIYFRWKKWI
>NZ_CP010368.1|WP_002049746.1|449800_450382_+|TIGR00730-family-Rossman-fold-protein
MNSICIFCGSSLGSDPIFQQIAQLTGQTIAKQGKTLVYGGGRSGLMGVVADSALQAGGQVIGVIPRALVDRELAHPGLTRLYVVENMHERKTKMADLSDGFIALPGGAGTLEEIFEQWTWAQLGIHQKPCAFLNVAGFYEDLLKMVQGTVDKGFSQARFADKLIASDKIEDILQQFEQYQPPAPKWTNADVQP
>NZ_CP010368.1|WP_039246252.1|450396_450798_+|NUDIX-domain-containing-protein
MKTITVAAAVILNEQNELLLVRKLNTQAFMQVGGKLEPNEAPETAIQREILEEIGSSCVIERFIGRFETAAANEPDHTLISHLYLVRLKQSPQIAAEIAEMKWIKFNDSETKLAPLTKEIVIPWCEQNLSTTL
>NZ_CP010368.1|WP_039249311.1|450800_451436_-|ComF-family-protein
MFKLFNPQYLFQLLSPCLLCGIGTREKYSLCKECWEQLPWLKQTVQRNDQSVLVACHYAYPINRIIQQFKYEQKLHYQTLLAEVLQQIKFPKVQAIVPMPISKQRLTERGFNQSLLLAKLLSKQLKIPVWQPVQRLNERSQKGLSRLERFENIEQQFVAMTQEKRRYRRVLIIDDVITTGSSIHALSQALKQLGCTSIYASCLAAASSTSY
>NZ_CP010368.1|WP_022575959.1|451428_453474_-|ATP-dependent-DNA-helicase-RecG
MTSVHQLQGVGSASAALLEKLNIFTTDDLLFHLPRDYEDRSTIIPMNQLVVGRSYLLEGEVKSVDFPPGKRKSMAALIQDEFGKVTLRFYHIYKNLTDKIKPGNRLRIFGEVRVGARGLELYHPEIQLINEHTPLPKTQLTAIYPSTDGLTQPKLREYVKQALKHHSDALPELLPKQYTNGYALKEALHYIHEPPVDANMIQLAQGSHPAQQRLIFEELVAHQISLLTRRAYIRQIASPAFPSSKVLAKKLLEALPFQMTNAQKRVSKEILTDLKQHQPMLRLVQGDVGAGKTLVAAIAACHALEADWQVALMAPTEILAEQHYLNFKRWFEPLGITVAWLSGKQKGKARTQAEQQIKEGHAELIVGTHALFQDNVEFAKLGLVIIDEQHRFGVDQRLALRNKGAEQLTPHQLVMTATPIPRTLAMSAYGDLDTSIIDELPPGRTPIQTVTIPLDRREEVLNRIATNCREGKQAYWVCTLVEQSETLDAQAAEATYQEMKERFPELNIGLVHGKMKADEKQSVMQAFKNNELQLLIATTVIEVGVDVPNASIMVIENAERLGLSQLHQLRGRVGRGAKASFCVLLYKPPLSQNGQERLSILRESNDGFVIAEKDLELRGPGELLGTKQTGDMGFRVARLERDDHLLSQAHYVAQQVLKDYPEQADALLKRWLPEAPRYAYV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1187729 : 1202522

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001187844.1\|1187729_1188278_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	1.7e-97	100.0
WP_039246979.1\|1188539_1190039_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	3.3e-271	93.8
WP_039246981.1\|1190040_1192416_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	97.1
WP_039246984.1\|1192422_1193406_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.7e-181	94.8
WP_002052415.1\|1193416_1194112_-	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	1.6e-119	98.3
WP_039246986.1\|1194121_1194928_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	5.3e-143	97.8
WP_009498528.1\|1194937_1195987_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.1e-188	98.6
WP_039246990.1\|1196344_1199077_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	96.6
WP_080961319.1\|1199090_1201856_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	97.9
WP_171249577.1\|1201946_1202522_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	4.6e-109	99.0

DBSCAN-SWA_2

1247259 : 1270446

Acinetobacter_phage(65.38%)

integrase,tail

attL 1249890:1249907|attR 1277149:1277166

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039247045.1\|1247259_1248072_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A126HHM5	Vibrio_phage	4.2e-39	34.9
WP_002052782.1\|1248068_1248842_-	ABC transporter permease	NA	NA	NA	NA
WP_002052950.1\|1248838_1249774_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.7e-23	30.5
1249890:1249907	attL	NA	NA	NA	NA
WP_002052629.1\|1250071_1251058_+\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	6.8e-185	98.8
WP_000123991.1\|1251054_1251324_-	hypothetical protein	A0A1B1P9G0	Acinetobacter_phage	4.7e-48	100.0
WP_039247053.1\|1251568_1252885_+	AAA family ATPase	A0A2H4J6D5	uncultured_Caudovirales_phage	1.5e-163	74.9
WP_000854669.1\|1252881_1253139_+	hypothetical protein	A0A2H4J6Z3	uncultured_Caudovirales_phage	7.3e-22	61.5
WP_167435653.1\|1253135_1253312_+	hypothetical protein	A0A0P0IRH7	Acinetobacter_phage	2.0e-18	87.9
WP_039247055.1\|1253308_1253752_+	hypothetical protein	A0A1X9SFH5	Acinetobacter_phage	9.4e-09	34.6
WP_032053189.1\|1253748_1253955_+	hypothetical protein	A0A0A0RML7	Acinetobacter_phage	2.7e-27	85.3
WP_050049509.1\|1254174_1254558_+	hypothetical protein	E2GLV9	Acinetobacter_phage	1.5e-07	59.1
WP_000123971.1\|1254554_1254923_+	hypothetical protein	NA	NA	NA	NA
WP_039247062.1\|1254934_1255387_+	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	2.8e-77	98.0
WP_000837878.1\|1255475_1255745_+	hypothetical protein	A0A0D4DC03	Acinetobacter_phage	2.1e-43	96.6
WP_039247065.1\|1255755_1256289_+	hypothetical protein	A0A0P0I4C3	Acinetobacter_phage	2.9e-20	37.6
WP_068551104.1\|1256784_1257018_+	hypothetical protein	NA	NA	NA	NA
WP_017394237.1\|1257285_1257459_+	hypothetical protein	A0A0D4DBK3	Acinetobacter_phage	6.4e-22	91.2
WP_017394236.1\|1257469_1257652_+	hypothetical protein	A0A0D4DBU4	Acinetobacter_phage	1.7e-25	96.7
WP_080593976.1\|1257569_1257926_+	DUF968 domain-containing protein	A0A0D4DC07	Acinetobacter_phage	6.1e-19	55.9
WP_017394234.1\|1257975_1258395_+	hypothetical protein	NA	NA	NA	NA
WP_039247070.1\|1258435_1258918_+	hypothetical protein	A0A0D4DC11	Acinetobacter_phage	4.2e-63	72.6
WP_000233107.1\|1259080_1259611_+	hypothetical protein	NA	NA	NA	NA
WP_039247071.1\|1259652_1260087_+	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	6.7e-68	86.8
WP_039247075.1\|1260055_1260697_+	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	3.9e-125	98.6
WP_050049510.1\|1260702_1261185_+	PIN domain-containing protein	NA	NA	NA	NA
WP_017394224.1\|1261287_1261812_+	DUF4468 domain-containing protein	A0A0P0I8L3	Acinetobacter_phage	1.0e-91	93.1
WP_017394223.1\|1261817_1262090_+	hypothetical protein	NA	NA	NA	NA
WP_017394222.1\|1262165_1266329_+	tape measure protein	A0A220VZA0	Acinetobacter_phage	0.0e+00	70.6
WP_044709021.1\|1266383_1266698_+	hypothetical protein	NA	NA	NA	NA
WP_039247081.1\|1266690_1267032_+\|tail	phage tail protein	A0A0R6PHH7	Moraxella_phage	1.8e-12	41.1
WP_034120668.1\|1267084_1268254_+	hypothetical protein	G3ENB2	Psychrobacter_phage	4.3e-37	36.7
WP_039247083.1\|1268240_1269047_+\|tail	phage minor tail protein L	A0A0R6PGU8	Moraxella_phage	2.9e-93	64.2
WP_039247086.1\|1269053_1269809_+	C40 family peptidase	A0A0R6PIM4	Moraxella_phage	5.4e-81	55.4
WP_017394010.1\|1269792_1270446_+\|tail	tail assembly protein	G3ENB6	Psychrobacter_phage	1.0e-43	49.5
1277149:1277166	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3776595 : 3784912

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039249214.1\|3776595_3777486_-	glycosyltransferase	A0A1V0SAH6	Catovirus	4.2e-08	26.7
WP_050049516.1\|3777482_3778445_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	2.8e-05	31.1
WP_039249215.1\|3778437_3779703_-	O-antigen translocase	NA	NA	NA	NA
WP_039249216.1\|3779703_3780819_-	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	8.0e-41	30.3
WP_080961366.1\|3780818_3781673_-	WxcM-like domain-containing protein	NA	NA	NA	NA
WP_039249217.1\|3781674_3782547_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.2e-109	67.6
WP_039249218.1\|3782546_3783605_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.5e-100	52.1
WP_039249220.1\|3783634_3784912_-	Vi polysaccharide biosynthesis UDP-N-acetylglucosamine C-6 dehydrogenase TviB	A0A218MKK1	uncultured_virus	1.4e-09	24.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP010903

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6554

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049520.1\|439_778_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_050049521.1\|2372_2561_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_050049522.1\|2660_3407_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	9.6e-14	37.4
WP_050049523.1\|3598_4057_-	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_050049524.1\|4067_6554_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.9e-91	34.1

DBSCAN-SWA_2

11582 : 14747

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049528.1\|11582_14747_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-63	22.9

DBSCAN-SWA_3

18587 : 19154

Sodalis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049532.1\|18587_19154_-	recombinase family protein	Q2A092	Sodalis_phage	1.6e-24	38.0

DBSCAN-SWA_4

38176 : 40429

Saudi_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049548.1\|38176_40429_-	type I DNA topoisomerase	A0A1S5V180	Saudi_moumouvirus	3.7e-77	35.0

DBSCAN-SWA_5

47545 : 48322

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049557.1\|47545_48322_+	ParA family protein	A0A1X9I765	Streptococcus_phage	4.9e-13	25.7

DBSCAN-SWA_6

52750 : 57618

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049561.1\|52750_54046_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	9.7e-147	57.7
WP_050049562.1\|54070_54652_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	2.1e-53	57.2
WP_005146114.1\|54953_55511_-	TetR family transcriptional regulator	A0A0R6PIB6	Moraxella_phage	3.4e-16	30.7
WP_005146112.1\|55511_55856_-	hypothetical protein	NA	NA	NA	NA
WP_050049563.1\|56116_56638_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_050049564.1\|56709_57618_-	replication initiation protein	A0A218MNI2	uncultured_virus	2.2e-44	35.5

DBSCAN-SWA_7

62022 : 63348

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050049569.1\|62022_63348_+	protein kinase	M1H3V5	Paramecium_bursaria_Chlorella_virus	1.3e-13	24.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010369

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP010368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP010903

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection