CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP014583	Winogradskyella sp. PG-2	1 crisprs	WYL,DEDDh,csa3	0	2	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014583_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014583_1

3137036-3137235

Orphan

Consensus_repeat	Method
AATATCACCAGAACCAGCTATAG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_AP014583_1

>merge|NZ_AP014583|1|3137036-3137235|CRISPRCasFinder
AAAGTCTCCTGAACCAGCAATCTTAGTTGTTAATTTTTTTGCTGAACCCTTTAATACAATATCACCAGAACCAGCTATAGCGCTTTCTATAGTTTTGGCAGCTACATTTAAATTAATATCACCAGAACCAGCTATAGATACGTCAAAGTCATCTGCTTTAATTGTACCAGTATTCATTATGTCACCAGATCGTGCAAGAG

>NZ_AP014583|1|1|3137036-3137235|CRISPRCasFinder
AAAGTCTCCTGAACCAGCAATCT	TAGTTGTTAATTTTTTTGCTGAACCCTTTAATAC
AATATCACCAGAACCAGCTATAG	CGCTTTCTATAGTTTTGGCAGCTACATTTAAATT
AATATCACCAGAACCAGCTATAG	ATACGTCAAAGTCATCTGCTTTAATTGTACCAGTATTCAT
TATGTCACCAGATCGTGCAAGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014583.1\|WP_144374485.1\|3135671_3136595_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014583.1\|WP_045473848.1\|3127139_3128771_+\|trehalose-synthase	unknown	unknown	gnl\|CDD\|274141
NZ_AP014583.1\|WP_045473859.1\|3137624_3138713_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014583.1\|WP_045473874.1\|3145083_3145461_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|236880
NZ_AP014583.1\|WP_045473854.1\|3134289_3135624_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341035
NZ_AP014583.1\|WP_045473846.1\|3125199_3127137_+\|alpha-1,4-glucan--maltose-1-phosphate-maltosyltransferase	unknown	unknown	gnl\|CDD\|200482
NZ_AP014583.1\|WP_045473870.1\|3143300_3144332_+\|type-IX-secretion-system-protein-PorQ	unknown	unknown	unknown
NZ_AP014583.1\|WP_045473862.1\|3138690_3139254_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014583.1\|WP_045473852.1\|3130896_3133317_+\|DUF4968-domain-containing-protein	unknown	unknown	gnl\|CDD\|376446
NZ_AP014583.1\|WP_045473866.1\|3140046_3142500_+\|endopeptidase-La	unknown	unknown	gnl\|CDD\|223542
NZ_AP014583.1\|WP_045473844.1\|3123806_3125075_+\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179486
NZ_AP014583.1\|WP_045473872.1\|3144349_3145039_+\|(d)CMP-kinase	unknown	unknown	gnl\|CDD\|234579
NZ_AP014583.1\|WP_045473876.1\|3145627_3146044_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014583.1\|WP_171817189.1\|3133393_3134221_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NZ_AP014583.1\|WP_045473850.1\|3128774_3130685_+\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445
NZ_AP014583.1\|WP_045473864.1\|3139265_3139817_-\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_AP014583.1\|WP_045473868.1\|3142483_3143227_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|180536
NZ_AP014583.1\|WP_045473878.1\|3146301_3148143_+\|30S-ribosomal-protein-S1	unknown	unknown	gnl\|CDD\|235775
NZ_AP014583.1\|WP_045473841.1\|3121918_3122404_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|376583
NZ_AP014583.1\|WP_045473843.1\|3122598_3123810_+\|glycogen-synthase	unknown	unknown	gnl\|CDD\|273997

Protein	Function_ID	Function_description	E-value
NZ_AP014583.1\|WP_045473848.1\|3127139_3128771_+\|trehalose-synthase	gnl\|CDD\|274141	TIGR02457, trehalose_synthase, trehalose synthase-fused probable maltokinase. Three pathways for the biosynthesis of trehalose, an osmoprotectant that in some species is also a precursor of certain cell wall glycolipids. Trehalose synthase, TreS, can interconvert maltose and trehalose, but while the equilibrium may favor trehalose, physiological concentrations of trehalose may be much greater than that of maltose and TreS may act largely in its degradation. This model describes a domain found only as a C-terminal fusion to TreS proteins. The most closely related proteins outside this family, Pep2 of Streptomyces coelicolor and Mak1 of Actinoplanes missouriensis, have known maltokinase activity. We suggest this domain acts as a maltokinase and helps drive conversion of trehalose to maltose. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	1.01384e-86
NZ_AP014583.1\|WP_045473874.1\|3145083_3145461_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|236880	PRK11198, PRK11198, LysM domain/BON superfamily protein; Provisional.	1.40318e-21
NZ_AP014583.1\|WP_045473854.1\|3134289_3135624_+\|MFS-transporter	gnl\|CDD\|341035	cd17482, MFS_YxiO_like, Bacillus subtilis YxiO, Listeria monocytogenes BtlA, and similar transporters of the Major Facilitator Superfamily. This family is composed of Bacillus subtilis MFS-type transporter YxiO, and similar proteins including Listeria monocytogenes BtlA. The function of B. subtilis YxiO is still unknown, and L. monocytogenes BtlA is a putative secondary transporter involved in bile tolerance and general stress resistance. This family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.79178e-105
NZ_AP014583.1\|WP_045473864.1\|3139265_3139817_-\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	1.27136e-29
NZ_AP014583.1\|WP_045473872.1\|3144349_3145039_+\|(d)CMP-kinase	gnl\|CDD\|234579	PRK00023, cmk, (d)CMP kinase.	2.65245e-110
NZ_AP014583.1\|WP_045473852.1\|3130896_3133317_+\|DUF4968-domain-containing-protein	gnl\|CDD\|376446	pfam01055, Glyco_hydro_31, Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.	0
NZ_AP014583.1\|WP_045473841.1\|3121918_3122404_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|376583	pfam01641, SelR, SelR domain. Methionine sulfoxide reduction is an important process, by which cells regulate biological processes and cope with oxidative stress. MsrA, a protein involved in the reduction of methionine sulfoxides in proteins, has been known for four decades and has been extensively characterized with respect to structure and function. However, recent studies revealed that MsrA is only specific for methionine-S-sulfoxides. Because oxidized methionines occur in a mixture of R and S isomers in vivo, it was unclear how stereo-specific MsrA could be responsible for the reduction of all protein methionine sulfoxides. It appears that a second methionine sulfoxide reductase, SelR, evolved that is specific for methionine-R-sulfoxides, the activity that is different but complementary to that of MsrA. Thus, these proteins, working together, could reduce both stereoisomers of methionine sulfoxide. This domain is found both in SelR proteins and fused with the peptide methionine sulfoxide reductase enzymatic domain pfam01625. The domain has two conserved cysteine and histidines. The domain binds both selenium and zinc. The final cysteine is found to be replaced by the rare amino acid selenocysteine in some members of the family. This family has methionine-R-sulfoxide reductase activity.	6.07463e-77
NZ_AP014583.1\|WP_045473844.1\|3123806_3125075_+\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179486	PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_AP014583.1\|WP_045473846.1\|3125199_3127137_+\|alpha-1,4-glucan--maltose-1-phosphate-maltosyltransferase	gnl\|CDD\|200482	cd11344, AmyAc_GlgE_like, Alpha amylase catalytic domain found in GlgE-like proteins. GlgE is a (1,4)-a-D-glucan:phosphate a-D-maltosyltransferase, involved in a-glucan biosynthesis in bacteria. It is also an anti-tuberculosis drug target. GlgE isoform I from Streptomyces coelicolor has the same catalytic and very similar kinetic properties to GlgE from Mycobacterium tuberculosis. GlgE from Streptomyces coelicolor forms a homodimer with each subunit comprising five domains (A, B, C, N, and S) and 2 inserts. Domain A is a catalytic alpha-amylase-type domain that along with domain N, which has a beta-sandwich fold and forms the core of the dimer interface, binds cyclodextrins. Domain A, B, and the 2 inserts define a well conserved donor pocket that binds maltose. Cyclodextrins competitively inhibit the binding of maltooligosaccharides to the S. coelicolor enzyme, indicating that the hydrophobic patch overlaps with the acceptor binding site. This is not the case in M. tuberculosis GlgE because cyclodextrins do not inhibit this enzyme, despite acceptor length specificity being conserved. Domain C is hypothesized to help stabilize domain A and could be involved in substrate binding. Domain S is a helix bundle that is inserted within the N domain and it plays a role in the dimer interface and interacts directly with domain B. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_AP014583.1\|WP_171817189.1\|3133393_3134221_+\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	2.77664e-77
NZ_AP014583.1\|WP_045473850.1\|3128774_3130685_+\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
NZ_AP014583.1\|WP_045473868.1\|3142483_3143227_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|180536	PRK06347, PRK06347, 1,4-beta-N-acetylmuramoylhydrolase.	6.82208e-21
NZ_AP014583.1\|WP_045473878.1\|3146301_3148143_+\|30S-ribosomal-protein-S1	gnl\|CDD\|235775	PRK06299, rpsA, 30S ribosomal protein S1; Reviewed.	0
NZ_AP014583.1\|WP_045473866.1\|3140046_3142500_+\|endopeptidase-La	gnl\|CDD\|223542	COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones].	0
NZ_AP014583.1\|WP_045473843.1\|3122598_3123810_+\|glycogen-synthase	gnl\|CDD\|273997	TIGR02149, glgA_Coryne, glycogen synthase, Corynebacterium family. This model describes Corynebacterium glutamicum GlgA and closely related proteins in several other species. This enzyme is required for glycogen biosynthesis and appears to replace the distantly related TIGR02095 family of ADP-glucose type glycogen synthase in Corynebacterium glutamicum, Mycobacterium tuberculosis, Bifidobacterium longum, and Streptomyces coelicolor. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0

>NZ_AP014583.1|WP_144374485.1|3135671_3136595_+|hypothetical-protein
MMKKILVLCLFIALILLVNCGNEPYEGDLPTRDNPCELAIEATANAAEDFSAATEDQYNLLCSVYKDALQDQISLCGDPDGLLQNIIDELGDCVLENPLCDDAIAATEVARQNYLLASDSDTEALCNAYKDALEYQIEVCGDDGTLRAILDELGDCEPVFVETVGTWRLEAWLTDQARDIDNDGEVTNDYLEDIDCYTNETITFYSDGTGVLYLRSVADITYTPIDGSPNEEDFFVTCNAISIDRPFNWVQIGNNTLIFTMEDGSIVNYFRNSNSLFIAIDNAFSATSTVDGVSQINERITYVYVKL
>NZ_AP014583.1|WP_045473854.1|3134289_3135624_+|MFS-transporter
MSELKKGSKKLLHAWAFYDWANSVYPLVISSAVFPIFYGALTIIKDEETGKVLNDTVNFLGYQFNNDSLISYVTAFSFLIVSILSPILSGISDYVGNKESFMKFFCYLGASACIGLYWFSLDNLLFGMVCYVLGLVGFWGSLVFYNSYLPDIAFPEQQDKVSAKGFSLGYIGSVLLLLINLVMILKFEWFGFETEAQPTRIAFIMVGVWWVLFAQYTFKHLPTGTNEGHKVTKTVLMSGFNELKKIWLALKSNKILKTYLSAFFVYSMAVQTIMLAATYFAVEELDWGTQDSTTGLIISILLIQLIAVIGANYTAKLSKKIGNIKALICVICIWILICGFAYFVKTPTHFYITAATVGLVMGGIQALSRSTYSKLIPFGSEDTASYFSFYDVAEKIGLVIGLFLYGFVASITGSMRYSILFLITFFVVGLLILNTIRNVKIDQS
>NZ_AP014583.1|WP_171817189.1|3133393_3134221_+|M48-family-metallopeptidase
MKLKKVILSLGILAVILSCATNPFTGKKTLAFVSNDQLFPSAFAQYNQVLSENKVIKGTKDAEMITRVGQRIAVAAERWLNANGHQSYLDDYQWEYTLIESEQVNAWCMPGGKIAFYTGILPIAQNETGVAAIMGHEVIHALANHGQQRMSAAYLQQGLAEAGNVALANDQKALGIFNQSFGIVSNVAGMLPFSRAHETEADRVGLLIMAIAGYNPDEGAELWKRMKANSGGQAPPEFLSTHPSNDTRITNLQAMAPTAQAEAKKFGVTSFRPIN
>NZ_AP014583.1|WP_045473852.1|3130896_3133317_+|DUF4968-domain-containing-protein
MIVNTELENKGNLFPSKLIDFKKDVDKLYFTADNDVILQLTVVRDSLLRFRYTTVGNFDNDFSYAITKYASIGYNKLEIEEKKDRYEITTSKLRCEISKESMRVAIYDVIDGKLINQDETGFHWEESYQYGGNVVKMSKVSNDGESYYGLGDKPNHLNLKGKRYNNWVTDSYAYGKDTDPIYKAIPFYTGLHHGKAYGIFFDNTFRTSFDFAHERRNVTSFWSQGGEMNYYFFYGPKMNDVVESYTDLTGKPHHLPPLWALGFHQCKWSYYPESKVKEITSTFRKLKIPCDAIYLDIDYMDGFRCFTWNKDYFPDPKRMVKELSEDGFKTVAIIDPGIKIDKDYSVFKEALEKDYFCKRADGDYMKGKVWPGECYFPDFTNPEVRDWWSGLFQELIEDIGIKGVWNDMNEPAVMEVPNKTFPDDVRHDYDGNPCSHRKAHNIYGMQMARATYQGLKKYSYPKRPFVITRSAYSGTQRYTSTWTGDNVATWEHLWIANIQAQRMAMSGFSFAGSDIGGFAEQPQGELFTRWVQLGVFHPFFRVHSSGDHGDQEPWAFDEDVTDIVRKFIEIRYQLLPYLYTAFWNYADHGTPLLKSLVLFDQDDVQTHYRTDEFIFGEQILACPVLEPNAKGRRMYIPKGNWYNFWTDEVLKGGREMWIDADIDSMPIFVKEGAIIPKYPIQQYVGEKEIKEITLDVYYKKGKEESELFSDANDGFDYTKGRYSLRNFMLTGRKNELIINQHKEGKFITPYETFKVQIHGLPFEIGEVQIDNETISLKHLKSNGTISFVVDKNFSELHIIGKASKSK
>NZ_AP014583.1|WP_045473850.1|3128774_3130685_+|1,4-alpha-glucan-branching-protein-GlgB
MAEVIAHSRFTDFDVNLFKAGKHYRLYEKFGSHITTVDGVEGVYFAVWAPSAKMVSVIGDFNFWVEGEHKLNVRWDSSGIWEGFIPGAGKGSKYKYKIQSNHNDIKTEKADPYARRAEHNPKTASIVWDEPYSWKDSIWMKKRKKHNALDAPYSVYEVHLGSWKKKIEENRFLSYKEMTDELVAYVKDMNFTHVELMPVMEFPYDPSWGYQLTGYFAPTSRFGYPEEFKLLVDKLHQNDIGIILDWVPSHFPEDAHGLGFFDGSALYEHPDPKKGYHQDWKSLIFNYGRNEVKSFLISNAIFWLDQFHVDGLRVDAVASMLFLDYSREDGEWEPNMFGGRENLEAMSFLREMNEAVYSSFPDVQTIAEESTAFPMVSKPTSIGGLGFGMKWMMGWMHDTLQYFAKEPIYRKHHQNDLTFSMTYAFTENFMLPLSHDEVVYGKRSILGRMPGDEWQRFANLRLLYSYMFTHPGTNLLFQGAEFGQSEEWNFEQSLDWHLLQYNPHKGVQELVRDLNALYKKEPALHEKQFSGEGFEWIDYNDAENSVFTYIRKGNNEEDDVIIACNMTPVPKENYKLGLPRKGKLKEIFNSDLKKYFGSGEFKNKIKTSKADAWHFRDDSIEVTIPPLGMVVFKYSK
>NZ_AP014583.1|WP_045473848.1|3127139_3128771_+|trehalose-synthase
MSKKNSQAVNLKQPYNFDIRWEELMENEDFVDIFLSDVLEQYIVKQRWYGGKSSKLKYVELAEYFRIQQNEEVYYGLILEVNFVEAFYQHYFLPIAFVSDENFAKDDRILPISIQNQKGFIIDAINLEAFRRVVFERILSAVPKDRTRVQYKKSSLFKDSKYESSRFMGMEQSNTSIVYNDKFVLKFFRRIYADRNPDYEMSRFLSEKKDFKNTPAYLGSMQIKDHENTNITIALMNEMVPNDGDAWDYMLKELHKVFSNLEYKSIDIGQLPHTETFVRLDIRDIPPQIIDWVGLNVFTKIQQLAKRTAEMHIALGSEFEDTAFTPTRFNGDYTVWLKNRLLYQFQNRLNAVENNLHKLDGLALELANVFLDKKNDIRKRFVDFDWTKLKGERLRVHGDYHLGQILVKDDDFYILDFEGEPESTIRDRKVKQPPLKDVAGLFRSFHYAIYATIFNNLDNYKHTQTELFEAGEILYQYFIGLFLGTYVVEIQNANINIGYQQERIFLLKYSLLEKAVYELGYELNSRPRWAVIPLKGISNIINN
>NZ_AP014583.1|WP_045473846.1|3125199_3127137_+|alpha-1,4-glucan--maltose-1-phosphate-maltosyltransferase
MQNQRRVVIDAVSPQINGGEFFIKRVLNEIINVDANVLVDGHDVIAASVLYKHEKAKKWNEVRMDDIGNDEWKSSFTVEKQGFYAYKVQGWVDYALNWQHGIERKIDDNQHVKSELLEGITFLKPLLKKTIKQEKDYLEYCIDCFEDDNKYDDAIKEAVSSKLHNVFVKYPEKHLSNETQEFQVYVDRKKARFSTWYEFFPRSASEIDGQHGTFKDCERLLPRVAQMGFDTLYFPPVHPIGEINRKGRNNTTEAKDNDAGSAWGIGSKHGGHKDLHPELGSIKDFKALIKKAKDLNIEIAMDYALQAAPDHPWVESNPDWFKWRPDGTVQYAENPPKKYQDILPIYWESKDYKNLWKECLDTIIYWIDCGINVFRVDNPHTKPYYFWNWLIAEVKKKYPDVLFLAEAFTKPKVMQQLAKQGYTQSYTYFTWRDSKHELIEYVTELTQTDQREYMQPNFWPNTPDINPYHLQGANESKYLQRYALAATLSSSIGIYGPVFEQMIDDAIPGKEEYYMSEKFEVKHYDWFIENKLTLLISKINTLRNQNEALQQTNNIKFCDIHNDNLLAFYKWNDDKTNELLIIISLDQYYAQKGNVQLPIGDIGVHAGQSIQVEDLITGSSYNWYDEWNYVELHPTLPFHIFKINK
>NZ_AP014583.1|WP_045473844.1|3123806_3125075_+|glucose-1-phosphate-adenylyltransferase
MINDKVLSIILGGGQGSRLYPLTESRSKPAVPIAGKYRLVDIPISNCINSDIKRMFVLTQFNSASLNKHIKNTYHFSFFSSAFVDVLAAEQTIASDKWFQGTADAVRQSMHHFLRHDFEYALILSGDQLYQMDFNEMIQAHEDSGAEISIATYPVNAKDATSFGIMKTDEKNIIKTFIEKPDTSLLPDWTSNVSDEMKNNGRHYLASMGIYIFNRDLLVKLMKDDGTVDFGKEIIPGAIKKHKTLSYQYEGYWTDIGNIDSFFEANLGLTDPIPQFNLYDNDQRIYTNARILPTSKISGTLCDRTVIADGCLIHAAKIERSVIGIRSRIGAESTVINCYMMGNSHYESLDDVQAQKVKTFMGIGERCFIKNAILDKNCRIGDDVRINGGVKLKDKETDTYFVKDGIVVVKKDAHIPSGTIIQ
>NZ_AP014583.1|WP_045473843.1|3122598_3123810_+|glycogen-synthase
MKALFFTREFPPYVYGGAGVHVEYLASELSKLMEMEVRAFGDQDITNNSMSVKGFPYENSAFDNANDKLKAVFKTLSTGLSMTSDEIDADIVHCHTWYSHFAGIMAKLCYGTPLVVTTHSLEPLRPWKREQLGRGYDASSWVEKTAIEMADCLIAVSEETKEDVLKHFNVDENKIEVVYNGIDLKEYVVVNETNVLDEYAIDKNKPYVLFVGRITRQKGIIHLVNAIKYIDGNTQVILCAGAPDTPKIAKEMEDAVAEASKTRNNIVWIDKMLDKKDVIQLYSHADVFCCPSIYEPFGIINIEAMACETAVVASAVGGIKEVVVDGETGLLINLEQQTSAPFEPVNPDEFSKDLAEGVNKVINDKKLQNKMAKNGRKRVEEFFDWTAIAKQTEAIYKSLIDKK
>NZ_AP014583.1|WP_045473841.1|3121918_3122404_-|peptide-methionine-(R)-S-oxide-reductase-MsrB
MKKLVLVTLISFFFSCNSSAQKTGTKEKETFPITKTEAEWKEQLTDKQYYVLRKAGTERPFSSKLNKNYKKGVYHCAACDTPLFKSEHKFDSGTGWPSFDREIEGNVAYGTDNNLGYSRDEEHCATCGGHLGHVFNDGPRETTGKRHCINGVALKFVPSEG
>NZ_AP014583.1|WP_045473859.1|3137624_3138713_-|hypothetical-protein
MILKIQYRLALLLLVIPFLTFANTDLIVAKTSKERNIKKSFNVSSDATLKVTNSFGNLNIITWDENRIEFNITIKISGNDEEKVQDRLNGIDVEFSSSNDLVSAITKIEKNKKNWWNWGKKMNLKMEIDYVIKMPMTNNVDLNNKFGSINLDRLKGSSKIRCDHGKITTKELMSNNNVINFNHTRNSYFEYIKEGKISANHSGFTITKAEKINLSANHTRSIVEFAENIDYNCNHGSLKVDNINNLDGKGNHLTTRIGNVFKNLKLRGSHVSLKIERLASKANSIDIDTRFTSMTIGYDAGFNFNFDFDFSHGSLRDSQGFNFTNKHTDYTSKAYEGYYGSQDSGNMVKIKSQHGSVSFKRQ
>NZ_AP014583.1|WP_045473862.1|3138690_3139254_-|hypothetical-protein
MQKDTIDELFDNLKDEFDVNEPSQGHELRFLDRLKANDVVVNDSKSSSRFNWRPFLAIAASVVICLSVFMTLQNEPETLDLASVSPELAETQDFFTATIENELKKLNNERSPLTEQIITDALEQIKLLESEYQKLKTNLTEIGNDQRVIYAMITNFQNRIDILNIVLEEIETIKNLKTNTNDTKNTI
>NZ_AP014583.1|WP_045473864.1|3139265_3139817_-|RNA-polymerase-sigma-factor
MTSTNQNIEQLLLHCKSGNQRAQLEVYNRYNKAMYNTAIRIVKDSFKAEDIMQESFLTAFTKLNTLQDTKVFGSWLKRIVVNNSIAHYNKTSKQNKVPLDNLLYKVEDDTGIEESNHNNEKVKQIMNVMKTLKPNYSLGLSLHLIEGYDYEEICDIMDISYANCRTMISRAKESLRKKLMQTA
>NZ_AP014583.1|WP_045473866.1|3140046_3142500_+|endopeptidase-La
MGKSNFISLDSLSFQDFNENSELIPLMTPEDEELINNESLPESLPILSLRNTVLFPGVVIPITAGRDASIKLINDANKGGKVIGVVSQKDESVENPTAKDIYKIGTVARILKVLKMPDGNTTVVIQGKKRFQIKEVISEKPYLTATISDISEAKPAKDNEEFKAIIDSIKDLSLEIIKESPNIPSEASFAIKNIESNSFLVNFVSSNMNLKVEEKQELLKINDLKERALQTLKFMNMEYQKLELKNDIQNKVQSDMNQQQREYFLHQQMKTIQEELGGGVSSSEEIEEMKTRSKAKKWDDKVKVHFDKELSKMQRMNPQVAEYSIQRNYLDLFLDLPWNEFSKDKFDLKRAMKILDRDHFGLDDVKRRIIEYLAVLKLRNDMKSPILCLYGPPGVGKTSLGKSIAEALGREYVRISLGGLRDESEIRGHRKTYIGAMPGRIIQSLKKAQTSNPVFVLDEIDKLSTGNQGDPSSAMLEVLDPEQNSEFYDNFLEMGYDLSKVMFVATANSLNTIQPALRDRMEIINVTGYTIEEKVEIAKRHLLPKQLKEHGLDSKHLKIAKPQLEKIVEGYTRESGVRGLEKQIAKMVRYAAKNIAMEEKYNIKISNDDVIEVLGSPRLERDKYENNNVAGVVTGLAWTRVGGDILFIESILSKGKGSLTITGNLGKVMKESATIAMEYIKANTDEFGIKPEVFDKYNVHIHVPEGATPKDGPSAGVTMLTSLVSLFTQRKVKKSLAMTGEITLRGKVLPVGGIKEKILAAKRARIKEILLCEDNKRDIDEIKPEYLKGLTFHYVTDMSDVLKLALTNQKVKNAKKL
>NZ_AP014583.1|WP_045473868.1|3142483_3143227_+|LysM-peptidoglycan-binding-domain-containing-protein
MQKNYKLIFSIIALAISSLFAFAQSEIEYKDVILDGKPAKLNIATGEITLVNLEEKKADTSNVVKAIIPKQEISSDASDFYVVKQGETLYQIANRFETSLTQLKKVNNLETTIIDKGQKLVVKNFDLHIVPESKSKPINTANKNISNFHIVERGETLFGLAMRYNLTVNELKSKNSLNTDLIKVGQKLRVRDFGLSNDKADISVCTVAKGDTLYSIAKKSGTSVKALKKLNRLTNDMLMIGQILQLK
>NZ_AP014583.1|WP_045473870.1|3143300_3144332_+|type-IX-secretion-system-protein-PorQ
MIKRVTNLFFLLLALPLFAQLGGESTYQFLNLVSSPRQAALGGKIITNFDHDVTEGLYNPASINWEMGNQLAVNYSNYLGGISYGTAAYAYTWDRHVQTFHIGVSYINYGTFDGYDVNGNSTGTFNGNEAALSAAYNYNIPFTDFYVGAAVKLITSSLEQYNSFGGALDFGAMYINEDLDFHAAITVRNLGTQFTTYAGQNEPLPFEVNFGMSQTLENVPLRWHLTLENLQKWPIGVSNPARATTDLDGNQTQEKVSFFNKGLRHLILGAELFPEGGFNIRLGYNFRRAEELRILDQRNFSGLSVGVGIKLNKMRFSYTHARYTSASNTSFFGLQIDLDSRRR
>NZ_AP014583.1|WP_045473872.1|3144349_3145039_+|(d)CMP-kinase
MNKIIIAIDGFSSTGKSTIAKQLAIKLNYIYVDTGAMYRAVTYFALENDFIGDDFFHSKKLIQNLDKVSITFRFNDIKGFAEVYLNGINIESDIRTLRVSQFVSPVATLSEVRRMLVKQQQLMGQYKGIVMDGRDIGTVVFPEAELKIFMTASAETRAKRRYKELLERGHNLNYEDVLENVTTRDRIDSTREDSPLVKANDAIEIDNSELTIEEQLDTIINLASHNISK
>NZ_AP014583.1|WP_045473874.1|3145083_3145461_-|LysM-peptidoglycan-binding-domain-containing-protein
MVRAKYQGVLDLGEKLNIQNGDVSEDNGVLKVTGTAATQYEKNLLWDAIKVAGGDNPSDIMANIKVADETVYAIHTVASGETLGKIAKHYYGDAMKYKEIFAANTDILKNPDLIHPDQELVIPNL
>NZ_AP014583.1|WP_045473876.1|3145627_3146044_-|hypothetical-protein
MKKHFFLSVLLGFLIISCSKDDDTSPNNPLVDIEILGEWDISARGVNNISSLEVICCHTLSFYEDADNRDFKGTYVSNDSGFITSGSFIIDNNIISYTTDLDNTYMLEFSIENNVLEVWSIDEDNGDRNWSQYLRVIE
>NZ_AP014583.1|WP_045473878.1|3146301_3148143_+|30S-ribosomal-protein-S1
MAEKKTKEAEVAVEATEAVTVEAPVVSEAQANPEKFLKEFDWHNYEEGIEQVEDTKLEEFEKLVSENFVDTLDDEVVDGTVITITDRDAIIDINAKSEGVISLNEFRYNPDLKVGDKVEVLIDVREDATGQLVLSHRKARVIKAWDRVNNAHDTGEIVNGFVKCRTKGGMIVDVFGIEAFLPGSQIDVKPIRDYDQYVNKTMEFKVVKINHEFKNIVVSHKALIEADIEEQKKEIIGQLEKGQVLEGIVKNITSYGVFIDLGGVDGLVHITDLSWSRINHPNEIVELDQKLNVVILDFDENKSRIQLGLKQLSKHPWEALGEDVKIGDKVKGKVVVIADYGAFIEVEEGVEGLVHVSEMSWSTHLRSAQDFVTVGDEIDAVILTLDREDRKMSLGIKQLTPDPWTDITKKYPVGSKHTGIVRNFTNFGVFVELEEGIDGLIYISDLSWTKKIKHPSEFCNVGDNLDVVVLELDVEGRKLSLGHKQTTDNPWDKYEKEFALESIHKAAVTEMVDKGATIDFNEDIVAFIPARHLEKEDGSKLKKGEEAEFKIIEFNKEFKRVVASHTAVFRAEEAKIVKQAVKKQAAQAAEAKPTLGDANEALQALKDKLDGKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	14198-14231	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	393652-393685	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	409145-409178	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	396516-396549	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	437226-437259	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	393625-393658	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	415482-415515	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	507893-507926	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	402301-402334	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	408046-408079	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	409145-409178	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	415482-415515	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	393625-393658	6	0.824
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	393190-393223	6	0.824
NZ_AP014583_1	1.2\|3137116\|34\|NZ_AP014583\|CRISPRCasFinder	3137116-3137149	34	NZ_CP033743	Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence	28100-28133	9	0.735
NZ_AP014583_1	1.1\|3137059\|34\|NZ_AP014583\|CRISPRCasFinder	3137059-3137092	34	NZ_CP029545	Lactobacillus helsingborgensis strain ESL0183 plasmid unnamed	11094-11127	11	0.676

1. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

2. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

3. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

4. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

5. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

6. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

7. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tcgttgttgatttttttgctgaaacc-gtattaca	Protospacer
* ******.************** **  ** ***

8. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

9. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tcgttgttgatttttttgctgaaacc-gtattaca	Protospacer
* ******.************** **  ** ***

10. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

11. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

12. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tcgttgttgatttttttgctgaaacc-gtattaca	Protospacer
* ******.************** **  ** ***

13. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

14. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 6, identity: 0.824

tagttgttaatttttttgctgaaccctttaatac-	CRISPR spacer
tggttgttgatttttttgctgaaacc-gtattaca	Protospacer
*.******.************** **  ** ***

15. spacer 1.2|3137116|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP033743 (Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

cgctttctatagttttggcagctacatttaaatt	CRISPR spacer
cgctttctattgttttggccgctattcttgtacc	Protospacer
********** ******** ****. .**. *..

16. spacer 1.1|3137059|34|NZ_AP014583|CRISPRCasFinder matches to NZ_CP029545 (Lactobacillus helsingborgensis strain ESL0183 plasmid unnamed) position: , mismatch: 11, identity: 0.676

tagttgttaatttttttgctgaaccctttaatac	CRISPR spacer
cttgagccaattttttatctgaaccctttaattt	Protospacer
.    *..********  ************** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

881919 : 890020

Caulobacter_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045469624.1\|881919_883617_-	carbamoyltransferase	A0A1B1IVF2	uncultured_Mediterranean_phage	3.1e-60	31.4
WP_045469627.1\|883664_884621_-	hypothetical protein	NA	NA	NA	NA
WP_045469631.1\|884637_886098_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	2.3e-67	37.8
WP_084221516.1\|886111_886744_-	SIS domain-containing protein	A0A067XQR2	Caulobacter_phage	6.6e-24	37.6
WP_045469634.1\|886784_887765_-	GHMP kinase	A0A067XQL1	Caulobacter_phage	3.4e-35	33.6
WP_045469637.1\|887776_889075_-	HAD-IIIA family hydrolase	A0A1V0SB89	Catovirus	3.6e-08	23.7
WP_045469640.1\|889081_890020_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SAI6	Catovirus	1.6e-29	30.8

DBSCAN-SWA_2

2312489 : 2358825

Tupanvirus(25.0%)

integrase,tRNA,transposase

attL 2335502:2335518|attR 2337860:2337876

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045475443.1\|2312489_2313935_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_045472175.1\|2314137_2314560_+	hypothetical protein	NA	NA	NA	NA
WP_045472178.1\|2314583_2315807_+	hypothetical protein	NA	NA	NA	NA
WP_045472181.1\|2315957_2318468_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.5e-140	40.6
WP_045472184.1\|2318477_2319644_+	formimidoylglutamase	NA	NA	NA	NA
WP_045472188.1\|2319803_2321156_+	gliding motility lipoprotein GldK	A0A075BSL8	Microcystis_phage	2.3e-13	35.7
WP_045472191.1\|2321248_2321884_+	gliding motility protein GldL	NA	NA	NA	NA
WP_045472194.1\|2321932_2323507_+	gliding motility protein GldM	NA	NA	NA	NA
WP_045472197.1\|2323557_2324466_+	gliding motility protein GldN	NA	NA	NA	NA
WP_045472200.1\|2324564_2325611_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_045472203.1\|2325600_2325984_-	DUF983 domain-containing protein	NA	NA	NA	NA
WP_045472206.1\|2326097_2328008_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.3e-54	29.0
WP_045472209.1\|2328074_2329220_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_045472212.1\|2329223_2332496_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.1e-48	20.7
WP_045472215.1\|2332476_2333802_+	TolC family protein	NA	NA	NA	NA
WP_084221561.1\|2333814_2333997_+	CPXCG motif-containing cysteine-rich protein	NA	NA	NA	NA
WP_052471337.1\|2334159_2334978_+	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_052471219.1\|2335278_2335887_+	hypothetical protein	NA	NA	NA	NA
2335502:2335518	attL	NA	NA	NA	NA
WP_052471220.1\|2335935_2336589_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_045472224.1\|2336604_2337660_+	hypothetical protein	NA	NA	NA	NA
WP_045472226.1\|2338449_2339322_-	hypothetical protein	NA	NA	NA	NA
2337860:2337876	attR	NA	NA	NA	NA
WP_045472229.1\|2339463_2340345_-	hypothetical protein	NA	NA	NA	NA
WP_045472232.1\|2340436_2341618_-\|transposase	transposase	NA	NA	NA	NA
WP_045472234.1\|2342152_2342683_-	CIA30 family protein	NA	NA	NA	NA
WP_045472237.1\|2342845_2344174_-	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_045472240.1\|2346403_2346967_-	hypothetical protein	NA	NA	NA	NA
WP_045472243.1\|2346956_2347448_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_045472246.1\|2347447_2348296_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_052471221.1\|2348774_2349944_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_045472249.1\|2350168_2350471_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_045472252.1\|2350470_2350689_-	hypothetical protein	NA	NA	NA	NA
WP_171817174.1\|2351117_2352674_-	S8 family serine peptidase	A0A2K9L199	Tupanvirus	1.7e-12	32.2
WP_052471223.1\|2353133_2353898_-	DUF3667 domain-containing protein	NA	NA	NA	NA
WP_045472254.1\|2354337_2355189_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	9.8e-31	31.9
WP_045472257.1\|2355188_2355560_-\|transposase	transposase	NA	NA	NA	NA
WP_052471224.1\|2355916_2357323_-	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	3.7e-51	31.6
WP_045475451.1\|2357603_2358455_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.7e-30	36.4
WP_045472260.1\|2358468_2358825_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

2534724 : 2548830

Acinetobacter_phage(50.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045472642.1\|2534724_2535576_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-32	37.3
WP_045472257.1\|2535575_2535947_-\|transposase	transposase	NA	NA	NA	NA
WP_171817176.1\|2536155_2536326_-	hypothetical protein	NA	NA	NA	NA
WP_144374462.1\|2536371_2537427_-	hypothetical protein	NA	NA	NA	NA
WP_045472648.1\|2537923_2540563_-	CHAT domain-containing protein	NA	NA	NA	NA
WP_171817177.1\|2540510_2540687_-	hypothetical protein	NA	NA	NA	NA
WP_084221568.1\|2540864_2541386_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.5e-29	41.9
WP_052471246.1\|2541364_2541868_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_045472653.1\|2542551_2543037_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_045472656.1\|2543041_2543650_+	hypothetical protein	NA	NA	NA	NA
WP_045472659.1\|2543748_2545146_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_045472662.1\|2545842_2546574_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_045472665.1\|2546698_2547511_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_045472232.1\|2547648_2548830_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage