CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP010518	Pandoraea apista strain TF81F4 chromosome, complete genome	1 crisprs	DEDDh,RT,csa3,WYL,DinG,cas3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010518_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010518_1

1925573-1925664

Orphan

Consensus_repeat	Method
GGTTCGCCGGTGCCGCCGGATTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010518_1

>merge|NZ_CP010518|1|1925573-1925664|CRISPRCasFinder
GGTTCGCCGGTGCCGCCGGATTACCGGCCGCCGGTACAGCAGGCGCCACGCACGCCCGTGTATCCGAACGGCTCGCCGGTGCCGCCGGATTA

>NZ_CP010518|1|1|1925573-1925664|CRISPRCasFinder
GGTTCGCCGGTGCCGCCGGATTA	CCGGCCGCCGGTACAGCAGGCGCCACGCACGCCCGTGTATCCGAAC
GGCTCGCCGGTGCCGCCGGATTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010518.4\|WP_042116687.1\|1914188_1915079_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP010518.4\|WP_042116696.1\|1921904_1923116_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP010518.4\|WP_042116711.1\|1930090_1931587_+\|acetyl-CoA-hydrolase/transferase-family-protein	unknown	unknown	gnl\|CDD\|274588
NZ_CP010518.4\|WP_042116683.1\|1911619_1912399_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP010518.4\|WP_042116697.1\|1923281_1924637_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|273327
NZ_CP010518.4\|WP_042116717.1\|1934186_1936073_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP010518.4\|WP_042116689.1\|1915151_1916756_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP010518.4\|WP_042116685.1\|1912446_1914192_+\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|234861
NZ_CP010518.4\|WP_042116691.1\|1916883_1917756_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010518.4\|WP_042116719.1\|1936487_1937198_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP010518.4\|WP_042116681.1\|1910303_1911623_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP010518.4\|WP_042116713.1\|1931782_1933378_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP010518.4\|WP_042116720.1\|1937225_1938236_-\|asparaginase	unknown	unknown	gnl\|CDD\|199208
NZ_CP010518.4\|WP_042116706.1\|1928468_1929041_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010518.4\|WP_042116694.1\|1919265_1921626_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|99782
NZ_CP010518.4\|WP_042116703.1\|1926648_1928202_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227279
NZ_CP010518.4\|WP_072632851.1\|1926065_1926299_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010518.4\|WP_042116709.1\|1928979_1929897_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176142
NZ_CP010518.4\|WP_109468910.1\|1918028_1918934_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP010518.4\|WP_042116715.1\|1933646_1934003_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314

Protein	Function_ID	Function_description	E-value
NZ_CP010518.4\|WP_042116687.1\|1914188_1915079_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	3.22442e-78
NZ_CP010518.4\|WP_042116696.1\|1921904_1923116_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.24796e-95
NZ_CP010518.4\|WP_042116711.1\|1930090_1931587_+\|acetyl-CoA-hydrolase/transferase-family-protein	gnl\|CDD\|274588	TIGR03458, Propionyl-CoA:succinate_CoA_transferase, succinate CoA transferase. This family of CoA transferases includes enzymes catalyzing at least two related but distinct activities. The E. coli YgfH protein has been characterized as a propionyl-CoA:succinate CoA transferase where it appears to be involved in a pathway for the decarboxylation of succinate to propionate. The Clostridium kluyveri CAT1 protein has been characterized as a acetyl-CoA:succinate CoA transferase and is believed to be involved in anaerobic succinate degradation. The propionate:succinate transferase activity has been reported in the propionic acid fermentation of propionibacterium species, where it is distinct from the coupled activities of distinct nucleotide-triphosphate dependent succinate and propionate/acetate CoA transferases (as inferred from activity in the absence of NTPs). The family represented by this model includes a member from Propionibacterium acnes KPA171202 which is likely to be responsible for this activity. A closely related clade not included in this family are the Ach1p proteins of fungi which are acetyl-CoA hydrolases. This name has been applied to many of the proteins represented by this model, possibly erroneously.	0
NZ_CP010518.4\|WP_042116683.1\|1911619_1912399_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.14065e-58
NZ_CP010518.4\|WP_042116697.1\|1923281_1924637_-\|MFS-transporter	gnl\|CDD\|273327	TIGR00895, transport_protein, benzoate transport. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	6.75196e-98
NZ_CP010518.4\|WP_042116717.1\|1934186_1936073_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	8.06564e-99
NZ_CP010518.4\|WP_042116689.1\|1915151_1916756_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP010518.4\|WP_042116685.1\|1912446_1914192_+\|dihydroxy-acid-dehydratase	gnl\|CDD\|234861	PRK00911, PRK00911, dihydroxy-acid dehydratase; Provisional.	0
NZ_CP010518.4\|WP_042116719.1\|1936487_1937198_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.43303e-43
NZ_CP010518.4\|WP_042116681.1\|1910303_1911623_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.04249e-102
NZ_CP010518.4\|WP_042116713.1\|1931782_1933378_-\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	1.14133e-112
NZ_CP010518.4\|WP_042116720.1\|1937225_1938236_-\|asparaginase	gnl\|CDD\|199208	cd08964, L-asparaginase_II, Type II (periplasmic) bacterial L-asparaginase. Asparaginases (amidohydrolases, E.C. 3.5.1.1) are enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia. In bacteria, there are two classes of amidohydrolases. This model represents type II L-asparaginases, which tend to be highly specific for asparagine and localized to the periplasm. They are potent antileukemic agents and have been used in the treatment of acute lymphoblastic leukemia (ALL), but not without severe side effects. Tumor cells appear to have a heightened dependence on exogenous L-aspartate, and depleting their surroundings of L-aspartate may starve cancerous ALL cells. Type II L-asparaginase acts as a tetramer, which is actually a dimer of two tightly bound dimers. A conserved threonine residue is thought to supply the nucleophile hydroxy-group that attacks the amide bond. Many bacterial L-asparaginases have both L-asparagine and L-glutamine hydrolysis activities, to a different degree, and some of them are annotated as asparaginase/glutaminase.	2.53934e-100
NZ_CP010518.4\|WP_042116694.1\|1919265_1921626_+\|cytochrome-P450	gnl\|CDD\|99782	cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.	3.63771e-99
NZ_CP010518.4\|WP_042116703.1\|1926648_1928202_-\|EAL-domain-containing-protein	gnl\|CDD\|227279	COG4943, COG4943, Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms].	1.29418e-100
NZ_CP010518.4\|WP_042116709.1\|1928979_1929897_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176142	cd08451, PBP2_BudR, The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.63177e-78
NZ_CP010518.4\|WP_109468910.1\|1918028_1918934_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	5.63929e-42
NZ_CP010518.4\|WP_042116715.1\|1933646_1934003_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	3.10883e-23

>NZ_CP010518.4|WP_042116697.1|1923281_1924637_-|MFS-transporter
MKAAEVNVGKLIDESRLGAYQWWVIALCAMCLVVDGFDVQAMGYVAPVVIREWGIAKETLSPVFGAGLFGMLVGSLTFSALADKLGRRPVLIGATLFFAVCMIFTGFANTITELVVWRFVAGLGLGCIMPNAMALAGEYSPRRIRVSLMMMVSCGFTLGGVVGGLITAAIIPSMGWRAVFFIGGAIPLVLGILMWISLPESIQFLMFKKSDRVRIRKQLLRVAPNANVPVDAHFVLDEQKAKGVPFIELFKDGRARVTLLLWVINFANLLDMYFLSNWLPTVIRDAGYSTQVAVMAGTALWAGGVIGTLLLGRVIDRVGFTSVLAVTFLIAIAATAAIGNPVVMVSMVAVFIAIFFAGFSIIGGQPALNALAATYYPTSLRSTGIGWSLGVGRIGSVLGPVLGGALMHLQWSSSSLFLAAAVPACVSLIGVLAIARTQRGDGGNLRTAAAN
>NZ_CP010518.4|WP_042116696.1|1921904_1923116_-|multidrug-effflux-MFS-transporter
MTSTSELSPALPSERVLLGVLGLFMMIAPASTDMYLPGLVTMRHELGASAAATQLTLSYFFLGFAFGQLVWGPLADRFGRRRPMAAGIALYIFGSIGCAFADSIDHMMMWRFVQALGGCAMPVIAQAIVRDVYGPRNSARAFSIMLLVMSVAPIVAPLIGGQMLRFTTWRVIFGILAVFGVVAMFALWRLPETGAVHARQAGGPRAVAASYLQLLRDPHFVGYMVAGGAVFGASFTYITGTPLVYMEYFHVSPQFFGVLFGINIVGMASVTMFNSRRVGQIGPYRLMRIGIIGCAIVTSVLCATVWLGVALLPVMVALLFLFMSLRGIITANSVAGALANHPTRAGAAAALVGSVQYGFGFAAGGLLGLLNDGSPRPLATVMCGFSVLALIALVTMLRKPQHA
>NZ_CP010518.4|WP_042116694.1|1919265_1921626_+|cytochrome-P450
MSQTISPTPDTAAASAGGCPFHQTAPVTAPNGCPVSARAADFDPFEDGYQQDPPEYVRWAREQEPVFYSPKLGYWVVTRYDDIKAIFRDNITFSPSIALEKITPTGPEANAVLASYGFALNRTLVNEDEPAHMPRRRVLMEPFTPEHLKHHEPLVRQLAREYVDRFVNDGRADLVDQMLWEVPLTVALHFLGVPEEDMDKLREYSIAHTVNTWGRPKPEEQVAVAHAVGNFWQLAGKILDKMRQNPDGPGWMQYGIRKQQEHPEVVTDSYLHSMMMAGIVAAHETTANATANAMKLLLQHPDVWREICEDPSLIPNAVEECLRHNGSVAAWRRLATKDVTIGGIDIPAGSKLLIVTSSANHDEAHFADADLFDIRRENASDQLTFGYGSHQCMGKNLARMEMQIFLEEFTRRLPHMKLAEQSFTYVPNTSFRGPEHVWVEWDPAQNPERRDPAVLTRHSPVRIGEPSGHSVTRPVVVESVTPAAEGIVKLRLVAPDGRTMPRWAPGSHIDIECGDTGLSRQYSLCGDPSDAHAFEIAVLHEPEGRGGSNWVHTQVKIGDRLRIRGPRNHFRLDESISRAIFVAGGIGVTPIAAMARRAKTLGIDYEVHYSGRSRRTMALLDELQTLHGDRLHLWVKDEGQRADYASLLATPQNGTQVYACGPVRMLDGLAQCCAHWPEDTLRVEHFQSQLGTLDPEKEHAFEVTLKDSGITVTVPADQTLLTALRAANIDVQSDCEEGLCGSCEVQVLEGDVDHRDVVLTRAERDANTKMMSCCSRACGKKLVLAL
>NZ_CP010518.4|WP_109468910.1|1918028_1918934_-|IclR-family-transcriptional-regulator
MTTIKRPTAGRPRRAAEPSGMTDSLAASDNDASGAPRERGRRQRVQSAETGMVVLKGLARLGGRASLTALALHVQQSPAKVHRYLMSLVEEGLVAQDTDSQHYHLGLEAMLIGVAAMRQADPVRAAEPALVRLREAFDVTCFIAVMGNKGPTIVRFEEPGLPVTINVRIGSVMSVLWSAAGRVFLGLLDDPQVLAMAEAELAQASPEHRAQLDAADPIGALRASVRAAQGASVRDTNLTGISALAAPVFNYDGRLVGVITALGATGGFDARMEGPIGEAVRREALAASHALGYRPALPASA
>NZ_CP010518.4|WP_042116691.1|1916883_1917756_-|hypothetical-protein
MLMLKRTVDLTPRVASIPTPSMTYVPLGQFGQGERKLSGGEQHRALASSDRQTAEKSDGDRPAAAHASPQCGGDELWLWRFLLAGRPFGATGASAGGPDDGATWLSGAEHALARRLPRPQMRHRFLSERIALRWIFGRWFHCPPAQAPVPAPTPGGSSLACDGPHGKVWVDMAHAGLWLFVAMGQGPVALTAHAPAPTGPDDTARRSAQPGDPFSVARDAAHRLCLARLAGEGQALATGAAIPLLAHPYVSVPYAGRTRYLYDMSVSSRLTVVAARDSIVHRMRAFGWQN
>NZ_CP010518.4|WP_042116689.1|1915151_1916756_-|ABC-transporter-substrate-binding-protein
MHRRSRRHLAAVLTVLALPMVPLVAHAKPLTVCTEASPEGFDVVRYNSLTTTNASADPVFNRLVEFDAAQAKVVPSLATRWEVSPDGLTYTFTLRPNVSFHSNDLFKPTRAFNADDVVFTFERMLNDNAPWHKLTPSGFPHAQSLSLGKLIKSVQKVDDNTVRFTLSEPDAVFLSMLSMGFASIYSAEYADKLMAANKTDELNARPIGTGPFVFRSYQKDSVVRFDANASYFGGKPASERLIYTIVPDAAVRAQKVKVGECQIALSPKPLDVQAARGDKALKVVETPAFMTAFVAINTQHKPLNDVRVRQALNLAFDKPSYVKQVFEGTATPAANVYPPNTWSYAKNVADYPHNIEKAKKLLADAGFPQGFETTIWTRPAGSLLNPNPRVGAEMLQSDLAKIGVKAQIKTVEWGELIRRGKAGEHDLLFMGWSGDNGDPDNFLTPQFSCAAVTSGTNFARFCDANLDKLISDGKRTPDVATRTAKYQAAQKTIKEDALWIPLAHPTAAVITRADVSGYQVSPFGRQNFATVQVK
>NZ_CP010518.4|WP_042116687.1|1914188_1915079_+|NAD(P)-dependent-oxidoreductase
MTISRVGFCGIGRMGEPMTQRLLAAGHDVAVWNRSAAKLAALTDAGAMACVTPQALGECVDIALLCLGDGKAVEDVVFGEHGLVHAATPPRFLVDHSTLSPALTRTLAKRWHDATGSVWIDAPVSGGTAGAAAGTLAIMAGGPAHAVEALTPVLHAFSSRVTRMGDTGAGQTTKLANQAIVATTLAGLAEAFVLATRSGIDTSAVPSALQGGWADSVLLQTLWPRMVTPPAQATGTVRVMLKDLDAIAELAHTSATVQRVLPEVRRLLSDAAQRGMADWDLSQIFRIGEAESSPQA
>NZ_CP010518.4|WP_042116685.1|1912446_1914192_+|dihydroxy-acid-dehydratase
MTDLHKHRSRTVTEGVTRTPHRAFLRATGLDDAAIEKPFVAIVDTFGENTPCSMSLNQVSDNVRLGVAAGGGVPIRGSAISVSDGTSMNHAGMRFSLVSRETIADSVELFVRAHCYDALVGVAGCDKTLPGILMGMVRVNVPGVFLFGGAMLPGVAPDGTQATILTAIEAVGAAQRGDMSADTLLGIEKRCTPTAGSCPGQFTANTMAMVAEVLGLAPLGSAMVPAVYSERIAIARRAGENVMRALRNGGPLPRDLVTRKSLENACAAVAATGGSTNAMLHIPAIAHEAGISFTLDDVSEVLARTPLIGDMQPGGRYLAVDLHHVGGVPAVLNALLAGGHIHGDTLTQSGETLEVALRAFPGPDGRVVKPHTEPLSPNAGLVVLRGNLAPDGAALKTAGLKQLVFSGNARVFETEEDCMAVVSAGTYREGDVLVIRNEGPKGGPGMREMLSVTAAIYGQGMGEKVALLTDGRFSGATRGMCIGYVGPEAAAGGPIRLLRDGDRIHIDAIKGKLDVELSDEELATRAAQTRPFVRGRLGGVLEKYEALVRPAKFGAVTHSGAVEWPYEASLGETATREDTHR
>NZ_CP010518.4|WP_042116683.1|1911619_1912399_+|SDR-family-oxidoreductase
MNFPVCLVTGAATGIGAATALRFAREGWAVAINNFDDSTRAAAESVAAQCRDAGAQTLVIDADVGDDAACRRMASAVGAQWGRLDALVNSAGTTRVIPHSDLEAIDDAEFERIYRVNLIGMFQMTRAAAGLLRERPAGASSAAVINISSLASLNGTGSSIAYAASKGAVNSLTLSLARNLAPQVRVNAIAPGMVDDGLLRRVLGDDAYARVVDGMRENAPLKRVSQPSEIADLAWFLAAHAPAMTGQVLAIENGLLLNT
>NZ_CP010518.4|WP_042116681.1|1910303_1911623_+|MFS-transporter
MSTSLSGAGAQPHAVLDPMQRNALYRKLTWHIIPFLFLAFIVAYIDRVNVSFAKLEMLADLSLSETVYGAGAGVFFLGYFIFEVPSNLILHRVGARMWIARIMVTWSIISCLTMFTQGPVSFYVLRFLLGVAEAGFFPGIVLYLSKWFPSNKRSQIIALFMVAIPVSGAIGGPLSGWIMQRFGGLHDLAGWQWLFLIEGIASLFVGIAAFFVLQDRIETVKWLNADEKRLLAQDLAADDSTRAHQSVREVFGNGKVWLLGLLYFCIAMGNYGLVFWLPTMIRAAGVANLGNIGLLSAVPSLVSAIAMILVARHADRHNERRVHVAVCCVLGAAGMLASVLLAQHLWWSMAALIVAAIGINSIAPVFWGIPTAMMGGAGAAAAIALINSTGNLAGFVSPYVIGFLKDSTGQLLPGMIVLACALVGGACIVLSLKPQRSHA
>NZ_CP010518.4|WP_072632851.1|1926065_1926299_-|hypothetical-protein
MSNTPPGRPFELAGAITPRADERFDGAVDAYCDGHYIGRCEFSSIDAHDASEAAEQIRKRIELRIEDRVAREASTSH
>NZ_CP010518.4|WP_042116703.1|1926648_1928202_-|EAL-domain-containing-protein
MQTLRRLTRWLPVLTGAVAGMLVMLLVAQIVQTRVDDFRLRAYVQDIMGFMSDASVSSQDALLSAMYSGAVPCTDADIFALRRVAMRSPYFHDIGRVHGSRLLCTAISGRLEPAPELPPPSHETRSGLKLWHTLTGLVTPGVQVNATGMGDVVVFSPPVLPERLATPPNGFASVASTSDMRFQFWRAGMFEDQQRIELGATSRWLDIGSLRRYSTCSGRVDVCASAVYVSSQILANPLGLALALSIGAAAGVSMGVSWRSRRRYRMSIDWVTQQAAESGGINVVYQPLVRLRDRKMVGVEALARLNDSAGAPISPDMFIPIAERRGVIGLITRQVVRRALIDMHGRAMADPEFHISINLAATDVVDSTFHAYLNHMSSSLWVPRAQIALEITERSTDNMTRLREALDRLRVDGYQIHIDDFGTGFSNLAYLSTLNVDALKIDRMFTQSIGTDTVGSAIVDQICKMAALLKVEVIVEGMETEAQANYMLARYPAAIGQGWLFGKAVPADDLPSEFDNV
>NZ_CP010518.4|WP_042116706.1|1928468_1929041_+|hypothetical-protein
MTLKFRNPANGDVVEITYMSCVAAFFLGPLYLLAYGFAWHALIWVALAIGPALVWRESVLAISLPLTCLLYSLIIHPMLVARLRANGWVPTFDDAVPGPGQRGYDAYGDAPSTGRASAGMRLAPTLSTLGTAHEGGNVGAALAAQSPAANESASLSLAADEKSCPFCAETIKRQALRCRHCLANLPATSQ
>NZ_CP010518.4|WP_042116709.1|1928979_1929897_-|LysR-family-transcriptional-regulator
MELRHLQYFIAVAEERHFTRAAARVGIQQPPLSLQIRQLEAELGGPLFVRLPRDVVLTELGEAFLPEARQILARVERVKRRMEQISRGEAGQIRIGFAGATYFEPRIPAWIRDFRAQYPDVQLHPQQSNTASLLTALVNEAIDAAFVRTPFEVPPGIASVPVVDEPMVLVLPLGHAMCARERVPLAALSQDEFILLPREISPALYDRTIAACEAAGFRPKLGQEAPQITSIVPMVAAGFGVSMVPASVSQIRTPGMGFWPIDGEVPYAPISLAYRADHGSAALDRFIAMLPADSPGSGGSEAPDV
>NZ_CP010518.4|WP_042116711.1|1930090_1931587_+|acetyl-CoA-hydrolase/transferase-family-protein
MFEDRIRLASLRDRVMSADDAATLVGDGMVVGMSGFTRAGDAKDMPIALARRAKAHPMKITLITGASLGHDSDKTLTEAGVLAKRLPFQVDTTLRGAINRGEVMFVDQHLSETVEFLRAGQFGKLDVAVIEAVAITEDGGLVPSSSVGNSASFAILAEKVIVEINLAQPLAFEGMHDIWIPGQRPHRTPLPIVDVRDRVGTNVVKIAPEKIAAIVITDTPDSASNALPADADTQRIAGHLIEFFQHEVSRGRLPRTLPAIQSGIGTIANAVLTGFIDSPFEDLTMYSEVLQDSTFELMDAGKMVFASGSSITVSQAVQDRVFKHLERYRDKLVLRPQEVSNHPEVIRRLGLIALNTALEADIYGNVNSTHVGGTHMMNGIGGSGDFARNARMAIFATKSIAKDGKISSIVPMVPHVDHNEHDVDIIVTEQGLADLRTLAPRERVNLVIDHCAHPSYREVLRDYYRDALRYGGQTPHALERAFDMHVNLRERGSMLAGK
>NZ_CP010518.4|WP_042116713.1|1931782_1933378_-|HAMP-domain-containing-protein
MKFLGSLKIGTRLTIGFAITLILLCIVGGMAVFQASRIYDGTRDLADNWLPSVQTLGTAQVAANGARRASLAMLLTTVDSTRADETKKRLASIDLMNKTLDSYNSLVASDEDRRAYDAVRAAWTSYLEVDNRAAELEKGDDAGKEQARTLVMTDAVKRFAELSDRLKEHVAVNRAGALTASEAAANNYHTAFIATVVLILLSLVVNVVIALVITRSITVPIGRCVDIAETVARGDLSSRIEVHGKDELAQLLGSLRDMNTKLAQVVGQVRNTSESIATGSAQIAAGNTDLSSRTEQQAASLEETAASMEELTTTVKQNADNAEQGNVLATNASHIAQRGGAVVRQVVETMREISEGSARVSDITSVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLAQRSANAAKEIKELIDASTRQVSEGAKLVAEAGSTMDEVVHAVKRVTDLMAEIAAASTEQRTGIEQVNQAVMQMDTVTQQNAALVEEASAAAQSMAAQSGGLRELVSIFTLEGAANQGHRAQRLSA
>NZ_CP010518.4|WP_042116715.1|1933646_1934003_-|GFA-family-protein
MANQQYSGGCHCGDLRFTANIDLSKTIACNCSICKKRGLILAFSPIAEFSQTAGVGKAKEYLFNKHVIRHQFCPTCGVEAFAFGEMPDGAKMAAVNVRCIDDIDLATVHPAPFDGASK
>NZ_CP010518.4|WP_042116717.1|1934186_1936073_-|methyl-accepting-chemotaxis-protein
MTVSSLRTRIILIACATVIGALILSGITTYVIVRSSMMSTIANTLDAVARGNTLAVERWAAAKGQSVVGTAAAVEKGEQGVALTKLLGATNGFPISSIGWSDKSYFSSGPTPPDYDPTARPWYKGATGAGKLTVVKPYADIASGKLYVSFAAPILRDGQTLGAVSGAVPLDAVQEVVKAVHPTPSSLAFVVSRDGLVIAHPDEKLMLKQSSDLAPSLTPEALARLERATEPMEVDLSGAEKLLKVQPVPGTDWLFVVALDKAEATAGLSQVLSATIITLIVLTLCAIGIASFFTSQAFRRLSQVRDAMDTIGSGGGDLTRRLDVVGHDEVAQISRSFNAFVDKISTVMIDVRAGVHGMTSATSEIEMGNRDLSQRTEASAGTLQETSAALTELTASVKQTAEAAEHATRLANDASEAAARGGEVVTGAVTTMSEIAQSSERITEIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLAQRSAAAAQEIKTLIEASVQNVKSGTQRVQAAGNTMGDIVDGISRVRRLIGEIHSAMTEQSTGISQIDRSVAEMDQSTQQNAALVEESAAASAMLSEQARNLADTVALFQLREHSRHGETVVRSHSQGSRDPYRDEPAMAA
>NZ_CP010518.4|WP_042116719.1|1936487_1937198_-|GntR-family-transcriptional-regulator
MSSASASVSGTTGASGRRRLTAYQYAIETLRTEILQGKLKAGDRLRQDDLARRLEMSTTPVREALRTLVSEGLVFFDVHRGAVVRGLTIDDVNELYRLRKTLEPMMAEQAMATIREEDIARAQALHAEMLATTDVAKWTELNQAFHAALWASQDNSRLAHLIKTLRDASGPYIALSLYMRPVHVDVSNQEHQKMLDEYRARDVAATRRHTEDHLDATLRIIVKAIEQTEAEAAAND
>NZ_CP010518.4|WP_042116720.1|1937225_1938236_-|asparaginase
MSNSLPVVAVASLGGTISMTPSDAAGGVVPTLDATQLARSVPGLSEVATIKTTSLRQLPSASLGYGDLMDALTWAEQQVADGASGVVLTQGTDTLEETAFLLDLFWKLPAPLILTGAMRAPQAAGADGPANLLAAVRTAVHPDSIGRGVLVVMNDTAHYARWVSKGDALAVQAFVSLDGGVAARLVEGCPTFFHARQTRPQPLARPVRAWPKVAMVTAVLGDDGELAEMALKGGYEAVVIAAQGAGHVSFGFAERIGPLAAQVPVVIASRAAGGSTASRTYGYVGAEIDLARRGAHLCGWLSPLKARLLVTALLASGVAPGAVGDALANWSKLTRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

576217 : 589792

Burkholderia_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042118265.1\|576217_576430_-	helix-turn-helix domain-containing protein	Q6J1Q0	Burkholderia_virus	7.1e-07	51.9
WP_042115612.1\|576440_576692_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_045852665.1\|576776_579008_-	DNA methyltransferase	H9C171	Pectobacterium_phage	7.6e-115	39.0
WP_042115613.1\|579116_579614_-	single-stranded DNA-binding protein	I6NRL7	Burkholderia_virus	9.1e-45	78.1
WP_042115614.1\|579642_579876_-	hypothetical protein	W8JKF6	Salmonella_phage	1.0e-06	38.2
WP_156181612.1\|579872_580049_-	hypothetical protein	NA	NA	NA	NA
WP_042115615.1\|580053_580419_-	hypothetical protein	NA	NA	NA	NA
WP_042115616.1\|580423_580735_-	hypothetical protein	A0A0H5AW99	Pseudomonas_phage	9.8e-13	55.1
WP_042115617.1\|580727_581033_-	hypothetical protein	NA	NA	NA	NA
WP_042115618.1\|581047_581581_-	hypothetical protein	H2BDI1	Pseudomonas_virus	6.8e-22	36.7
WP_042115619.1\|581584_581899_-	hypothetical protein	NA	NA	NA	NA
WP_042118269.1\|581895_582870_-	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	9.3e-118	62.5
WP_042115620.1\|582862_583246_-	ASCH domain-containing protein	A0A291AUQ6	Sinorhizobium_phage	2.2e-30	50.4
WP_052765575.1\|583248_584028_-	hypothetical protein	NA	NA	NA	NA
WP_042115621.1\|584032_584242_-	hypothetical protein	NA	NA	NA	NA
WP_042115622.1\|584245_584503_-	hypothetical protein	NA	NA	NA	NA
WP_042115623.1\|584553_585384_-	DUF2303 family protein	A0A291AUR3	Sinorhizobium_phage	6.7e-16	27.9
WP_052765576.1\|585417_585774_-	hypothetical protein	I6NMK2	Burkholderia_virus	3.2e-07	34.7
WP_082118026.1\|585810_586491_-	DUF550 domain-containing protein	L7TI87	Pseudomonas_virus	1.5e-34	51.9
WP_042115624.1\|587105_587447_-	hypothetical protein	NA	NA	NA	NA
WP_042115625.1\|588142_589792_-	hypothetical protein	U6C712	Ralstonia_phage	1.9e-139	62.4

DBSCAN-SWA_2

593096 : 606052

Burkholderia_phage(23.08%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042115628.1\|593096_593360_-	hypothetical protein	Q6UYL7	Burkholderia_phage	1.0e-26	70.8
WP_156181613.1\|593364_593652_-	hypothetical protein	NA	NA	NA	NA
WP_042115630.1\|593975_594272_-	KTSC domain-containing protein	A9YWW2	Burkholderia_phage	3.3e-10	44.7
WP_042115631.1\|594930_595152_-	hypothetical protein	NA	NA	NA	NA
WP_042115632.1\|595156_595588_-	hypothetical protein	NA	NA	NA	NA
WP_052765578.1\|595631_596090_-	hypothetical protein	A0A2D1GNH0	Pseudomonas_phage	5.7e-09	48.6
WP_042115633.1\|596169_596448_+	helix-turn-helix domain-containing protein	D0UIL8	Aggregatibacter_phage	3.5e-14	56.8
WP_042115634.1\|596528_596987_+	hypothetical protein	NA	NA	NA	NA
WP_052765579.1\|596989_597382_+	hypothetical protein	NA	NA	NA	NA
WP_042115635.1\|597378_597885_+	hypothetical protein	A0A142KAC0	Gordonia_phage	1.2e-39	56.8
WP_109468934.1\|597871_599134_+	site-specific DNA-methyltransferase	Q8W6P4	Burkholderia_virus	7.9e-85	44.1
WP_052765580.1\|599126_600047_+	hypothetical protein	A0A0D4DBT2	Acinetobacter_phage	2.4e-51	64.2
WP_052765581.1\|600027_600831_+	ATP-binding protein	K7PLU3	Enterobacteria_phage	2.9e-40	34.4
WP_156181614.1\|600827_600977_+	hypothetical protein	NA	NA	NA	NA
WP_042115637.1\|600969_601167_+	hypothetical protein	NA	NA	NA	NA
WP_042115638.1\|601169_601643_+	DUF1367 family protein	A0A0M3LR84	Mannheimia_phage	5.8e-17	32.7
WP_042115639.1\|601642_601945_+	hypothetical protein	I6XGC2	Burkholderia_virus	1.6e-15	50.0
WP_042115640.1\|601935_602166_+	hypothetical protein	NA	NA	NA	NA
WP_042118287.1\|602309_602612_+	phage related protein gp8	Q3HQZ9	Burkholderia_phage	3.5e-23	55.2
WP_042115641.1\|602614_603241_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052765582.1\|603264_604470_+\|terminase	terminase small subunit	I6NV32	Burkholderia_virus	8.7e-41	44.4
WP_042115642.1\|604477_606052_+	DEAD/DEAH box helicase family protein	A0A1L6BXZ8	Clostridium_phage	8.2e-23	23.4

DBSCAN-SWA_3

1298804 : 1378573

Pseudomonas_phage(28.57%)

integrase,terminase,transposase,head,tail,plate,coat

attL 1309641:1309655|attR 1343383:1343397

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042116097.1\|1298804_1299851_-\|plate	phage baseplate assembly protein	A0A2I7S9E5	Vibrio_phage	1.9e-07	27.5
WP_042116098.1\|1299847_1300255_-	hypothetical protein	NA	NA	NA	NA
WP_052765631.1\|1300256_1300835_-\|plate	phage baseplate assembly protein V	A0A192Y8K5	Salmonella_phage	8.2e-13	36.3
WP_042116100.1\|1300831_1301887_-\|tail	phage tail protein	NA	NA	NA	NA
WP_042116101.1\|1301879_1303115_-	phage FluMu DNA circulation protein	NA	NA	NA	NA
WP_042116103.1\|1303114_1305250_-\|tail	phage tail length tape measure protein	A0A0M3LPB6	Mannheimia_phage	2.9e-63	37.2
WP_042116106.1\|1305481_1305805_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_042116107.1\|1305819_1306182_-\|tail	phage tail tube protein	NA	NA	NA	NA
WP_042116109.1\|1306232_1307705_-\|tail	phage tail sheath protein	A0A2P9JZJ8	Alteromonadaceae_phage	1.2e-57	32.4
WP_042116111.1\|1307701_1308181_-	hypothetical protein	NA	NA	NA	NA
WP_042116112.1\|1308177_1308672_-	DUF1320 family protein	NA	NA	NA	NA
WP_052765632.1\|1308671_1309154_-	hypothetical protein	NA	NA	NA	NA
WP_042116113.1\|1309239_1310142_-\|head	phage head protein	H6V827	Pseudomonas_virus	2.4e-59	42.2
1309641:1309655	attL	NA	NA	NA	NA
WP_042116115.1\|1310195_1311188_-	hypothetical protein	A0A2D1GNS3	Pseudomonas_phage	7.2e-33	32.8
WP_042118577.1\|1311418_1311856_-	DNA-binding protein	NA	NA	NA	NA
WP_042116118.1\|1311883_1312339_-	DUF1018 domain-containing protein	NA	NA	NA	NA
WP_042116120.1\|1312341_1313043_-	DUF2786 domain-containing protein	A0A2H4JCP9	uncultured_Caudovirales_phage	4.0e-30	40.4
WP_042116121.1\|1313129_1313405_-	HU family DNA-binding protein	NA	NA	NA	NA
WP_042116123.1\|1313472_1313874_-	ASCH domain-containing protein	B5TA86	Burkholderia_phage	1.1e-53	76.9
WP_042116125.1\|1313882_1314509_-	DUF3164 family protein	B5TA85	Burkholderia_phage	4.7e-99	89.4
WP_042116126.1\|1314508_1315090_-	hypothetical protein	B5TA84	Burkholderia_phage	2.7e-64	72.0
WP_109468904.1\|1315360_1315558_-	hypothetical protein	NA	NA	NA	NA
WP_042116128.1\|1315572_1316523_-	AAA family ATPase	B5TA81	Burkholderia_phage	1.2e-61	41.6
WP_042116130.1\|1316536_1318216_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	B5TA80	Burkholderia_phage	2.8e-90	36.6
WP_042116132.1\|1318218_1319388_-	hypothetical protein	J9RW58	Pseudomonas_phage	6.4e-49	67.3
WP_042116134.1\|1319396_1319576_-	DNA-binding protein	NA	NA	NA	NA
WP_150728747.1\|1319634_1320009_+	helix-turn-helix domain-containing protein	A4JWR8	Burkholderia_virus	1.9e-10	46.2
WP_047827190.1\|1320074_1320485_+	hypothetical protein	NA	NA	NA	NA
WP_042116139.1\|1320569_1320923_+	membrane protein	Q6QIC8	Burkholderia_phage	4.2e-28	63.1
WP_052765635.1\|1320925_1321576_+	lytic transglycosylase domain-containing protein	Q5ZQZ1	Pseudomonas_phage	1.5e-34	43.8
WP_052765636.1\|1321572_1322070_+	hypothetical protein	NA	NA	NA	NA
WP_042116140.1\|1322066_1322444_+	hypothetical protein	NA	NA	NA	NA
WP_042116142.1\|1322447_1322948_+	DUF1804 family protein	F6MIK6	Haemophilus_phage	2.4e-08	36.5
WP_042116144.1\|1322934_1324608_+\|terminase	phage terminase large subunit	A0A125RNB9	Pseudomonas_phage	1.4e-158	53.3
WP_042116145.1\|1324600_1326154_+	DUF935 family protein	J9SVY0	Pseudomonas_phage	2.1e-87	39.5
WP_042116147.1\|1326150_1326396_+	hypothetical protein	NA	NA	NA	NA
WP_042116149.1\|1326392_1327673_+	hypothetical protein	J9STS2	Pseudomonas_phage	8.0e-77	40.7
WP_042116150.1\|1327758_1328343_+\|tail	phage tail protein	NA	NA	NA	NA
WP_042116152.1\|1330968_1331745_-	P-loop NTPase	NA	NA	NA	NA
WP_162597680.1\|1331822_1335704_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109468940.1\|1335688_1336873_-	cellulase	NA	NA	NA	NA
WP_052765639.1\|1336915_1339279_-	cellulose biosynthesis cyclic di-GMP-binding regulatory protein BcsB	NA	NA	NA	NA
WP_124988600.1\|1339567_1339834_+	hypothetical protein	NA	NA	NA	NA
WP_042116154.1\|1339840_1340494_+	HAD-IB family hydrolase	NA	NA	NA	NA
WP_107338199.1\|1341020_1342493_+	FUSC family protein	NA	NA	NA	NA
WP_042116158.1\|1342713_1343877_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
1343383:1343397	attR	NA	NA	NA	NA
WP_082117919.1\|1344007_1345297_-	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_042116160.1\|1345610_1346348_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_042116161.1\|1346400_1346592_-	DUF2964 family protein	NA	NA	NA	NA
WP_042116162.1\|1346762_1346972_-	DUF2964 domain-containing protein	NA	NA	NA	NA
WP_042118598.1\|1347145_1347448_-	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_042116164.1\|1347650_1348217_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_042118600.1\|1348287_1349646_-	N-succinylarginine dihydrolase	NA	NA	NA	NA
WP_042118603.1\|1349695_1351177_-	succinylglutamate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_052765641.1\|1351387_1352452_+	succinylglutamate desuccinylase	NA	NA	NA	NA
WP_042116166.1\|1352824_1354603_+	hypothetical protein	NA	NA	NA	NA
WP_042116168.1\|1356423_1357698_-	fumarylacetoacetase	NA	NA	NA	NA
WP_042116169.1\|1357798_1359118_-	homogentisate 1,2-dioxygenase	NA	NA	NA	NA
WP_042116170.1\|1359231_1360137_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_042116171.1\|1360162_1363528_-	response regulator	A0A1V0SGX0	Hokovirus	3.6e-28	34.4
WP_039365914.1\|1363572_1364247_-	response regulator transcription factor	NA	NA	NA	NA
WP_156181634.1\|1364465_1365035_-	hypothetical protein	NA	NA	NA	NA
WP_042118611.1\|1365443_1366265_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_052765642.1\|1366553_1367843_-	CoA transferase	NA	NA	NA	NA
WP_042116173.1\|1368098_1369076_-	magnesium/cobalt transporter CorA	NA	NA	NA	NA
WP_042116174.1\|1369150_1371856_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042116175.1\|1371998_1372484_-	DNA starvation/stationary phase protection protein Dps	NA	NA	NA	NA
WP_042116177.1\|1372604_1373177_-	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_082117921.1\|1373740_1374274_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_042116180.1\|1374289_1375048_+	molecular chaperone	NA	NA	NA	NA
WP_162597681.1\|1375166_1377599_+	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_042116183.1\|1377595_1378573_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage