CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_AP013065	Serratia marcescens SM39 plasmid pSMC2, complete sequence	0 crisprs	NA	0	0
NZ_AP013064	Serratia marcescens SM39 plasmid pSMC1, complete sequence	1 crisprs	NA	1	0
NZ_AP013063	Serratia marcescens SM39	0 crisprs	DEDDh,DinG,csa3,cas3,WYL	0	8

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP013064_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP013064_1

1492-1598

Orphan

Consensus_repeat	Method
GTGTCCAAAGTCCGTGCGTATTAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP013064_1

>merge|NZ_AP013064|1|1492-1598|CRISPRCasFinder
GTGTCCAAAGTCCGTGCGTATTACAGCCGACCAGGCCATGCCGGTGGCCAGCATCGCCGGAAGTGACGAGGGCGGCCGCGAAGGTGTCCAAAGTCCGTCCGTATTAC

>NZ_AP013064|1|1|1492-1598|CRISPRCasFinder
GTGTCCAAAGTCCGTGCGTATTAC	AGCCGACCAGGCCATGCCGGTGGCCAGCATCGCCGGAAGTGACGAGGGCGGCCGCGAAG
GTGTCCAAAGTCCGTCCGTATTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP013064.1\|WP_011518938.1\|3261_4740_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_AP013064.1\|WP_003124454.1\|9190_9541_-\|mercuric-ion-transporter-MerT	unknown	unknown	gnl\|CDD\|184301
NZ_AP013064.1\|WP_011518936.1\|5634_5970_+\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|274340
NZ_AP013064.1\|WP_072206022.1\|1853_2162_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP013064.1\|WP_041038512.1\|2285_2849_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_AP013064.1\|WP_003132004.1\|6528_6765_-\|broad-spectrum-mercury-transporter-MerE	unknown	unknown	gnl\|CDD\|184297
NZ_AP013064.1\|WP_000995360.1\|6761_7127_-\|mercury-resistance-co-regulator-MerD	unknown	unknown	gnl\|CDD\|184299
NZ_AP013064.1\|WP_041038525.1\|8901_9177_-\|mercury-resistance-system-periplasmic-binding-protein-MerP	unknown	unknown	gnl\|CDD\|131107
NZ_AP013064.1\|WP_011518937.1\|4754_5618_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NZ_AP013064.1\|WP_041038523.1\|7144_8830_-\|mercury(II)-reductase	unknown	unknown	gnl\|CDD\|184298

Protein	Function_ID	Function_description	E-value
NZ_AP013064.1\|WP_011518938.1\|3261_4740_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	2.46125e-145
NZ_AP013064.1\|WP_003124454.1\|9190_9541_-\|mercuric-ion-transporter-MerT	gnl\|CDD\|184301	PRK13751, PRK13751, putative mercuric transport protein; Provisional.	4.13543e-75
NZ_AP013064.1\|WP_011518936.1\|5634_5970_+\|molecular-chaperone-DnaK	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	1.39919e-08
NZ_AP013064.1\|WP_041038512.1\|2285_2849_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	7.27927e-51
NZ_AP013064.1\|WP_003132004.1\|6528_6765_-\|broad-spectrum-mercury-transporter-MerE	gnl\|CDD\|184297	PRK13747, PRK13747, putative mercury resistance protein; Provisional.	4.34146e-46
NZ_AP013064.1\|WP_000995360.1\|6761_7127_-\|mercury-resistance-co-regulator-MerD	gnl\|CDD\|184299	PRK13749, PRK13749, HTH-type transcriptional regulator MerD.	5.86571e-70
NZ_AP013064.1\|WP_041038525.1\|8901_9177_-\|mercury-resistance-system-periplasmic-binding-protein-MerP	gnl\|CDD\|131107	TIGR02052, periplasmic_mercuric_ion_binding_protein, mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403). [Cellular processes, Detoxification].	3.42174e-29
NZ_AP013064.1\|WP_011518937.1\|4754_5618_+\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	1.01106e-14
NZ_AP013064.1\|WP_041038523.1\|7144_8830_-\|mercury(II)-reductase	gnl\|CDD\|184298	PRK13748, PRK13748, putative mercuric reductase; Provisional.	0

>NZ_AP013064.1|WP_072206022.1|1853_2162_+|hypothetical-protein
MSRARRTFPPELLARLHAMQVTAALDLLGLYWKHDPDFKPIKDKATVRVNVALGGGGVELLATGPKWYDTRAEKGGGGAIDLAMHLLRLDFVSAVKRLQAAT
>NZ_AP013064.1|WP_041038512.1|2285_2849_-|recombinase-family-protein
MQGQRIGYVRVSSFDQNPERQLEQVEVGKVFTDKASGKDTQRPELDSLLAFVREGDTVVVHSMDRLARNLDDLRRLVQKLTRRGVRIEFVKECLTFPGEDSPMANLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSPERAAELLQRVKAGEQKAKLAREFGISRETLYQYLREIGA
>NZ_AP013064.1|WP_011518938.1|3261_4740_+|SulP-family-inorganic-anion-transporter
MMKSLRQDWLSNVRNDLLAGIVVALALIPEAIAFSIIAGVDPKVGLYASFSIAAIIAFAGGRPGMVSAATGAMALLMVTLVKDHGLQYLLAATVLTGVLQILAGWLKLGALMRFVSRSVITGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYGFPYITKAVPSPLVAIVVLTGVAIFLGLDIRTVGDMGKLPDSLPVFLLPDVPLNLETLKIIFPVSATLAVVGLLESMMTASIVDDLTDSNSNKNRECVGQGVANIATGFLGGMAGCAMIGQSVINVKSGGRGRLSTLAAGVFLLLMVVFIGDWVARIPMAALVAVMIMVSIGTFNWASIRNLREHPKSSSMVMLATVVVTVGTHDLAKGVLIGVLLSGFFFAHKVGQILRVTSRTEDEGRVRTYTITGQVFFASADRFINTFDYKEVIEKVRIDVSRAHFWDITAVSALDKVVIKFRREATEVEVIGLNEASATMVDKFAVHDKDGAEDMLMGH
>NZ_AP013064.1|WP_011518937.1|4754_5618_+|universal-stress-protein
MKNENKVLACVDQSHFADYVADYAAWAARRMDAPLEFLHVIDRHPEQGSGEDHSGAIGIDAQENLLTKLTAEDEARTKNAREQGRIFLNRLRERATAAGAALVDVRQRHGELEATLAEQEDGVRLLILGRRGEAAEATQRDLGRNVERVVRSLHKPILTVTEGFKEPQRVMIAFDGGVVTRRGVEMVAGSPLFRGLPIILLMSGKKSQDAPKQLDWAKTTLESAGFDVTASLIPGDAESIIAKTVKEQSIDMLIMGAFGHSPLRTLMFGSKTADLLRSSTIPTLLLR
>NZ_AP013064.1|WP_011518936.1|5634_5970_+|molecular-chaperone-DnaK
MDMEQFRARLLIEQRETVEAIQQAQQSAAPVELDQSCVGRVSRIDALQQQALAQGLRERLTIRKRKVEAALARLDSGTYGLCCACHSDLEPELLNADPAVVFCQECATARQ
>NZ_AP013064.1|WP_003132004.1|6528_6765_-|broad-spectrum-mercury-transporter-MerE
MNNPERLPSETHKPITGYLWGGLAVLTCPCHLPILAVVLAGTTAGAFLGEHWVIAALGLTGLFLLSLSRALRAFRERE
>NZ_AP013064.1|WP_000995360.1|6761_7127_-|mercury-resistance-co-regulator-MerD
MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLALLRQFVERRREALADLEVQLATLPTEPAQHAESLP
>NZ_AP013064.1|WP_041038523.1|7144_8830_-|mercury(II)-reductase
MTHLKITGMTCDSCAAHVKEALEKVPGVQSAIVSYAKGAAQLALDPGTAPDALTAAVAGLGYKAMLADAPPTDNRTGLFDKVRGWMGAADKGSGGERPLQVAVIGSGGAAMAAALKAVEQGAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGMPPTPPTILRERLLAQQQARVEELRHAKYEGILDGNSAITVLHGEARFKDDQSLIVSLNEGGERVVMFDRCLVATGASPAMPPIPGLKESPYWTSTEALVSDTIPERLAVIGSSMVALELAQAFARLGSQVTILARSTLFFREDPAIGEAVTAAFRAEGIKVLEHTEASQVAHVDGEFVLTTGQGEVRADKLLVATGRTPNTRSLALEAAGVAVNAQGAIVIDKGMRTSSPNIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDATLDLDAMPAVVFTDPQVATVGYSEAEAQRIGLQTDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG
>NZ_AP013064.1|WP_041038525.1|8901_9177_-|mercury-resistance-system-periplasmic-binding-protein-MerP
MKKLFASLALAAFVAPVFAATQTVTLSVPGMTCSTCLITVKKAISKVEGVSKVNVTFETREAVVTFDDAKTSVQKLTKATEDAGYPSSVKK
>NZ_AP013064.1|WP_003124454.1|9190_9541_-|mercuric-ion-transporter-MerT
MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWRRIVRPTAACKPGEVCAIPQVRTTYKLIFWFVAVLVLVALGFPYVMPFFY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_AP013064_1	1.1\|1516\|59\|NZ_AP013064\|CRISPRCasFinder	1516-1574	59	NZ_KX169264	Pseudomonas aeruginosa strain D5170990 plasmid pD5170990, complete sequence	22160-22218	1.0
NZ_AP013064_1	1.1\|1516\|59\|NZ_AP013064\|CRISPRCasFinder	1516-1574	59	NZ_KP975076	Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence	13176-13234	1.0
NZ_AP013064_1	1.1\|1516\|59\|NZ_AP013064\|CRISPRCasFinder	1516-1574	59	MN336501	Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence	5912-5970	1.0
NZ_AP013064_1	1.1\|1516\|59\|NZ_AP013064\|CRISPRCasFinder	1516-1574	59	NC_009739	Pseudomonas aeruginosa plasmid pMATVIM-7, complete sequence	5912-5970	1.0
NZ_AP013064_1	1.1\|1516\|59\|NZ_AP013064\|CRISPRCasFinder	1516-1574	59	NZ_CP033834	Pseudomonas aeruginosa strain FDAARGOS_570 plasmid unnamed, complete sequence	22064-22122	1.0
NZ_AP013064_1	1.1\|1516\|59\|NZ_AP013064\|CRISPRCasFinder	1516-1574	59	NZ_AP013064	Serratia marcescens SM39 plasmid pSMC1, complete sequence	1516-1574	1.0

1. spacer 1.1|1516|59|NZ_AP013064|CRISPRCasFinder matches to NZ_KX169264 (Pseudomonas aeruginosa strain D5170990 plasmid pD5170990, complete sequence) position: , mismatch: 0, identity: 1.0

agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	CRISPR spacer
agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	Protospacer
***********************************************************

2. spacer 1.1|1516|59|NZ_AP013064|CRISPRCasFinder matches to NZ_KP975076 (Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence) position: , mismatch: 0, identity: 1.0

agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	CRISPR spacer
agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	Protospacer
***********************************************************

3. spacer 1.1|1516|59|NZ_AP013064|CRISPRCasFinder matches to MN336501 (Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	CRISPR spacer
agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	Protospacer
***********************************************************

4. spacer 1.1|1516|59|NZ_AP013064|CRISPRCasFinder matches to NC_009739 (Pseudomonas aeruginosa plasmid pMATVIM-7, complete sequence) position: , mismatch: 0, identity: 1.0

agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	CRISPR spacer
agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	Protospacer
***********************************************************

5. spacer 1.1|1516|59|NZ_AP013064|CRISPRCasFinder matches to NZ_CP033834 (Pseudomonas aeruginosa strain FDAARGOS_570 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	CRISPR spacer
agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	Protospacer
***********************************************************

6. spacer 1.1|1516|59|NZ_AP013064|CRISPRCasFinder matches to NZ_AP013064 (Serratia marcescens SM39 plasmid pSMC1, complete sequence) position: , mismatch: 0, identity: 1.0

agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	CRISPR spacer
agccgaccaggccatgccggtggccagcatcgccggaagtgacgagggcggccgcgaag	Protospacer
***********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

228449 : 264580

Pseudomonas_phage(65.71%)

tail,integrase,transposase,capsid

attL 247954:247970|attR 268020:268036

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052475377.1\|228449_230414_-	hypothetical protein	B5TAB2	Burkholderia_phage	7.2e-85	40.8
WP_070099205.1\|230415_231219_-	hypothetical protein	A0A2D1GNV9	Pseudomonas_phage	3.1e-71	48.0
WP_041033390.1\|231215_233939_-	hypothetical protein	A0A2D1GNP9	Pseudomonas_phage	6.7e-299	67.6
WP_041033392.1\|233939_234137_-	hypothetical protein	A0A2D1GNL8	Pseudomonas_phage	6.4e-18	69.2
WP_041033394.1\|234146_234380_-	hypothetical protein	A0A2D1GNV4	Pseudomonas_phage	1.7e-33	80.5
WP_041033396.1\|234389_235205_-	phage BR0599 family protein	A0A2D1GNT2	Pseudomonas_phage	8.0e-115	70.5
WP_041033398.1\|235191_236376_-	hypothetical protein	A0A2D1GNY4	Pseudomonas_phage	6.8e-115	54.2
WP_080335397.1\|236372_239645_-\|tail	phage tail length tape measure family protein	A0A125RNI9	Pseudomonas_phage	3.4e-55	35.3
WP_052475380.1\|239801_240293_-	hypothetical protein	NA	NA	NA	NA
WP_041033400.1\|240289_241042_-	hypothetical protein	A0A2D1GNQ7	Pseudomonas_phage	2.2e-74	57.0
WP_041033402.1\|241028_241229_-	hypothetical protein	NA	NA	NA	NA
WP_041033404.1\|241216_241663_-	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	5.0e-18	34.0
WP_041033406.1\|241659_242184_-	DUF1320 domain-containing protein	Q5ZQX5	Pseudomonas_phage	5.3e-43	55.0
WP_041033408.1\|242195_243125_-\|capsid	major capsid protein	J9SVQ2	Pseudomonas_phage	1.3e-124	69.5
WP_041033410.1\|243192_243570_-	DUF2190 family protein	A0A0S4L3C3	Pseudomonas_phage	1.7e-19	47.2
WP_154232835.1\|243566_244652_-	peptidase	J9SGT4	Pseudomonas_phage	1.5e-76	51.6
WP_041033412.1\|244948_245512_-	phage virion morphogenesis protein	Q5ZQY1	Pseudomonas_phage	1.2e-48	51.9
WP_041033413.1\|245511_246729_-	bacteriophage protein	J9STS2	Pseudomonas_phage	2.2e-124	55.1
WP_080335398.1\|246718_248233_-	DUF935 family protein	Q5ZQY4	Pseudomonas_phage	9.3e-149	54.6
247954:247970	attL	NA	NA	NA	NA
WP_041033417.1\|248229_249909_-	phage protein	A0A219VH72	Ochrobactrum_phage	4.4e-115	45.9
WP_041033419.1\|249908_250460_-	DUF3486 family protein	J9SH37	Pseudomonas_phage	4.2e-43	68.8
WP_041033421.1\|250461_250758_-	hypothetical protein	J9SNG3	Pseudomonas_phage	2.1e-28	67.0
WP_041033422.1\|250769_251072_-	DUF2730 family protein	NA	NA	NA	NA
WP_052475383.1\|251176_251611_-	hypothetical protein	Q6TM80	Pseudomonas_phage	2.4e-09	40.3
WP_041033424.1\|251597_252218_-	transglycosylase SLT domain-containing protein	J9SHG5	Pseudomonas_phage	3.6e-67	61.6
WP_041033426.1\|252220_252589_-	membrane protein	A4JWP3	Burkholderia_virus	7.2e-23	54.3
WP_041033428.1\|252707_253907_-	hypothetical protein	A0A291AUQ1	Sinorhizobium_phage	3.0e-49	31.7
WP_041033430.1\|253909_254917_-	nucleoid-associated protein	A0A291AUQ0	Sinorhizobium_phage	4.2e-57	36.9
WP_041033432.1\|255207_255975_+	DNA adenine methylase	A2I2Y7	Vibrio_virus	6.0e-104	65.9
WP_154232790.1\|256011_256398_-	hypothetical protein	B5WZU2	Pseudomonas_phage	3.8e-06	45.5
WP_041033434.1\|256441_256858_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_041033437.1\|256948_257173_+	hypothetical protein	NA	NA	NA	NA
WP_041033439.1\|257176_257485_+	helix-turn-helix domain-containing protein	Q5ZR02	Pseudomonas_phage	1.4e-24	61.7
WP_041033441.1\|257498_258410_+	DUF3102 domain-containing protein	A4JWN3	Burkholderia_virus	1.2e-82	56.7
WP_041033443.1\|258411_260184_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	6.4e-226	66.6
WP_041033445.1\|260192_261356_+	AAA family ATPase	A4JWN1	Burkholderia_virus	3.0e-123	61.1
WP_154232791.1\|261383_261686_+	hypothetical protein	NA	NA	NA	NA
WP_041033448.1\|261678_261903_+	hypothetical protein	NA	NA	NA	NA
WP_041033450.1\|261928_262453_+	host-nuclease inhibitor Gam family protein	A0A125RNF6	Pseudomonas_phage	2.6e-50	58.9
WP_041033454.1\|262646_262940_+	hypothetical protein	NA	NA	NA	NA
WP_041033456.1\|262923_263646_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	4.0e-25	33.8
WP_052475384.1\|263778_264204_+	regulatory protein GemA	Q6QIE7	Burkholderia_phage	8.9e-25	44.8
WP_170865746.1\|264229_264580_+	DNA-binding protein	Q6QIE8	Burkholderia_phage	1.8e-10	33.9
268020:268036	attR	NA	NA	NA	NA

DBSCAN-SWA_2

544161 : 589674

Cronobacter_phage(27.91%)

tail,integrase

attL 545889:545935|attR 590908:590954

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033637396.1\|544161_545028_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	9.0e-32	34.7
WP_172668113.1\|545233_545443_+	hypothetical protein	NA	NA	NA	NA
WP_070099211.1\|545439_545760_+	hypothetical protein	NA	NA	NA	NA
545889:545935	attL	NA	NA	NA	NA
WP_041033733.1\|545954_547115_-\|integrase	site-specific integrase	G8C7S0	Escherichia_phage	3.9e-155	69.5
WP_041033735.1\|547538_548186_-	DNA methyltransferase	G8C7S6	Escherichia_phage	3.2e-90	75.9
WP_041033738.1\|548182_548371_-	ANR family transcriptional regulator	NA	NA	NA	NA
WP_041033740.1\|548385_548757_-	hypothetical protein	NA	NA	NA	NA
WP_048796803.1\|548980_549199_-	hypothetical protein	NA	NA	NA	NA
WP_052475393.1\|549176_549875_-	hypothetical protein	R9W0X9	Serratia_phage	1.6e-23	37.0
WP_041033742.1\|549871_550105_-	hypothetical protein	B1GS76	Salmonella_phage	7.1e-08	48.2
WP_154232793.1\|550101_550455_-	hypothetical protein	F1C5B5	Cronobacter_phage	2.1e-11	42.0
WP_041033744.1\|550777_550978_-	hypothetical protein	R9VYJ0	Serratia_phage	3.5e-32	97.0
WP_052475395.1\|550970_551504_-	hypothetical protein	A0A2H4J4Q4	uncultured_Caudovirales_phage	1.3e-41	56.5
WP_052475396.1\|551500_551977_-	hypothetical protein	NA	NA	NA	NA
WP_041033746.1\|551960_552800_-	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	5.1e-80	59.3
WP_041033748.1\|552802_553006_-	hypothetical protein	NA	NA	NA	NA
WP_041033750.1\|553055_553745_-	hypothetical protein	A0A088C400	Shewanella_sp._phage	1.5e-24	39.2
WP_041033753.1\|553744_554410_-	ATP-binding protein	G9L667	Escherichia_phage	3.4e-71	61.8
WP_041033756.1\|554409_555081_-	exodeoxyribonuclease X	A0A1W5PTR6	Pseudoalteromonas_phage	1.2e-18	31.9
WP_154232794.1\|555240_555384_-	hypothetical protein	NA	NA	NA	NA
WP_052475397.1\|555923_556262_-	hypothetical protein	NA	NA	NA	NA
WP_080335402.1\|556764_557427_-	LexA family transcriptional regulator	A0A1R3Y604	Salmonella_virus	1.3e-17	57.1
WP_041033757.1\|557468_557681_+	helix-turn-helix domain-containing protein	Q76H55	Enterobacteria_phage	1.4e-23	75.4
WP_041033759.1\|557706_557997_+	hypothetical protein	I6PCV6	Cronobacter_phage	7.2e-10	44.0
WP_154232795.1\|558292_558451_+	hypothetical protein	NA	NA	NA	NA
WP_041033761.1\|558443_559502_+	replication protein	A0A2H4J2W5	uncultured_Caudovirales_phage	4.9e-56	81.6
WP_080335469.1\|559501_560893_+	AAA family ATPase	A0A0P0ZC27	Stx2-converting_phage	3.9e-154	62.5
WP_052475398.1\|560892_561315_+	hypothetical protein	A0A2H4FNF5	Salmonella_phage	4.1e-46	60.9
WP_041033765.1\|561311_561668_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	6.1e-43	70.3
WP_041033767.1\|561664_562477_+	antitermination protein	M9NZB0	Enterobacteria_phage	5.2e-82	57.5
WP_041033769.1\|562959_563184_+	hypothetical protein	NA	NA	NA	NA
WP_041033771.1\|563243_563504_+	hypothetical protein	NA	NA	NA	NA
WP_041033773.1\|563503_564031_+	lysozyme	H9C184	Pectobacterium_phage	2.2e-81	83.0
WP_080335470.1\|564143_564506_+	DUF2570 domain-containing protein	NA	NA	NA	NA
WP_154232796.1\|564813_565437_-	hypothetical protein	NA	NA	NA	NA
WP_033646503.1\|565604_565859_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.0e-24	65.5
WP_041033779.1\|565906_566167_+	DUF2560 family protein	NA	NA	NA	NA
WP_041033781.1\|566159_566810_+	hypothetical protein	I6S676	Salmonella_phage	1.3e-88	73.1
WP_041033784.1\|566841_567321_+	DUF2280 domain-containing protein	F1C5D6	Cronobacter_phage	2.8e-59	70.4
WP_041033786.1\|567307_568786_+	phage DNA Packaging protein	G0ZND4	Cronobacter_phage	5.5e-255	86.0
WP_041033788.1\|568807_570136_+	DUF1073 domain-containing protein	I6R9A1	Salmonella_phage	4.5e-200	76.6
WP_080335471.1\|570119_571853_+	hypothetical protein	G0ZND6	Cronobacter_phage	6.5e-231	71.2
WP_041033790.1\|571856_573122_+	hypothetical protein	Q5G8Y2	Enterobacteria_phage	5.1e-185	76.2
WP_041033792.1\|573134_573581_+	hypothetical protein	A0A1V0E5Q8	Salmonella_phage	2.7e-64	87.2
WP_041033794.1\|573598_574675_+	hypothetical protein	A0A1V0E5P6	Salmonella_phage	2.7e-187	89.7
WP_041033796.1\|574684_574978_+	hypothetical protein	A0A1V0E5P8	Salmonella_phage	4.1e-37	77.3
WP_041033798.1\|575044_575443_+	hypothetical protein	G0ZNE1	Cronobacter_phage	4.7e-60	83.2
WP_041033800.1\|575614_575962_+	hypothetical protein	G0ZNE2	Cronobacter_phage	8.6e-34	59.1
WP_041033802.1\|575964_576375_+	hypothetical protein	A0A291AXD9	Shigella_phage	7.8e-34	58.1
WP_041033804.1\|576371_576755_+	hypothetical protein	F1C5E4	Cronobacter_phage	1.5e-31	49.6
WP_041033806.1\|576815_577565_+	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	2.3e-63	55.2
WP_041033808.1\|577616_578297_+	hypothetical protein	G0ZNE7	Cronobacter_phage	1.1e-61	55.5
WP_080335404.1\|578569_578911_+	hypothetical protein	NA	NA	NA	NA
WP_041033810.1\|578921_579644_+	hypothetical protein	NA	NA	NA	NA
WP_041037905.1\|579747_580332_+	hypothetical protein	NA	NA	NA	NA
WP_154232797.1\|580334_580679_+	hypothetical protein	NA	NA	NA	NA
WP_041033812.1\|580737_583890_+	tape measure protein	Q5G8W8	Enterobacteria_phage	3.4e-193	51.4
WP_041033814.1\|583948_584416_+	hypothetical protein	A0A173GC35	Salmonella_phage	8.5e-53	64.7
WP_041033816.1\|584416_584887_+	DUF1833 family protein	R9TPR6	Aeromonas_phage	5.4e-47	57.5
WP_041037907.1\|584906_585299_+	C40 family peptidase	F1C5F2	Cronobacter_phage	5.0e-46	65.5
WP_041033818.1\|585258_587748_+\|tail	phage tail protein	F1C5A7	Cronobacter_phage	9.2e-263	55.6
WP_080335405.1\|587748_589674_+	hypothetical protein	B5TAB2	Burkholderia_phage	1.6e-100	45.0
590908:590954	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1262349 : 1296916

uncultured_Caudovirales_phage(31.03%)

integrase,tail,holin,terminase,head

attL 1261199:1261214|attR 1283646:1283661

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1261199:1261214	attL	NA	NA	NA	NA
WP_041034468.1\|1262349_1263420_-\|integrase	phage integrase Arm DNA-binding domain-containing protein	Q9MCR4	Enterobacteria_phage	4.7e-107	52.8
WP_041034470.1\|1263361_1263622_-	excisionase	A0A1V0E5M4	Salmonella_phage	8.4e-18	62.9
WP_168166355.1\|1263838_1264015_-	hypothetical protein	NA	NA	NA	NA
WP_041034472.1\|1264056_1264557_-	siphovirus Gp157 family protein	H9C156	Pectobacterium_phage	5.7e-55	68.7
WP_041034474.1\|1264553_1266719_-	hypothetical protein	H9C157	Pectobacterium_phage	1.7e-132	40.5
WP_041034476.1\|1266770_1267049_-	hypothetical protein	NA	NA	NA	NA
WP_041034479.1\|1267059_1267377_-	hypothetical protein	NA	NA	NA	NA
WP_154232805.1\|1267415_1267850_+	hypothetical protein	NA	NA	NA	NA
WP_080335416.1\|1267866_1268268_-	helix-turn-helix domain-containing protein	I6PD69	Cronobacter_phage	9.3e-40	59.4
WP_041034483.1\|1268346_1268547_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041034485.1\|1268607_1269060_+	hypothetical protein	H9C162	Pectobacterium_phage	4.4e-30	56.8
WP_041034487.1\|1269083_1269302_+	hypothetical protein	H9C163	Pectobacterium_phage	9.2e-18	59.4
WP_041034489.1\|1269304_1270024_+	helix-turn-helix domain-containing protein	A0A1W6JP36	Morganella_phage	3.2e-30	69.0
WP_041034491.1\|1270020_1271394_+	hypothetical protein	Q76H51	Enterobacteria_phage	8.8e-114	48.4
WP_041034493.1\|1271438_1271861_+	hypothetical protein	NA	NA	NA	NA
WP_041034495.1\|1271864_1272110_+	hypothetical protein	H9C167	Pectobacterium_phage	6.5e-12	47.6
WP_154232806.1\|1272471_1272651_+	hypothetical protein	NA	NA	NA	NA
WP_041034500.1\|1272647_1272908_+	hypothetical protein	NA	NA	NA	NA
WP_052475410.1\|1272897_1273431_+	ead/Ea22-like family protein	R9W086	Serratia_phage	4.6e-18	39.7
WP_080335417.1\|1273607_1273799_+	hypothetical protein	NA	NA	NA	NA
WP_041034502.1\|1273869_1274466_+	DUF1367 family protein	H9C173	Pectobacterium_phage	1.2e-75	66.7
WP_041034504.1\|1274474_1274780_+	DUF968 domain-containing protein	A0A1I9KFA7	Aeromonas_phage	2.0e-26	56.8
WP_154232807.1\|1274767_1275055_+	hypothetical protein	NA	NA	NA	NA
WP_041034508.1\|1275057_1275354_+	hypothetical protein	NA	NA	NA	NA
WP_041034510.1\|1275382_1275880_+	hypothetical protein	NA	NA	NA	NA
WP_041034512.1\|1275890_1276118_+	hypothetical protein	NA	NA	NA	NA
WP_041034514.1\|1276121_1277747_+\|head,tail	head-tail connector protein	A0A2H4J3N6	uncultured_Caudovirales_phage	7.3e-176	58.4
WP_041034516.1\|1277743_1277977_+	hypothetical protein	NA	NA	NA	NA
WP_041034518.1\|1277963_1278785_+	hypothetical protein	A0A2H4JEQ5	uncultured_Caudovirales_phage	6.1e-38	38.9
WP_041034520.1\|1278800_1279205_+	phage family protein	Q716B1	Shigella_phage	2.2e-41	68.0
WP_041034522.1\|1279416_1280328_+	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	1.4e-43	38.3
WP_041034525.1\|1280382_1280946_+	hypothetical protein	A0A2H4JID6	uncultured_Caudovirales_phage	1.3e-50	50.8
WP_041034527.1\|1280948_1282937_+	hypothetical protein	A0A2H4J6H2	uncultured_Caudovirales_phage	1.1e-178	46.9
WP_041034529.1\|1282939_1283389_+	GNAT family N-acetyltransferase	A0A2H4J9Z5	uncultured_Caudovirales_phage	6.8e-23	45.0
WP_041034530.1\|1283391_1283919_+	hypothetical protein	A0A2H4J679	uncultured_Caudovirales_phage	6.5e-09	45.7
1283646:1283661	attR	NA	NA	NA	NA
WP_041034532.1\|1283918_1286624_+	transglycosylase SLT domain-containing protein	G9L6D3	Escherichia_phage	2.4e-304	60.5
WP_041034534.1\|1286623_1289515_+	hypothetical protein	G9L6D4	Escherichia_phage	0.0e+00	74.0
WP_154232808.1\|1289558_1289885_+	hypothetical protein	NA	NA	NA	NA
WP_041034538.1\|1289922_1290306_+	hypothetical protein	NA	NA	NA	NA
WP_041034540.1\|1290366_1290708_+	hypothetical protein	A0A2H4J7H0	uncultured_Caudovirales_phage	1.5e-19	48.2
WP_041034542.1\|1290704_1292315_+\|terminase	phage terminase large subunit	A0A2H4JCA3	uncultured_Caudovirales_phage	5.1e-230	71.6
WP_052475411.1\|1292330_1294766_+	hypothetical protein	B5TAB2	Burkholderia_phage	4.0e-101	45.3
WP_041034544.1\|1294768_1295452_+	hypothetical protein	NA	NA	NA	NA
WP_041034546.1\|1295570_1295804_+\|holin	class II holin family protein	H9C183	Pectobacterium_phage	1.6e-20	69.6
WP_041034548.1\|1295787_1296303_+	lysozyme	Q71TF3	Escherichia_phage	7.0e-48	52.8
WP_041034550.1\|1296287_1296662_+	hypothetical protein	NA	NA	NA	NA
WP_041034552.1\|1296658_1296916_+	hypothetical protein	A0A248XCT8	Klebsiella_phage	1.7e-15	58.1

DBSCAN-SWA_4

1580153 : 1611376

Moraxella_phage(33.33%)

coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033638278.1\|1580153_1581089_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_172668115.1\|1581109_1583530_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_041034821.1\|1583597_1584362_-	molecular chaperone	NA	NA	NA	NA
WP_086557004.1\|1584386_1584935_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_072008406.1\|1584940_1585444_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_033638282.1\|1585446_1585986_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_041034823.1\|1586260_1587697_-	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
WP_033647432.1\|1587798_1590429_-	PqiB family protein	NA	NA	NA	NA
WP_041037977.1\|1590397_1591645_-	membrane integrity lipid transport subunit YebS	NA	NA	NA	NA
WP_033638286.1\|1591900_1592398_+	GAF domain-containing protein	NA	NA	NA	NA
WP_033638287.1\|1592494_1593205_+	RNA chaperone ProQ	NA	NA	NA	NA
WP_033638289.1\|1593224_1595273_+	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	5.7e-85	33.7
WP_033638291.1\|1595582_1596461_+\|protease	protease HtpX	NA	NA	NA	NA
WP_041034825.1\|1596698_1597406_+	hypothetical protein	NA	NA	NA	NA
WP_033646331.1\|1597506_1598901_-	MFS transporter	NA	NA	NA	NA
WP_041034827.1\|1599132_1599924_+	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_041034829.1\|1599970_1600774_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_041034831.1\|1600776_1601640_-	2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
WP_041034833.1\|1601641_1602778_-	2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT	G3M9Y6	Bacillus_virus	1.3e-25	33.7
WP_041034835.1\|1602774_1603785_-	2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_033638301.1\|1603960_1604680_-	phosphonate utilization transcriptional regulator PhnR	NA	NA	NA	NA
WP_041034837.1\|1604835_1605939_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_033653909.1\|1605948_1606758_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_033653910.1\|1606821_1608213_-	L-cystine transporter	NA	NA	NA	NA
WP_033638305.1\|1608394_1608943_-	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	6.4e-07	35.8
WP_033653911.1\|1609365_1610031_-	hexitol phosphatase HxpB	NA	NA	NA	NA
WP_033653912.1\|1610095_1611376_-\|protease	protease	NA	NA	NA	NA

DBSCAN-SWA_5

1628246 : 1643531

Tupanvirus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025159696.1\|1628246_1630175_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.5e-132	37.7
WP_048233542.1\|1630178_1630730_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.6e-16	33.7
WP_004931418.1\|1630828_1631026_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004931417.1\|1631069_1631426_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_151498502.1\|1631492_1631588_+	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_004931416.1\|1631834_1632818_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	2.2e-34	38.9
WP_041034859.1\|1632832_1635220_+\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	1.4e-05	25.0
WP_004931414.1\|1635224_1635521_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	3.2e-13	40.0
WP_039566415.1\|1636070_1636487_+	DUF2502 domain-containing protein	NA	NA	NA	NA
WP_033653920.1\|1636665_1637673_+	vitamin B12 ABC transporter permease BtuC	NA	NA	NA	NA
WP_041034862.1\|1637718_1638270_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	1.5e-16	35.0
WP_041034864.1\|1638275_1639031_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2H4PQG7	Staphylococcus_phage	3.3e-06	28.7
WP_033638335.1\|1639427_1640582_+	UDP-4-amino-4-deoxy-L-arabinose aminotransferase	A0A2K9L470	Tupanvirus	1.2e-28	25.2
WP_033638338.1\|1640568_1641549_+	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	B9UDL7	Salmonella_phage	3.1e-36	32.4
WP_041037979.1\|1641548_1643531_+	bifunctional UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronic acid oxidase ArnA	A0A2K9KZK0	Tupanvirus	1.1e-21	25.4

DBSCAN-SWA_6

2901015 : 2921820

Klebsiella_phage(33.33%)

tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080335440.1\|2901015_2902518_-\|tail	prophage tail fiber N-terminal domain-containing protein	A0A1I9SF20	Klebsiella_phage	3.0e-30	41.3
WP_052475425.1\|2902539_2903739_-\|tail	tail fiber domain-containing protein	Q5G8V6	Enterobacteria_phage	1.6e-47	34.7
WP_152903591.1\|2903788_2904760_-	hypothetical protein	NA	NA	NA	NA
WP_041036001.1\|2904779_2907986_-	host specificity protein J	F1C571	Cronobacter_phage	0.0e+00	64.2
WP_041036003.1\|2908039_2908666_-\|tail	tail assembly protein	F1C572	Cronobacter_phage	8.2e-51	54.2
WP_154232821.1\|2908708_2909059_-	hypothetical protein	NA	NA	NA	NA
WP_041036005.1\|2909096_2909801_-	C40 family peptidase	K7PGR2	Enterobacteria_phage	1.8e-107	75.3
WP_170929876.1\|2909810_2910563_-\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	2.4e-97	65.2
WP_033639815.1\|2910572_2910911_-\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-33	60.0
WP_041036008.1\|2910910_2913244_-\|tail	phage tail tape measure protein	Q6UAW7	Klebsiella_phage	1.0e-13	43.2
WP_004935830.1\|2913236_2913458_-	hypothetical protein	Q6UAW9	Klebsiella_phage	1.7e-11	47.9
WP_041036010.1\|2913475_2913841_-\|tail	phage tail protein	Q6UAW8	Klebsiella_phage	2.6e-20	43.6
WP_033652513.1\|2913967_2914423_-\|tail	major tail shaft subunit	Q6UAX0	Klebsiella_phage	2.5e-57	75.5
WP_041036013.1\|2914463_2914856_-	hypothetical protein	Q7Y404	Yersinia_phage	1.4e-19	46.0
WP_041036015.1\|2914852_2915242_-	hypothetical protein	Q7Y405	Yersinia_phage	1.8e-24	42.1
WP_041036017.1\|2915299_2915740_-	lysozyme	A0A0M5M782	Salmonella_phage	4.4e-43	61.6
WP_041036019.1\|2915726_2916047_-\|holin	phage holin family protein	F1C5D1	Cronobacter_phage	1.5e-40	80.0
WP_019453679.1\|2916839_2917202_-	antitermination protein Q	A0A0P0ZCW0	Stx2-converting_phage	1.6e-38	64.6
WP_041036021.1\|2917412_2918090_+	peptidase S24	K7PK07	Enterobacteria_phage	7.9e-07	44.6
WP_033635291.1\|2918516_2918846_-	osmotically-inducible lipoprotein OsmE	NA	NA	NA	NA
WP_041036023.1\|2918973_2919441_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_039565032.1\|2919548_2920127_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_041036025.1\|2920120_2920537_-	VOC family protein	NA	NA	NA	NA
WP_033635297.1\|2920689_2921820_-	porin OmpC	Q1MVN1	Enterobacteria_phage	1.8e-104	53.9

DBSCAN-SWA_7

4764726 : 4838781

Erwinia_phage(33.33%)

integrase,plate,portal,protease,tRNA,capsid,tail,lysis,terminase,head

attL 4761072:4761091|attR 4836935:4836954

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4761072:4761091	attL	NA	NA	NA	NA
WP_041037431.1\|4764726_4765200_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_041037433.1\|4765243_4766638_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.7e-19	26.7
WP_004931124.1\|4766634_4767333_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	2.4e-06	30.3
WP_004931122.1\|4767481_4767961_+	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_041037435.1\|4768160_4769141_-\|integrase	tyrosine-type recombinase/integrase	S4TP66	Salmonella_phage	2.5e-179	95.7
WP_001099751.1\|4769210_4769504_-	helix-turn-helix transcriptional regulator	Q1JS45	Enterobacteria_phage	1.6e-36	75.3
WP_001583792.1\|4769640_4769913_+	hypothetical protein	Q1JS36	Enterobacteria_phage	1.0e-42	87.8
WP_001670778.1\|4770082_4770583_+	hypothetical protein	M1SV55	Escherichia_phage	1.8e-85	91.0
WP_041037442.1\|4770646_4770880_+	DUF2732 family protein	Q7Y4C2	Escherichia_virus	5.4e-24	79.7
WP_040229177.1\|4770870_4771167_+	DUF5405 family protein	A0A0F7LCL4	Escherichia_phage	1.6e-28	71.7
WP_016243384.1\|4771171_4771396_+	TraR/DksA C4-type zinc finger protein	A0A0F7LDG9	Escherichia_phage	5.2e-24	75.7
WP_016243385.1\|4771392_4771668_+	DUF5405 family protein	M1TAP2	Escherichia_phage	2.9e-32	75.8
WP_041037451.1\|4771657_4773949_+	replication endonuclease	Q858T4	Yersinia_virus	0.0e+00	83.6
WP_041037458.1\|4774632_4775655_-\|portal	phage portal protein	A0A2I8TV74	Erwinia_phage	4.7e-197	99.1
WP_041037460.1\|4775651_4776398_-	hypothetical protein	O80303	Escherichia_phage	1.3e-135	94.0
WP_041037462.1\|4776397_4778167_-\|terminase	terminase ATPase subunit family protein	A0A218M4M1	Erwinia_phage	0.0e+00	99.5
WP_032448423.1\|4778332_4779187_+\|capsid	capsid scaffolding protein	A0A218M4L9	Erwinia_phage	1.6e-158	99.3
WP_001248605.1\|4779262_4780330_+\|capsid	phage major capsid protein, P2 family	O80304	Escherichia_phage	2.9e-197	99.4
WP_032448424.1\|4780333_4781083_+\|terminase	terminase endonuclease subunit	A0A218M4L0	Erwinia_phage	7.4e-115	96.9
WP_041037468.1\|4781176_4781686_+\|head	head completion/stabilization protein	A0A218M4L7	Erwinia_phage	4.7e-89	97.6
WP_000870101.1\|4781685_4781889_+\|tail	tail protein X	A0A218M4L8	Erwinia_phage	9.8e-30	95.5
WP_001437784.1\|4781879_4782101_+	primosomal protein	A0A218M4L5	Erwinia_phage	8.4e-35	98.6
WP_041037473.1\|4782084_4782594_+	lysozyme	A0A218M4K3	Erwinia_phage	2.4e-85	92.9
WP_032237124.1\|4782590_4783004_+\|lysis	LysB family phage lysis regulatory protein	O80310	Escherichia_phage	1.1e-43	69.3
WP_041037477.1\|4783111_4783579_+\|tail	phage tail protein	A0A218M4K6	Erwinia_phage	5.5e-84	99.4
WP_032237126.1\|4783571_4784021_+	phage virion morphogenesis protein	O80313	Escherichia_phage	1.3e-71	98.0
WP_032448428.1\|4784089_4784725_+\|plate	phage baseplate assembly protein V	A0A2I8TV69	Erwinia_phage	2.1e-110	97.6
WP_000127178.1\|4784721_4785069_+	GPW/gp25 family protein	A0A218M4K8	Erwinia_phage	5.5e-57	99.1
WP_041037482.1\|4785075_4785984_+\|plate	baseplate assembly protein	A0A218M4K5	Erwinia_phage	1.9e-157	98.0
WP_041037484.1\|4785976_4786585_+\|tail	phage tail protein I	A0A218M4J3	Erwinia_phage	1.1e-111	97.0
WP_041037486.1\|4787627_4788056_+\|tail	tail assembly chaperone	A0A0F7LDZ0	Escherichia_phage	1.2e-16	37.8
WP_041037488.1\|4788187_4789366_+\|tail	phage tail sheath protein	Q37844	Escherichia_phage	3.1e-216	97.2
WP_001207674.1\|4789381_4789900_+\|tail	phage major tail tube protein	S4TNZ0	Salmonella_phage	6.5e-94	99.4
WP_041037492.1\|4789963_4790299_+\|tail	phage tail assembly protein	S4TTB2	Salmonella_phage	1.5e-51	97.3
WP_000763323.1\|4790331_4790451_+\|tail	GpE family phage tail protein	O80316	Escherichia_phage	1.4e-15	100.0
WP_041037494.1\|4790443_4792885_+\|tail	phage tail tape measure protein	A0A0M3UL85	Salmonella_phage	9.6e-305	85.4
WP_041038173.1\|4792896_4793382_+\|tail	phage tail protein	S4TUC3	Salmonella_phage	3.2e-79	90.7
WP_041037496.1\|4793378_4794548_+	phage late control D family protein	S4TRX8	Salmonella_phage	1.4e-208	98.5
WP_000468311.1\|4794625_4794844_+	DNA-binding transcriptional regulator	S4TNZ3	Salmonella_phage	4.7e-38	100.0
WP_032448435.1\|4794879_4795296_-	hypothetical protein	S4TTB4	Salmonella_phage	1.0e-33	52.3
WP_041037498.1\|4795552_4796455_+	CDF family cation-efflux transporter FieF	NA	NA	NA	NA
WP_004931116.1\|4796686_4797649_+	6-phosphofructokinase	NA	NA	NA	NA
WP_033636447.1\|4797835_4798825_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004931113.1\|4798890_4799658_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_033636444.1\|4799785_4800370_-	YiiQ family protein	NA	NA	NA	NA
WP_033639143.1\|4800569_4800989_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_041037503.1\|4801000_4801747_-	ferredoxin--NADP(+) reductase	NA	NA	NA	NA
WP_041037505.1\|4801750_4802362_-	HTH domain-containing protein	NA	NA	NA	NA
WP_033649888.1\|4802659_4803844_+	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	4.1e-11	25.3
WP_033654536.1\|4804036_4805047_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_033654537.1\|4805177_4806686_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_004931095.1\|4806728_4807574_-	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	2.0e-15	28.7
WP_004931092.1\|4808098_4808338_+	septal ring assembly protein ZapB	NA	NA	NA	NA
WP_004931090.1\|4808398_4808884_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_033636436.1\|4808959_4809877_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_033636435.1\|4809973_4811308_-	HslU--HslV peptidase ATPase subunit	A0A173GFL6	Erwinia_phage	3.8e-45	29.0
WP_033649891.1\|4811320_4811851_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_041037508.1\|4811953_4812886_-	cell division protein FtsN	NA	NA	NA	NA
WP_004931082.1\|4812951_4813980_-	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_033654545.1\|4814271_4816467_-	primosomal protein N'	NA	NA	NA	NA
WP_004931078.1\|4816666_4816882_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_006317756.1\|4816959_4817277_-	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_041037511.1\|4817581_4818742_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_041037513.1\|4818744_4821180_+	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_033636430.1\|4821408_4822305_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_033638623.1\|4822416_4825053_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_041037515.1\|4825310_4826456_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_033636428.1\|4826672_4827677_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_033636427.1\|4827697_4828471_+	acetylglutamate kinase	NA	NA	NA	NA
WP_019452247.1\|4828496_4829717_+	argininosuccinate synthase	NA	NA	NA	NA
WP_041037518.1\|4829785_4831159_+	argininosuccinate lyase	NA	NA	NA	NA
WP_033654540.1\|4831195_4831522_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_041037519.1\|4831704_4833153_-	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_019452251.1\|4833225_4833957_-	glutathione peroxidase	A0A1D8KSL1	Synechococcus_phage	1.4e-46	57.2
WP_033636422.1\|4834108_4835026_+	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_004931047.1\|4835008_4836406_-	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_004931044.1\|4836623_4837256_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
4836935:4836954	attR	NA	NA	NA	NA
WP_033649905.1\|4837271_4837643_+	YijD family membrane protein	NA	NA	NA	NA
WP_033636420.1\|4837677_4838781_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA

DBSCAN-SWA_8

5037217 : 5085083

Shigella_phage(23.08%)

tRNA,transposase,integrase

attL 5039996:5040014|attR 5090855:5090873

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015376459.1\|5037217_5037982_+\|tRNA	tRNA hydroxylase	NA	NA	NA	NA
WP_033636871.1\|5037997_5039605_-	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0S9J5	Catovirus	3.2e-59	30.3
WP_041037659.1\|5039831_5040335_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
5039996:5040014	attL	NA	NA	NA	NA
WP_033648627.1\|5040535_5043412_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.0e-140	36.0
WP_033631663.1\|5043424_5043874_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_033636874.1\|5043958_5045470_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.3e-46	37.4
WP_041037661.1\|5045752_5046847_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_033636876.1\|5046846_5047917_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_033636877.1\|5047979_5048738_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_033636878.1\|5048938_5049655_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_080289878.1\|5049655_5050348_-	acyl-homoserine-lactone synthase	NA	NA	NA	NA
WP_041037663.1\|5051558_5051951_-	VOC family protein	NA	NA	NA	NA
WP_041037665.1\|5051952_5053284_-	L-fucose:H+ symporter permease	NA	NA	NA	NA
WP_041037667.1\|5053280_5054810_-	pentose kinase	NA	NA	NA	NA
WP_041037669.1\|5054876_5055626_-	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_033636884.1\|5055781_5057164_-	gluconate permease	NA	NA	NA	NA
WP_033652796.1\|5057166_5058132_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_041037671.1\|5058162_5058930_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.2e-49	46.0
WP_154232829.1\|5058985_5059240_-	hypothetical protein	NA	NA	NA	NA
WP_172668124.1\|5061205_5061439_-\|transposase	transposase	U5P429	Shigella_phage	2.5e-13	49.3
WP_154232831.1\|5061410_5061812_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	2.2e-17	44.3
WP_080335461.1\|5062148_5062352_-\|transposase	transposase	NA	NA	NA	NA
WP_041037674.1\|5062584_5065740_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	7.5e-68	29.4
WP_034917146.1\|5065774_5066821_-	hypothetical protein	NA	NA	NA	NA
WP_041037676.1\|5066825_5068166_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_041037678.1\|5068155_5069712_-	SAM-dependent DNA methyltransferase	A0A2H4UVW8	Bodo_saltans_virus	2.0e-05	22.1
WP_154232832.1\|5070307_5071443_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.6e-79	55.0
WP_080335462.1\|5071520_5072261_-	hypothetical protein	NA	NA	NA	NA
WP_041037685.1\|5073378_5075175_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_041037687.1\|5075267_5076137_-	HNH endonuclease	NA	NA	NA	NA
WP_041037689.1\|5077557_5078766_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.4e-46	45.7
WP_041037691.1\|5078855_5079974_-	HNH endonuclease	NA	NA	NA	NA
WP_041037693.1\|5080209_5080518_-	hypothetical protein	NA	NA	NA	NA
WP_080335463.1\|5080412_5080655_-	ash family protein	NA	NA	NA	NA
WP_041037695.1\|5081038_5081863_+	hypothetical protein	NA	NA	NA	NA
WP_128884582.1\|5081867_5082179_+	hypothetical protein	NA	NA	NA	NA
WP_041037699.1\|5082305_5082605_+	hypothetical protein	NA	NA	NA	NA
WP_041037701.1\|5082777_5083170_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	7.2e-45	68.1
WP_041037703.1\|5083166_5083514_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.7e-58	93.0
WP_041037705.1\|5083544_5085083_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	5.9e-268	89.8
5090855:5090873	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP013064

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_AP013063

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection