CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	2 crisprs	csa3,c2c10_CAS-V-U3,RT,cas14j	0	15	16	0
NZ_CP009300	Bacillus cereus D17 chromosome, complete genome	6 crisprs	cas3,csa3,RT,DEDDh,cas14j,WYL,cas14k,DinG,c2c9_V-U4	20	20	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009299_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009299_1

100855-101150

TypeV-U3?,TypeI-A

V-U3

Consensus_repeat	Method
ATTTCAATACATCTATTGTTATGTTTTAAC	CRISPRCasFinder
ATTTCAATACATCTATTGTTNTGTTTTAAC	CRT
ATTTCAATACATCTATTGTTATGTTTTAACAA	PILER-CR

4 spacers

csa3,c2c10_CAS-V-U3

The CRISPR arrays of NZ_CP009299_1

>merge|NZ_CP009299|1|100855-101150|CRISPRCasFinder,CRT,PILER-CR
ACTCCTATATATCTATCGTGTTGTTTAAACTTCGCAATGATTTTGTGAAGTGCCGAGCGTCTCCCCAATTTCAATACATCTATTGTTTTGTTTTAACAAGGAATAGAAAGGAGCAAAATATATTGTGGGTAATAATTTCAATACATCTATTGTTATGTTTTAACCAGTTTCTCTTATCGCCTTATAAAAACAATACATATTTCAATACATCTATTGTTATGTTTTAACGAAATACTGAGACGAATGAATTATCTGTCGCTATACAATTTCAATACATCTATTGTTATGTTTTAACC

>NZ_CP009299|1|1|100855-101150|CRISPRCasFinder
ACTCCTATATATCTATCGTGTTGTTTAAAC	TTCGCAATGATTTTGTGAAGTGCCGAGCGTCTCCCCA
ATTTCAATACATCTATTGTTTTGTTTTAAC	AAGGAATAGAAAGGAGCAAAATATATTGTGGGTAATA
ATTTCAATACATCTATTGTTATGTTTTAAC	CAGTTTCTCTTATCGCCTTATAAAAACAATACAT
ATTTCAATACATCTATTGTTATGTTTTAAC	GAAATACTGAGACGAATGAATTATCTGTCGCTATACA
ATTTCAATACATCTATTGTTATGTTTTAACC

>NZ_CP009299|1|1|100855-101149|CRT
ACTCCTATATATCTATCGTGTTGTTTAAAC	TTCGCAATGATTTTGTGAAGTGCCGAGCGTCTCCCCA
ATTTCAATACATCTATTGTTTTGTTTTAAC	AAGGAATAGAAAGGAGCAAAATATATTGTGGGTAATA
ATTTCAATACATCTATTGTTATGTTTTAAC	CAGTTTCTCTTATCGCCTTATAAAAACAATACAT
ATTTCAATACATCTATTGTTATGTTTTAAC	GAAATACTGAGACGAATGAATTATCTGTCGCTATACA
ATTTCAATACATCTATTGTTATGTTTTAAC

>NZ_CP009299|1|1|100922-101084|PILER-CR
ATTTCAATACATCTATTGTTTTGTTTTAACAA	GGAATAGAAAGGAGCAAAATATATTGTGGGTAATA
ATTTCAATACATCTATTGTTATGTTTTAACCA	GTTTCTCTTATCGCCTTATAAAAACAATACAT
ATTTCAATACATCTATTGTTATGTTTTAACGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009299.1\|WP_042512120.1\|110340_113631_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350768
NZ_CP009299.1\|WP_002073819.1\|101934_103296_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c10_CAS-V-U3	-	gnl\|CDD\|284650
NZ_CP009299.1\|WP_000916407.1\|106771_107362_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512115.1\|96712_96916_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_000866031.1\|105607_106246_-\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
NZ_CP009299.1\|WP_000207868.1\|95504_95798_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009299.1\|WP_042512111.1\|92209_92587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512118.1\|98040_100704_-\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NZ_CP009299.1\|WP_042512112.1\|93597_94692_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP009299.1\|WP_071713414.1\|106262_106646_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_000494367.1\|109610_110324_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_002073821.1\|107381_107960_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512119.1\|103421_105251_+\|DUF4365-domain-containing-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512116.1\|96967_97612_-\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP009299.1\|WP_000817906.1\|108010_108646_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_000751014.1\|94688_94820_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_001024815.1\|108645_109275_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512114.1\|95870_96308_-\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
NZ_CP009299.1\|WP_000084559.1\|96351_96639_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512113.1\|95011_95197_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|274101

Protein	Function_ID	Function_description	E-value
NZ_CP009299.1\|WP_042512120.1\|110340_113631_-\|hypothetical-protein	gnl\|CDD\|350768	cd18010, DEXHc_HARP_SMARCAL1, DEXH-box helicase domain of SMARCAL1. SMARCAL1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1, also known as HARP) is recruited to stalled replication forks to promote repair and helps restart replication. It plays a role in DNA repair, telomere maintenance and replication fork stability in response to DNA replication stress. Mutations cause Schimke Immunoosseous Dysplasia. SMARCAL1 is part of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	0.000303389
NZ_CP009299.1\|WP_042512112.1\|93597_94692_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.2592e-20
NZ_CP009299.1\|WP_002073819.1\|101934_103296_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	3.32739e-21
NZ_CP009299.1\|WP_042512116.1\|96967_97612_-\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	1.67397e-31
NZ_CP009299.1\|WP_042512114.1\|95870_96308_-\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	2.24357e-36
NZ_CP009299.1\|WP_000207868.1\|95504_95798_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.42374e-11
NZ_CP009299.1\|WP_042512118.1\|98040_100704_-\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	1.77096e-130
NZ_CP009299.1\|WP_042512113.1\|95011_95197_+\|RNA-chaperone-Hfq	gnl\|CDD\|274101	TIGR02383, RNA-binding_protein_Hfq, RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see . The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication. [Regulatory functions, Other].	1.49921e-23
NZ_CP009299.1\|WP_000866031.1\|105607_106246_-\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	4.10175e-25

>NZ_CP009299.1|WP_042512118.1|98040_100704_-|type-IA-DNA-topoisomerase
MGKTLFIAEKPKVANEIMKSPRFRHSQKYTGSKPYYGYYENDHYIVSWCRGHLLELKNPEEMDPKYKVFSLEHLPLIYEPAYKVKQENAEQLQILVKLLQRPDVDHAVNICDADREGELIYREVYEFAGVNKKQSRVYKSSFEAAELERALNRLESASKYDGLAYSAKARQYLDYLLGMNITRGCTTKLAQNKFLLSSGRVQMCLLNEIRQRELAIENYREQSYYHLQLITDLGLKPVMKTEDPVLNPSPLRSLGEDLKGQYLVVEEFKEGTRKKNPKLLYNLTDLYKDAHAQLQINAETSRKHIQTLYEEGFITYPRSSSRHLPTEQVDRVKGVMQALAKSQYSFLVQSVDIEAIDVKHKTFNDELVSSHFAIIPTTKQYQEEGRPEIEKQLYSLVVKRFVGNFMRPAVYLVREVSLIDAMGNIYQTKESVLREKGFLEVFQEEVEEESVEVFKIPIMQKGQELQICDFELQESKTKKPALHTESSILTFMETAGRKIDDEHLKELMKGKRIGTVATEATFIPALHEKNYIAIEKGKITTTPIGRSFIEQFPVSQVKDPLYTAEMEGMIYRIEKNEMSYKEFIVQTNEFIQKITQEIIKIPDAVSYNLIENWKQQIEVCKCPCGNGIILDRGKFFGCSNHPNCNVGFPKRIKEKTIPAAQVKKLFEENKTDVIKGFKSNGKEFSAYLAFINGEVSFNLPTVEELSLGRCPKCQNGHILKRDTFFGCSDYQSGCNFAIFAKIKGKKLSDSQIKKLLKNRVTDFIHGFKGDYGEFTAAIRLKEDLRICFERPTTADRTVGKCPLCQSRVIIGKTNYLCEQYKKDCDFIISGMILEKKITANQIKKLLEKNMTDTIQGFKSKKTGELFGAKLTYDSAQKRLTFINEKKK
>NZ_CP009299.1|WP_042512116.1|96967_97612_-|thermonuclease-family-protein
MKIWIKAICITSFVIQMSACSSSAQTKIDSRPAQAVQNGIQRHVEGKGIVDIPEAYKGKLKGLETVKGKVLHIKDGDTIDVNVKGQKQTVRLLLLDTPESVSQKIPPQKMGKEASSFLKKQLDGKSVTLVYDQGPKEDKYGRKLAYIFCNGIHINELMAKSGYGIVAYISKPNTTLLPEMLEAEKEAKEAMAGVWSIKGFVNEKKRHYNRNDAA
>NZ_CP009299.1|WP_042512115.1|96712_96916_-|hypothetical-protein
MDENKRNMLLSFIISILFIFASLLPFSNNEYVYVISKIGAAAGVINIVTMSVFLYFQSKKTGHLLNQ
>NZ_CP009299.1|WP_000084559.1|96351_96639_-|hypothetical-protein
MSQVPGFLKFVLAKERRYVYLVVAEKKNKKIHTHMVYRFGPLEKALETMYEMRGDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY
>NZ_CP009299.1|WP_042512114.1|95870_96308_-|disulfide-bond-formation-protein-B
MSIIQKYHIAIAWTIATSAMLISLIFSEWMKLPPCNLCWYQRMAMYPLVLILGIGMYRKDPNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTEDYLNLFGFISIPMLSFVGFLAIIILLYIKPDKETKEQITQRL
>NZ_CP009299.1|WP_000207868.1|95504_95798_-|winged-helix-turn-helix-transcriptional-regulator
MTTIQASNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNVTQLTELLDIPQSTVSQHLSKMRGKILRSERRGLEMYYHIVNSKACQIVSVLGL
>NZ_CP009299.1|WP_042512113.1|95011_95197_+|RNA-chaperone-Hfq
MHTQEDFYTKLIEEKRLVTIFLLNGIRVPGIIIAVDKFSVLVSSHGKQQFIYKQAISTVSL
>NZ_CP009299.1|WP_000751014.1|94688_94820_+|hypothetical-protein
MKKTILGLAGVITIFTLMFGAQSPTETQKAIDVIQYAHGNHGG
>NZ_CP009299.1|WP_042512112.1|93597_94692_+|tetratricopeptide-repeat-protein
MIVSTKGNNEITKLLNDWYLEIRSRRIGNAHQLKEIIDTKIHSIEEDQNLLLYYSLLDFRYQFVIDNLSVSKSSFDKVEAFDMPTDNFLAYYYHFFKGIHASTIGEYQIAKESYENAEKLLDCIPDELEKAEFYYKVGAFHYDIYQGLLSYKKVSEAREIFAQHAGYEINVAFCDNLIGLACTHLREWELAEEYFTKAMDMFQKINEEQFILMVRQNLGLMYATQNLSPLAIRYLSEVNQKMPNNYKALFIEAREHMKEGNHSVAKDLIVKGHSICEEVANIEYLHHFKILDAMNGDFPAEALERTVLEGVSYFKEQELFEYIKEYEEYLATAFYKENNHVKASCYFYSCSQAGKKAFEKEALK
>NZ_CP009299.1|WP_042512111.1|92209_92587_-|hypothetical-protein
MKHSIGNVSTSYIIRLILNDLDTFITGGKRQFNFCSESGISPVEELIADWLEWFNDYPQGISPDELKGIKREIGELMGSMSIWCHHIEEREGFIKQFSDYFGEYIGFCKLVRDVYLEELKDESSY
>NZ_CP009299.1|WP_002073819.1|101934_103296_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MTYLSTVVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQKLWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQKTIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIKENDLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGACMLHKHKKKWYLSITYKSNIKEELKFDEDLIMGIDMGKINVLYFAFNKGLVRGGISGEEIEAFRKKIEHRRISLLRQGKYCSGNRIGKGRKKRIKPIEVLNDKIAKFRNATNHKYANYIVQQCLKYNCGTIQLEDLQGISKEQTFLKNWTYFDLQEKIKNQANQYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYNIEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN
>NZ_CP009299.1|WP_042512119.1|103421_105251_+|DUF4365-domain-containing-protein
MKKLNPLDNTIIEHLACLEINKCILQPPFHLQSNVQWNDKGLSFDGDINIYTNKIKKTDFIGTVPIQIKGTTKFKKIKKQQKIAHSISKEDLDVYYKNDNGVLFFVVTIHPETYVSQAYYKTLAPLDLKKLLDEIELTGQKSITVNFKKLEYGELENICKSFLNSLEKQSKRFIEDAKNIAFSQYKIEYGHVQNNVLVDLFEEQAYVYGVLNDVDFPIDIFQLQEMRKETDEIVTIGNETLRIKSVLKISKEIICLTIENSLTFEFSKKFVDGKLRLINGKVHLSKLKTLGSYVKSLKLLKYLLTYNKIPLSSFEIDTTLNEKETFKDIDENIKIHEELIQICKQIGISEDYIFDEKENLFILFNKIINIFKNKQYDLINFTPPLDKNSMVFCNIELSDYVMVTLLFDGYTAIDFFSVKAIKTMGAFLPKDGHVIDYDDANWREKIWKVSLYLNQSIENMERAANFKYEILELSFQDEHHDIDSLNSIDTHLKYISYFDEYSDEKYLKIAQDLIQRYLLKNPKDIIQKINPYQINLRLGNELSDDEINDILTIQENAQNKNDKILDYACEVLLQNRLKSKRLYESLKKDEQDTIKMYPIYHLYKNLISI
>NZ_CP009299.1|WP_000866031.1|105607_106246_-|NERD-domain-containing-protein
MKVLIFELVLIAILIPLNIVVKKHVPKWKGKAGEKLVKHILNKLDSESYCVLHDVTVHTEYGDTTQIDHIVIAETGVFVIETKNYEGWIYGNEKSARWTQGIFRKKSSFQNPFRQNYKHIKAIEWLMEQQLPSISIAAFHPKCSLKRVNVQSKDKHVLYYNDLQKCIESYTETQLTNDEVQHIYQTILRANIMDKDIEKKHVKYLHNKFAKQ
>NZ_CP009299.1|WP_071713414.1|106262_106646_-|hypothetical-protein
MKRNREYIALRNSILIGWLLTCIVIGLSIYFSSVVYLLIGCFILSLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIKGLCISYFILGLETHVYRLMRRNARV
>NZ_CP009299.1|WP_000916407.1|106771_107362_+|hypothetical-protein
MLKLVVDNTVTEPEPKTDSAFSNYFTCKDCVYYLSKSDSCSLQLAADSNSPLIPYECGNFEETYEIGTEDPLNSHIHQRLREEKAQILDESYPAQPAIDPIHKDAIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNMSSKKYASPFPLHDHGAKEGIRHYMCWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNY
>NZ_CP009299.1|WP_002073821.1|107381_107960_+|hypothetical-protein
MLEHTILFSLVQLVPLILSTGIIYILLELTDTEWKTWFSYEGIFTIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLVSIFLVFFASIPTLLKIAFILQMTVILLLLEYLCLYIDRLPIHNLYRIQEIICDKKQLKIERIILNNAEHGTHTIKTRDEQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR
>NZ_CP009299.1|WP_000817906.1|108010_108646_-|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLQAAQASVKIDFNELKGNDVSSSFTDGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NZ_CP009299.1|WP_001024815.1|108645_109275_-|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLFYAAEGNEIKLKSIKPKLAGDV
>NZ_CP009299.1|WP_000494367.1|109610_110324_-|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSRKKFLIEEAKKKEMENKPVERPVYWCPRENRPIGREQERVTVPTKEITLEKDVANIYDLVATSVHKNLGEEESNRLKHEDIEEVEYADAFHHTPTPEVVYDIPFPSDEDIPEELLEYEDMYSQQEYVSIPPETEHVFPVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVDSPYSYTLVEWSNRQLGNI
>NZ_CP009299.1|WP_042512120.1|110340_113631_-|hypothetical-protein
MLQEMIQQDTFDQEQTPAMLQLETGTASHSAFCFAMAVNQNNQMQFAVLGANDSTLKSFRAAISMGTRRLYFGEGQKEELHYVLGKKMNVISTGQFEFINTQTVNRKKAIIAFSKELEEKYIVAIDEAPEMQVRDFLMAPPYGLPILEEWAKPIYEEMLTRKLLQPLDVYFDKNEFTSLSIAQVVLKEEDCKEFLSEMIRTGKCKFPQDGTGEKINEINDLNEYLLEYSPVMLDKVTKLDEPLHQPMKEQALSHFDTYQRPLFPVQAHVATGAAKALQVQKGIIIQGEMSSGKSAIMTATVDGYFHLTGKKGYRTCVFVPPTLTEKWAKEEIRHLIPDADVHLIKRTEDLIRIHQSWIQAGRPKPEKPTFFVISFTTMRGDSIKQMPLPYKQIALSKKSKEDVQRYYKNGYYCPDCGAKLRKKTSSIMVQQANGDQKEVCQYKDFTGSDLDSKTNKNSVCADCNSNIWSPKVKTKYASFKDWTKYENKLVQAIKEGNKPLQKQLELENRVKPYEAKQSGRAYRKVATVEYIRRKMKHFFDALICDEVHELKSETAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKRGFEYSSLMEWNETYGNIERTYYHDGEVVSNVASRGAQGMLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELINVPTILVEMSEEQKKAYEHMKGSFEKAIEGAKGTPDVWKLWLSYIRTGNSYPDNMNHYPNYHLDNAEKELVWSNEEFRFDEDCIQPKEKKLQEILQTEISEGRPTIIYVSDTGSTVKERDIQPRLQKVAEQVPGAKVSILRTNTVAPPKRSAWLKEQVSSGVNVIICSQELVKVGLDLLATPTIIFYQLSFSLFTLNQAARRHWRIGQTKQCRTFYLGYKETFQAQMAQLIAQKNKAAEAMNGDATSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVEKLPETMDVAFMKEAQFVQSAVECIKKEQVPGVRVKQNVLEVDGEIEDIIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKEKRKNKVIDGQYEFDLFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009299_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009299_2

101445-101673

TypeV-U3?,TypeI-A

V-U3:NA

Consensus_repeat	Method
ATTTCAATACATCTATTGTTATGTTTTAAC	CRISPRCasFinder
ATTTCAATACATCTATTGTT	CRT
ATTTCAATACATCTATTGTTATGTTTTAAC	PILER-CR

3 spacers

csa3,c2c10_CAS-V-U3

The CRISPR arrays of NZ_CP009299_2

>merge|NZ_CP009299|2|101445-101673|CRISPRCasFinder,CRT,PILER-CR
TTTTAAATACATCTATTGTTCTGTTTTAACGATTGACGACATTGTTCAATAGTTGTAATCTTGTTTGATTTCAATACATCTATTGTTCTGTTTTAACAATCCACATAGCATACGGTGTCATATAATGACTTAAATTTCAATACATCTATTGTTATGTTTTAACGGATAATGGCCGTTATCACATTGTAGAGGTGGATCAATTTCAATACATCTATTGTTATGTTTTAAC

>NZ_CP009299|2|2|101445-101673|CRISPRCasFinder
TTTTAAATACATCTATTGTTCTGTTTTAAC	GATTGACGACATTGTTCAATAGTTGTAATCTTGTTTG
ATTTCAATACATCTATTGTTCTGTTTTAAC	AATCCACATAGCATACGGTGTCATATAATGACTTAA
ATTTCAATACATCTATTGTTATGTTTTAAC	GGATAATGGCCGTTATCACATTGTAGAGGTGGATCA
ATTTCAATACATCTATTGTTATGTTTTAAC

>NZ_CP009299|2|2|101445-101663|CRT
TTTTAAATACATCTATTGTT	CTGTTTTAACGATTGACGACATTGTTCAATAGTTGTAATCTTGTTTG
ATTTCAATACATCTATTGTT	CTGTTTTAACAATCCACATAGCATACGGTGTCATATAATGACTTAA
ATTTCAATACATCTATTGTT	ATGTTTTAACGGATAATGGCCGTTATCACATTGTAGAGGTGGATCA
ATTTCAATACATCTATTGTT

>NZ_CP009299|2|2|101446-101673|PILER-CR
TTTAAATACATCTATTGTTCTGTTTTAACG	ATTGACGACATTGTTCAATAGTTGTAATCTTGTTTGA
TTTCAATACATCTATTGTTCTGTTTTAACA	ATCCACATAGCATACGGTGTCATATAATGACTTAAA
TTTCAATACATCTATTGTTATGTTTTAACG	GATAATGGCCGTTATCACATTGTAGAGGTGGATCAA
TTTCAATACATCTATTGTTATGTTTTAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009299.1\|WP_042512120.1\|110340_113631_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350768
NZ_CP009299.1\|WP_002073819.1\|101934_103296_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c10_CAS-V-U3	-	gnl\|CDD\|284650
NZ_CP009299.1\|WP_000916407.1\|106771_107362_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512115.1\|96712_96916_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_000866031.1\|105607_106246_-\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
NZ_CP009299.1\|WP_000207868.1\|95504_95798_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009299.1\|WP_042512111.1\|92209_92587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512118.1\|98040_100704_-\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NZ_CP009299.1\|WP_042512112.1\|93597_94692_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP009299.1\|WP_071713414.1\|106262_106646_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_000494367.1\|109610_110324_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_002073821.1\|107381_107960_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512119.1\|103421_105251_+\|DUF4365-domain-containing-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512116.1\|96967_97612_-\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP009299.1\|WP_000817906.1\|108010_108646_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_000751014.1\|94688_94820_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_001024815.1\|108645_109275_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512114.1\|95870_96308_-\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
NZ_CP009299.1\|WP_000084559.1\|96351_96639_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009299.1\|WP_042512113.1\|95011_95197_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|274101

Protein	Function_ID	Function_description	E-value
NZ_CP009299.1\|WP_042512120.1\|110340_113631_-\|hypothetical-protein	gnl\|CDD\|350768	cd18010, DEXHc_HARP_SMARCAL1, DEXH-box helicase domain of SMARCAL1. SMARCAL1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1, also known as HARP) is recruited to stalled replication forks to promote repair and helps restart replication. It plays a role in DNA repair, telomere maintenance and replication fork stability in response to DNA replication stress. Mutations cause Schimke Immunoosseous Dysplasia. SMARCAL1 is part of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	0.000303389
NZ_CP009299.1\|WP_042512112.1\|93597_94692_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.2592e-20
NZ_CP009299.1\|WP_002073819.1\|101934_103296_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	3.32739e-21
NZ_CP009299.1\|WP_042512116.1\|96967_97612_-\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	1.67397e-31
NZ_CP009299.1\|WP_042512114.1\|95870_96308_-\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	2.24357e-36
NZ_CP009299.1\|WP_000207868.1\|95504_95798_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.42374e-11
NZ_CP009299.1\|WP_042512118.1\|98040_100704_-\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	1.77096e-130
NZ_CP009299.1\|WP_042512113.1\|95011_95197_+\|RNA-chaperone-Hfq	gnl\|CDD\|274101	TIGR02383, RNA-binding_protein_Hfq, RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see . The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication. [Regulatory functions, Other].	1.49921e-23
NZ_CP009299.1\|WP_000866031.1\|105607_106246_-\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	4.10175e-25

>NZ_CP009299.1|WP_042512118.1|98040_100704_-|type-IA-DNA-topoisomerase
MGKTLFIAEKPKVANEIMKSPRFRHSQKYTGSKPYYGYYENDHYIVSWCRGHLLELKNPEEMDPKYKVFSLEHLPLIYEPAYKVKQENAEQLQILVKLLQRPDVDHAVNICDADREGELIYREVYEFAGVNKKQSRVYKSSFEAAELERALNRLESASKYDGLAYSAKARQYLDYLLGMNITRGCTTKLAQNKFLLSSGRVQMCLLNEIRQRELAIENYREQSYYHLQLITDLGLKPVMKTEDPVLNPSPLRSLGEDLKGQYLVVEEFKEGTRKKNPKLLYNLTDLYKDAHAQLQINAETSRKHIQTLYEEGFITYPRSSSRHLPTEQVDRVKGVMQALAKSQYSFLVQSVDIEAIDVKHKTFNDELVSSHFAIIPTTKQYQEEGRPEIEKQLYSLVVKRFVGNFMRPAVYLVREVSLIDAMGNIYQTKESVLREKGFLEVFQEEVEEESVEVFKIPIMQKGQELQICDFELQESKTKKPALHTESSILTFMETAGRKIDDEHLKELMKGKRIGTVATEATFIPALHEKNYIAIEKGKITTTPIGRSFIEQFPVSQVKDPLYTAEMEGMIYRIEKNEMSYKEFIVQTNEFIQKITQEIIKIPDAVSYNLIENWKQQIEVCKCPCGNGIILDRGKFFGCSNHPNCNVGFPKRIKEKTIPAAQVKKLFEENKTDVIKGFKSNGKEFSAYLAFINGEVSFNLPTVEELSLGRCPKCQNGHILKRDTFFGCSDYQSGCNFAIFAKIKGKKLSDSQIKKLLKNRVTDFIHGFKGDYGEFTAAIRLKEDLRICFERPTTADRTVGKCPLCQSRVIIGKTNYLCEQYKKDCDFIISGMILEKKITANQIKKLLEKNMTDTIQGFKSKKTGELFGAKLTYDSAQKRLTFINEKKK
>NZ_CP009299.1|WP_042512116.1|96967_97612_-|thermonuclease-family-protein
MKIWIKAICITSFVIQMSACSSSAQTKIDSRPAQAVQNGIQRHVEGKGIVDIPEAYKGKLKGLETVKGKVLHIKDGDTIDVNVKGQKQTVRLLLLDTPESVSQKIPPQKMGKEASSFLKKQLDGKSVTLVYDQGPKEDKYGRKLAYIFCNGIHINELMAKSGYGIVAYISKPNTTLLPEMLEAEKEAKEAMAGVWSIKGFVNEKKRHYNRNDAA
>NZ_CP009299.1|WP_042512115.1|96712_96916_-|hypothetical-protein
MDENKRNMLLSFIISILFIFASLLPFSNNEYVYVISKIGAAAGVINIVTMSVFLYFQSKKTGHLLNQ
>NZ_CP009299.1|WP_000084559.1|96351_96639_-|hypothetical-protein
MSQVPGFLKFVLAKERRYVYLVVAEKKNKKIHTHMVYRFGPLEKALETMYEMRGDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY
>NZ_CP009299.1|WP_042512114.1|95870_96308_-|disulfide-bond-formation-protein-B
MSIIQKYHIAIAWTIATSAMLISLIFSEWMKLPPCNLCWYQRMAMYPLVLILGIGMYRKDPNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTEDYLNLFGFISIPMLSFVGFLAIIILLYIKPDKETKEQITQRL
>NZ_CP009299.1|WP_000207868.1|95504_95798_-|winged-helix-turn-helix-transcriptional-regulator
MTTIQASNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNVTQLTELLDIPQSTVSQHLSKMRGKILRSERRGLEMYYHIVNSKACQIVSVLGL
>NZ_CP009299.1|WP_042512113.1|95011_95197_+|RNA-chaperone-Hfq
MHTQEDFYTKLIEEKRLVTIFLLNGIRVPGIIIAVDKFSVLVSSHGKQQFIYKQAISTVSL
>NZ_CP009299.1|WP_000751014.1|94688_94820_+|hypothetical-protein
MKKTILGLAGVITIFTLMFGAQSPTETQKAIDVIQYAHGNHGG
>NZ_CP009299.1|WP_042512112.1|93597_94692_+|tetratricopeptide-repeat-protein
MIVSTKGNNEITKLLNDWYLEIRSRRIGNAHQLKEIIDTKIHSIEEDQNLLLYYSLLDFRYQFVIDNLSVSKSSFDKVEAFDMPTDNFLAYYYHFFKGIHASTIGEYQIAKESYENAEKLLDCIPDELEKAEFYYKVGAFHYDIYQGLLSYKKVSEAREIFAQHAGYEINVAFCDNLIGLACTHLREWELAEEYFTKAMDMFQKINEEQFILMVRQNLGLMYATQNLSPLAIRYLSEVNQKMPNNYKALFIEAREHMKEGNHSVAKDLIVKGHSICEEVANIEYLHHFKILDAMNGDFPAEALERTVLEGVSYFKEQELFEYIKEYEEYLATAFYKENNHVKASCYFYSCSQAGKKAFEKEALK
>NZ_CP009299.1|WP_042512111.1|92209_92587_-|hypothetical-protein
MKHSIGNVSTSYIIRLILNDLDTFITGGKRQFNFCSESGISPVEELIADWLEWFNDYPQGISPDELKGIKREIGELMGSMSIWCHHIEEREGFIKQFSDYFGEYIGFCKLVRDVYLEELKDESSY
>NZ_CP009299.1|WP_002073819.1|101934_103296_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MTYLSTVVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQKLWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQKTIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIKENDLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGACMLHKHKKKWYLSITYKSNIKEELKFDEDLIMGIDMGKINVLYFAFNKGLVRGGISGEEIEAFRKKIEHRRISLLRQGKYCSGNRIGKGRKKRIKPIEVLNDKIAKFRNATNHKYANYIVQQCLKYNCGTIQLEDLQGISKEQTFLKNWTYFDLQEKIKNQANQYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYNIEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN
>NZ_CP009299.1|WP_042512119.1|103421_105251_+|DUF4365-domain-containing-protein
MKKLNPLDNTIIEHLACLEINKCILQPPFHLQSNVQWNDKGLSFDGDINIYTNKIKKTDFIGTVPIQIKGTTKFKKIKKQQKIAHSISKEDLDVYYKNDNGVLFFVVTIHPETYVSQAYYKTLAPLDLKKLLDEIELTGQKSITVNFKKLEYGELENICKSFLNSLEKQSKRFIEDAKNIAFSQYKIEYGHVQNNVLVDLFEEQAYVYGVLNDVDFPIDIFQLQEMRKETDEIVTIGNETLRIKSVLKISKEIICLTIENSLTFEFSKKFVDGKLRLINGKVHLSKLKTLGSYVKSLKLLKYLLTYNKIPLSSFEIDTTLNEKETFKDIDENIKIHEELIQICKQIGISEDYIFDEKENLFILFNKIINIFKNKQYDLINFTPPLDKNSMVFCNIELSDYVMVTLLFDGYTAIDFFSVKAIKTMGAFLPKDGHVIDYDDANWREKIWKVSLYLNQSIENMERAANFKYEILELSFQDEHHDIDSLNSIDTHLKYISYFDEYSDEKYLKIAQDLIQRYLLKNPKDIIQKINPYQINLRLGNELSDDEINDILTIQENAQNKNDKILDYACEVLLQNRLKSKRLYESLKKDEQDTIKMYPIYHLYKNLISI
>NZ_CP009299.1|WP_000866031.1|105607_106246_-|NERD-domain-containing-protein
MKVLIFELVLIAILIPLNIVVKKHVPKWKGKAGEKLVKHILNKLDSESYCVLHDVTVHTEYGDTTQIDHIVIAETGVFVIETKNYEGWIYGNEKSARWTQGIFRKKSSFQNPFRQNYKHIKAIEWLMEQQLPSISIAAFHPKCSLKRVNVQSKDKHVLYYNDLQKCIESYTETQLTNDEVQHIYQTILRANIMDKDIEKKHVKYLHNKFAKQ
>NZ_CP009299.1|WP_071713414.1|106262_106646_-|hypothetical-protein
MKRNREYIALRNSILIGWLLTCIVIGLSIYFSSVVYLLIGCFILSLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIKGLCISYFILGLETHVYRLMRRNARV
>NZ_CP009299.1|WP_000916407.1|106771_107362_+|hypothetical-protein
MLKLVVDNTVTEPEPKTDSAFSNYFTCKDCVYYLSKSDSCSLQLAADSNSPLIPYECGNFEETYEIGTEDPLNSHIHQRLREEKAQILDESYPAQPAIDPIHKDAIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNMSSKKYASPFPLHDHGAKEGIRHYMCWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNY
>NZ_CP009299.1|WP_002073821.1|107381_107960_+|hypothetical-protein
MLEHTILFSLVQLVPLILSTGIIYILLELTDTEWKTWFSYEGIFTIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLVSIFLVFFASIPTLLKIAFILQMTVILLLLEYLCLYIDRLPIHNLYRIQEIICDKKQLKIERIILNNAEHGTHTIKTRDEQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR
>NZ_CP009299.1|WP_000817906.1|108010_108646_-|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLQAAQASVKIDFNELKGNDVSSSFTDGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NZ_CP009299.1|WP_001024815.1|108645_109275_-|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLFYAAEGNEIKLKSIKPKLAGDV
>NZ_CP009299.1|WP_000494367.1|109610_110324_-|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSRKKFLIEEAKKKEMENKPVERPVYWCPRENRPIGREQERVTVPTKEITLEKDVANIYDLVATSVHKNLGEEESNRLKHEDIEEVEYADAFHHTPTPEVVYDIPFPSDEDIPEELLEYEDMYSQQEYVSIPPETEHVFPVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVDSPYSYTLVEWSNRQLGNI
>NZ_CP009299.1|WP_042512120.1|110340_113631_-|hypothetical-protein
MLQEMIQQDTFDQEQTPAMLQLETGTASHSAFCFAMAVNQNNQMQFAVLGANDSTLKSFRAAISMGTRRLYFGEGQKEELHYVLGKKMNVISTGQFEFINTQTVNRKKAIIAFSKELEEKYIVAIDEAPEMQVRDFLMAPPYGLPILEEWAKPIYEEMLTRKLLQPLDVYFDKNEFTSLSIAQVVLKEEDCKEFLSEMIRTGKCKFPQDGTGEKINEINDLNEYLLEYSPVMLDKVTKLDEPLHQPMKEQALSHFDTYQRPLFPVQAHVATGAAKALQVQKGIIIQGEMSSGKSAIMTATVDGYFHLTGKKGYRTCVFVPPTLTEKWAKEEIRHLIPDADVHLIKRTEDLIRIHQSWIQAGRPKPEKPTFFVISFTTMRGDSIKQMPLPYKQIALSKKSKEDVQRYYKNGYYCPDCGAKLRKKTSSIMVQQANGDQKEVCQYKDFTGSDLDSKTNKNSVCADCNSNIWSPKVKTKYASFKDWTKYENKLVQAIKEGNKPLQKQLELENRVKPYEAKQSGRAYRKVATVEYIRRKMKHFFDALICDEVHELKSETAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKRGFEYSSLMEWNETYGNIERTYYHDGEVVSNVASRGAQGMLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELINVPTILVEMSEEQKKAYEHMKGSFEKAIEGAKGTPDVWKLWLSYIRTGNSYPDNMNHYPNYHLDNAEKELVWSNEEFRFDEDCIQPKEKKLQEILQTEISEGRPTIIYVSDTGSTVKERDIQPRLQKVAEQVPGAKVSILRTNTVAPPKRSAWLKEQVSSGVNVIICSQELVKVGLDLLATPTIIFYQLSFSLFTLNQAARRHWRIGQTKQCRTFYLGYKETFQAQMAQLIAQKNKAAEAMNGDATSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVEKLPETMDVAFMKEAQFVQSAVECIKKEQVPGVRVKQNVLEVDGEIEDIIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKEKRKNKVIDGQYEFDLFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009299_1	1.1\|100885\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100885-100921	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	100885-100921	0	1.0
NZ_CP009299_1	1.1\|100885\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100885-100921	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76506-76542	0	1.0
NZ_CP009299_1	1.1\|100885\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100885-100921	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193642-193678	0	1.0
NZ_CP009299_1	1.2\|100952\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100952-100988	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76439-76475	0	1.0
NZ_CP009299_1	1.2\|100952\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100952-100988	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	100952-100988	0	1.0
NZ_CP009299_1	1.2\|100952\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100952-100988	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193575-193611	0	1.0
NZ_CP009299_1	1.3\|101019\|34\|NZ_CP009299\|CRISPRCasFinder,CRT	101019-101052	34	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76375-76408	0	1.0
NZ_CP009299_1	1.3\|101019\|34\|NZ_CP009299\|CRISPRCasFinder,CRT	101019-101052	34	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101019-101052	0	1.0
NZ_CP009299_1	1.3\|101019\|34\|NZ_CP009299\|CRISPRCasFinder,CRT	101019-101052	34	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193511-193544	0	1.0
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76308-76344	0	1.0
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193444-193480	0	1.0
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101083-101119	0	1.0
NZ_CP009299_1	1.5\|100954\|35\|NZ_CP009299\|PILER-CR	100954-100988	35	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76439-76473	0	1.0
NZ_CP009299_1	1.5\|100954\|35\|NZ_CP009299\|PILER-CR	100954-100988	35	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	100954-100988	0	1.0
NZ_CP009299_1	1.5\|100954\|35\|NZ_CP009299\|PILER-CR	100954-100988	35	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193575-193609	0	1.0
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76375-76406	0	1.0
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101021-101052	0	1.0
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193511-193542	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1897	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77787	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75952	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68495	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178557	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193088	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68181-68217	0	1.0
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101475-101511	0	1.0
NZ_CP009299_2	2.2\|101542\|36\|NZ_CP009299\|CRISPRCasFinder	101542-101577	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75885	0	1.0
NZ_CP009299_2	2.2\|101542\|36\|NZ_CP009299\|CRISPRCasFinder	101542-101577	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178490	0	1.0
NZ_CP009299_2	2.2\|101542\|36\|NZ_CP009299\|CRISPRCasFinder	101542-101577	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193021	0	1.0
NZ_CP009299_2	2.2\|101542\|36\|NZ_CP009299\|CRISPRCasFinder	101542-101577	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101542-101577	0	1.0
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101608-101643	0	1.0
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28425-28460	0	1.0
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75819	0	1.0
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178424	0	1.0
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192955	0	1.0
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75962	0	1.0
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101465-101511	0	1.0
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178567	0	1.0
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193098	0	1.0
NZ_CP009299_2	2.5\|101532\|46\|NZ_CP009299\|CRT	101532-101577	46	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101532-101577	0	1.0
NZ_CP009299_2	2.5\|101532\|46\|NZ_CP009299\|CRT	101532-101577	46	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75895	0	1.0
NZ_CP009299_2	2.5\|101532\|46\|NZ_CP009299\|CRT	101532-101577	46	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178500	0	1.0
NZ_CP009299_2	2.5\|101532\|46\|NZ_CP009299\|CRT	101532-101577	46	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193031	0	1.0
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101598-101643	0	1.0
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75829	0	1.0
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192965	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1897	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77787	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75952	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68495	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178557	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193088	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68181-68217	0	1.0
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101475-101511	0	1.0
NZ_CP009299_2	2.8\|101543\|36\|NZ_CP009299\|PILER-CR	101543-101578	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75885	0	1.0
NZ_CP009299_2	2.8\|101543\|36\|NZ_CP009299\|PILER-CR	101543-101578	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178490	0	1.0
NZ_CP009299_2	2.8\|101543\|36\|NZ_CP009299\|PILER-CR	101543-101578	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193021	0	1.0
NZ_CP009299_2	2.8\|101543\|36\|NZ_CP009299\|PILER-CR	101543-101578	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101542-101577	0	1.0
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101608-101643	0	1.0
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28425-28460	0	1.0
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75819	0	1.0
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178424	0	1.0
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192955	0	1.0
NZ_CP009299_1	1.3\|101019\|34\|NZ_CP009299\|CRISPRCasFinder,CRT	101019-101052	34	NC_011654	Bacillus cereus AH187 plasmid pAH187_12, complete sequence	10959-10992	1	0.971
NZ_CP009299_1	1.3\|101019\|34\|NZ_CP009299\|CRISPRCasFinder,CRT	101019-101052	34	NZ_CP045535	Bacillaceae bacterium C02 plasmid unnamed2, complete sequence	5364-5397	1	0.971
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	74103-74139	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	36086-36122	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	15046-15082	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	28951-28987	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	26794-26830	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	36563-36599	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	33929-33965	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	124409-124445	1	0.973
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	21364-21400	1	0.973
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NC_011654	Bacillus cereus AH187 plasmid pAH187_12, complete sequence	10959-10990	1	0.969
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP045535	Bacillaceae bacterium C02 plasmid unnamed2, complete sequence	5364-5395	1	0.969
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34324	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51730	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141247	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122405-122441	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65545	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4166-4202	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76378-76414	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87139-87175	1	0.973
NZ_CP009299_2	2.1\|101475\|37\|NZ_CP009299\|CRISPRCasFinder	101475-101511	37	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61179-61215	1	0.973
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30747-30782	1	0.972
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229028-229063	1	0.972
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31092	1	0.972
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10204	1	0.972
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178434	1	0.978
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34324	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51730	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141247	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122405-122441	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65545	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4166-4202	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76378-76414	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87139-87175	1	0.973
NZ_CP009299_2	2.7\|101476\|37\|NZ_CP009299\|PILER-CR	101476-101512	37	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61179-61215	1	0.973
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30747-30782	1	0.972
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229028-229063	1	0.972
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31092	1	0.972
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10204	1	0.972
NZ_CP009299_1	1.1\|100885\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100885-100921	37	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	176775-176811	2	0.946
NZ_CP009299_1	1.1\|100885\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100885-100921	37	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	159726-159762	2	0.946
NZ_CP009299_1	1.1\|100885\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	100885-100921	37	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	283685-283721	2	0.946
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NZ_CP015180	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB71, complete sequence	66676-66712	2	0.946
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NC_020240	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pAW63, complete sequence	66757-66793	2	0.946
NZ_CP009299_1	1.4\|101083\|37\|NZ_CP009299\|CRISPRCasFinder,CRT	101083-101119	37	NC_018686	Bacillus thuringiensis MC28 plasmid pMC183, complete sequence	34985-35021	2	0.946
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12853-12888	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36970-37005	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39234-39269	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18681-18716	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25998-26033	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40707-40742	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11865-11900	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52269-52304	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6411	2	0.944
NZ_CP009299_2	2.3\|101608\|36\|NZ_CP009299\|CRISPRCasFinder	101608-101643	36	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6980	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12853-12888	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36970-37005	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39234-39269	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18681-18716	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25998-26033	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40707-40742	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11865-11900	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52269-52304	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6411	2	0.944
NZ_CP009299_2	2.9\|101609\|36\|NZ_CP009299\|PILER-CR	101609-101644	36	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6980	2	0.944
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NC_010895	Bacillus thuringiensis serovar tenebrionis plasmid pBMB175, complete sequence	44-75	3	0.906
NZ_CP009299_1	1.3\|101019\|34\|NZ_CP009299\|CRISPRCasFinder,CRT	101019-101052	34	NC_010895	Bacillus thuringiensis serovar tenebrionis plasmid pBMB175, complete sequence	44-77	4	0.882
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229018-229063	4	0.913
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28415-28460	5	0.891
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30737-30782	6	0.87
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31102	6	0.87
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10214	6	0.87
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6421	7	0.848
NZ_CP009299_2	2.6\|101598\|46\|NZ_CP009299\|CRT	101598-101643	46	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6990	7	0.848
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1907	8	0.83
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77797	8	0.83
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68171-68217	8	0.83
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68505	8	0.83
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34334	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4156-4202	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76368-76414	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51740	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87129-87175	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122395-122441	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141257	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61169-61215	9	0.809
NZ_CP009299_2	2.4\|101465\|47\|NZ_CP009299\|CRT	101465-101511	47	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65555	9	0.809
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	CP052311	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence	103349-103380	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP031791	Klebsiella pneumoniae strain KSB1_1I-sc-2280289 plasmid unnamed2, complete sequence	83411-83442	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP040026	Klebsiella pneumoniae strain KPC160132 plasmid pIncFI-L132, complete sequence	102138-102169	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP028997	Klebsiella pneumoniae strain AR_0079 plasmid unnamed4, complete sequence	63408-63439	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	CP052281	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-1, complete sequence	110430-110461	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	CP052423	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence	142921-142952	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP040597	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid unnamed3, complete sequence	86325-86356	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	CP052352	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence	37873-37904	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	CP052393	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence	46510-46541	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	NZ_CP047636	Klebsiella pneumoniae strain K2606 plasmid unnamed3, complete sequence	78525-78556	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	MK422451	Klebsiella phage ST13-OXA48phi12.3, complete genome	42354-42385	11	0.656
NZ_CP009299_1	1.6\|101021\|32\|NZ_CP009299\|PILER-CR	101021-101052	32	CP058330	Klebsiella phage vB_Kpn_1825-KPC53 chromosome phage_vB_Kpn_1825-KPC53, complete sequence	82352-82383	11	0.656

1. spacer 1.1|100885|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgcaatgattttgtgaagtgccgagcgtctcccca	CRISPR spacer
ttcgcaatgattttgtgaagtgccgagcgtctcccca	Protospacer
*************************************

2. spacer 1.1|100885|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgcaatgattttgtgaagtgccgagcgtctcccca	CRISPR spacer
ttcgcaatgattttgtgaagtgccgagcgtctcccca	Protospacer
*************************************

3. spacer 1.1|100885|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgcaatgattttgtgaagtgccgagcgtctcccca	CRISPR spacer
ttcgcaatgattttgtgaagtgccgagcgtctcccca	Protospacer
*************************************

4. spacer 1.2|100952|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggaatagaaaggagcaaaatatattgtgggtaata	CRISPR spacer
aaggaatagaaaggagcaaaatatattgtgggtaata	Protospacer
*************************************

5. spacer 1.2|100952|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aaggaatagaaaggagcaaaatatattgtgggtaata	CRISPR spacer
aaggaatagaaaggagcaaaatatattgtgggtaata	Protospacer
*************************************

6. spacer 1.2|100952|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aaggaatagaaaggagcaaaatatattgtgggtaata	CRISPR spacer
aaggaatagaaaggagcaaaatatattgtgggtaata	Protospacer
*************************************

7. spacer 1.3|101019|34|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagtttctcttatcgccttataaaaacaatacat	CRISPR spacer
cagtttctcttatcgccttataaaaacaatacat	Protospacer
**********************************

8. spacer 1.3|101019|34|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cagtttctcttatcgccttataaaaacaatacat	CRISPR spacer
cagtttctcttatcgccttataaaaacaatacat	Protospacer
**********************************

9. spacer 1.3|101019|34|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagtttctcttatcgccttataaaaacaatacat	CRISPR spacer
cagtttctcttatcgccttataaaaacaatacat	Protospacer
**********************************

10. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaatactgagacgaatgaattatctgtcgctataca	Protospacer
*************************************

11. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaatactgagacgaatgaattatctgtcgctataca	Protospacer
*************************************

12. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaatactgagacgaatgaattatctgtcgctataca	Protospacer
*************************************

13. spacer 1.5|100954|35|NZ_CP009299|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatagaaaggagcaaaatatattgtgggtaata	CRISPR spacer
ggaatagaaaggagcaaaatatattgtgggtaata	Protospacer
***********************************

14. spacer 1.5|100954|35|NZ_CP009299|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatagaaaggagcaaaatatattgtgggtaata	CRISPR spacer
ggaatagaaaggagcaaaatatattgtgggtaata	Protospacer
***********************************

15. spacer 1.5|100954|35|NZ_CP009299|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatagaaaggagcaaaatatattgtgggtaata	CRISPR spacer
ggaatagaaaggagcaaaatatattgtgggtaata	Protospacer
***********************************

16. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
gtttctcttatcgccttataaaaacaatacat	Protospacer
********************************

17. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
gtttctcttatcgccttataaaaacaatacat	Protospacer
********************************

18. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
gtttctcttatcgccttataaaaacaatacat	Protospacer
********************************

19. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

20. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

21. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

22. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

23. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

24. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

25. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

26. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

27. spacer 2.2|101542|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

28. spacer 2.2|101542|36|NZ_CP009299|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

29. spacer 2.2|101542|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

30. spacer 2.2|101542|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

31. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

32. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

33. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

34. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

35. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

36. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
***********************************************

37. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
***********************************************

38. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
***********************************************

39. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
***********************************************

40. spacer 2.5|101532|46|NZ_CP009299|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	Protospacer
**********************************************

41. spacer 2.5|101532|46|NZ_CP009299|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	Protospacer
**********************************************

42. spacer 2.5|101532|46|NZ_CP009299|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	Protospacer
**********************************************

43. spacer 2.5|101532|46|NZ_CP009299|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
ctgttttaacaatccacatagcatacggtgtcatataatgacttaa	Protospacer
**********************************************

44. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
atgttttaacggataatggccgttatcacattgtagaggtggatca	Protospacer
**********************************************

45. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
atgttttaacggataatggccgttatcacattgtagaggtggatca	Protospacer
**********************************************

46. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
atgttttaacggataatggccgttatcacattgtagaggtggatca	Protospacer
**********************************************

47. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

48. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

49. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

50. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

51. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

52. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

53. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

54. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
*************************************

55. spacer 2.8|101543|36|NZ_CP009299|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

56. spacer 2.8|101543|36|NZ_CP009299|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

57. spacer 2.8|101543|36|NZ_CP009299|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

58. spacer 2.8|101543|36|NZ_CP009299|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aatccacatagcatacggtgtcatataatgacttaa	CRISPR spacer
aatccacatagcatacggtgtcatataatgacttaa	Protospacer
************************************

59. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

60. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

61. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

62. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

63. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgtagaggtggatca	Protospacer
************************************

64. spacer 1.3|101019|34|NZ_CP009299|CRISPRCasFinder,CRT matches to NC_011654 (Bacillus cereus AH187 plasmid pAH187_12, complete sequence) position: , mismatch: 1, identity: 0.971

cagtttctcttatcgccttataaaaacaatacat	CRISPR spacer
cagtttctcttatcgctttataaaaacaatacat	Protospacer
****************.*****************

65. spacer 1.3|101019|34|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP045535 (Bacillaceae bacterium C02 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

cagtttctcttatcgccttataaaaacaatacat	CRISPR spacer
cagtttctcttatcgctttataaaaacaatacat	Protospacer
****************.*****************

66. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

67. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

68. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

69. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

70. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

71. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

72. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

73. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

74. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
gaaataccgagacgaatgaattatctgtcgctataca	Protospacer
*******.*****************************

75. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NC_011654 (Bacillus cereus AH187 plasmid pAH187_12, complete sequence) position: , mismatch: 1, identity: 0.969

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
gtttctcttatcgctttataaaaacaatacat	Protospacer
**************.*****************

76. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP045535 (Bacillaceae bacterium C02 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
gtttctcttatcgctttataaaaacaatacat	Protospacer
**************.*****************

77. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

78. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

79. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgatattgttcaatagttgtaatcttgtttg	Protospacer
*********.***************************

80. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgatattgttcaatagttgtaatcttgtttg	Protospacer
*********.***************************

81. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

82. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtgcaatagttgtaatcttgtttg	Protospacer
*************** *********************

83. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

84. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

85. spacer 2.1|101475|37|NZ_CP009299|CRISPRCasFinder matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

86. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtggatca	Protospacer
***************.********************

87. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtggatca	Protospacer
***************.********************

88. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtggatca	Protospacer
***************.********************

89. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttattacattgtagaggtggatca	Protospacer
****************.*******************

90. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 1, identity: 0.978

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ctgttttaacggataatggccgttatcacattgtagaggtggatca	Protospacer
 *********************************************

91. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

92. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

93. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgatattgttcaatagttgtaatcttgtttg	Protospacer
*********.***************************

94. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgatattgttcaatagttgtaatcttgtttg	Protospacer
*********.***************************

95. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

96. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtgcaatagttgtaatcttgtttg	Protospacer
*************** *********************

97. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

98. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

99. spacer 2.7|101476|37|NZ_CP009299|PILER-CR matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

gattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
****************.********************

100. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtggatca	Protospacer
***************.********************

101. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtggatca	Protospacer
***************.********************

102. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtggatca	Protospacer
***************.********************

103. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.972

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttattacattgtagaggtggatca	Protospacer
****************.*******************

104. spacer 1.1|100885|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

ttcgcaatgattttgtgaagtgccgagcgtctcccca	CRISPR spacer
ttcgcaatgattttgtgaagtgccgagcatttcccca	Protospacer
****************************.*.******

105. spacer 1.1|100885|37|NZ_CP009299|CRISPRCasFinder,CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.946

ttcgcaatgattttgtgaagtgccgagcgtctcccca	CRISPR spacer
ttcgcaatgattttgtgaagtgccgagcatttcccca	Protospacer
****************************.*.******

106. spacer 1.1|100885|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

ttcgcaatgattttgtgaagtgccgagcgtctcccca	CRISPR spacer
ttcgcaatgattttgtgaagtgccgagcatttcccca	Protospacer
****************************.*.******

107. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NZ_CP015180 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB71, complete sequence) position: , mismatch: 2, identity: 0.946

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
ggaatactgagacgaatgaactatctgtcgctataca	Protospacer
*.******************.****************

108. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NC_020240 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pAW63, complete sequence) position: , mismatch: 2, identity: 0.946

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
ggaatactgagacgaatgaactatctgtcgctataca	Protospacer
*.******************.****************

109. spacer 1.4|101083|37|NZ_CP009299|CRISPRCasFinder,CRT matches to NC_018686 (Bacillus thuringiensis MC28 plasmid pMC183, complete sequence) position: , mismatch: 2, identity: 0.946

gaaatactgagacgaatgaattatctgtcgctataca	CRISPR spacer
ggaatactgagacgaatgaactatctgtcgctataca	Protospacer
*.******************.****************

110. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

111. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

112. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
tgataatggccgttatcacattgtagaagtggatca	Protospacer
 **************************.********

113. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
tgataatggccgttatcacattgtagaagtggatca	Protospacer
 **************************.********

114. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

115. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

116. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtagatca	Protospacer
***************.**************.*****

117. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacatcgtggaggtggatca	Protospacer
*********************.**.***********

118. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgttgaggtggatta	Protospacer
************************ *********.*

119. spacer 2.3|101608|36|NZ_CP009299|CRISPRCasFinder matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgttgaggtggatta	Protospacer
************************ *********.*

120. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

121. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

122. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
tgataatggccgttatcacattgtagaagtggatca	Protospacer
 **************************.********

123. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
tgataatggccgttatcacattgtagaagtggatca	Protospacer
 **************************.********

124. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

125. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cgataatggccgttatcacattgtagaggtcgatca	Protospacer
 ***************************** *****

126. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttaccacattgtagaggtagatca	Protospacer
***************.**************.*****

127. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacatcgtggaggtggatca	Protospacer
*********************.**.***********

128. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgttgaggtggatta	Protospacer
************************ *********.*

129. spacer 2.9|101609|36|NZ_CP009299|PILER-CR matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.944

ggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
ggataatggccgttatcacattgttgaggtggatta	Protospacer
************************ *********.*

130. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NC_010895 (Bacillus thuringiensis serovar tenebrionis plasmid pBMB175, complete sequence) position: , mismatch: 3, identity: 0.906

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
gtttcttttatcgctttataaaaacaatacaa	Protospacer
******.*******.****************

131. spacer 1.3|101019|34|NZ_CP009299|CRISPRCasFinder,CRT matches to NC_010895 (Bacillus thuringiensis serovar tenebrionis plasmid pBMB175, complete sequence) position: , mismatch: 4, identity: 0.882

cagtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tagtttcttttatcgctttataaaaacaatacaa	Protospacer
.*******.*******.****************

132. spacer 2.6|101598|46|NZ_CP009299|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.913

atgtt-ttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
-cgttattcacggataatggccgttaccacattgtagaggtggatca	Protospacer
 .*** ** *****************.********************

133. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 5, identity: 0.891

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cactattcacggataatggccgttatcacattgtagaggtggatca	Protospacer
   * ** **************************************

134. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 6, identity: 0.87

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cactattcacggataatggccgttaccacattgtagaggtggatca	Protospacer
   * ** *****************.********************

135. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 6, identity: 0.87

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cactattcacggataatggccgttaccacattgtagaggtggatca	Protospacer
   * ** *****************.********************

136. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.87

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cactattcacggataatggccgttattacattgtagaggtggatca	Protospacer
   * ** ******************.*******************

137. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 7, identity: 0.848

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cattattcacggataatggccgttatcacattgttgaggtggatta	Protospacer
   * ** ************************** *********.*

138. spacer 2.6|101598|46|NZ_CP009299|CRT matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 7, identity: 0.848

atgttttaacggataatggccgttatcacattgtagaggtggatca	CRISPR spacer
cattattcacggataatggccgttatcacattgttgaggtggatta	Protospacer
   * ** ************************** *********.*

139. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.83

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
        **       *************************************

140. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.83

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
        **       *************************************

141. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.83

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
        **       *************************************

142. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.83

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgttcaatagttgtaatcttgtttg	Protospacer
        **       *************************************

143. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
        **       ****************.********************

144. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtgcaatagttgtaatcttgtttg	Protospacer
        **       *************** *********************

145. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
        **       ****************.********************

146. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
        **       ****************.********************

147. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
        **       ****************.********************

148. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 9, identity: 0.809

ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaatatggattgacgatattgttcaatagttgtaatcttgtttg	Protospacer
  .   **  *********.***************************

149. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 9, identity: 0.809

ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaatatggattgacgatattgttcaatagttgtaatcttgtttg	Protospacer
  .   **  *********.***************************

150. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
        **       ****************.********************

151. spacer 2.4|101465|47|NZ_CP009299|CRT matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.809

-------ctgttttaacgattgacgacattgttcaatagttgtaatcttgtttg	CRISPR spacer
agaaaaaatg-------gattgacgacattgtttaatagttgtaatcttgtttg	Protospacer
        **       ****************.********************

152. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to CP052311 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

153. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP031791 (Klebsiella pneumoniae strain KSB1_1I-sc-2280289 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

154. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP040026 (Klebsiella pneumoniae strain KPC160132 plasmid pIncFI-L132, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

155. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP028997 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

156. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to CP052281 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-1, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

157. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to CP052423 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

158. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP040597 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid unnamed3, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

159. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to CP052352 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

160. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to CP052393 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

161. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to NZ_CP047636 (Klebsiella pneumoniae strain K2606 plasmid unnamed3, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

162. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to MK422451 (Klebsiella phage ST13-OXA48phi12.3, complete genome) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

163. spacer 1.6|101021|32|NZ_CP009299|PILER-CR matches to CP058330 (Klebsiella phage vB_Kpn_1825-KPC53 chromosome phage_vB_Kpn_1825-KPC53, complete sequence) position: , mismatch: 11, identity: 0.656

gtttctcttatcgccttataaaaacaatacat	CRISPR spacer
tgaaatcttaccgccttatataaacaatgatc	Protospacer
     *****.********* *******.  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 27096

Bacillus_phage(80.0%)

transposase,integrase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001027747.1\|752_1034_+	adhesin	NA	NA	NA	NA
WP_033695785.1\|1061_1490_+	protein phosphatase	NA	NA	NA	NA
WP_000631828.1\|2427_4572_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_001285624.1\|4564_6205_+	ATP-binding protein	NA	NA	NA	NA
WP_000888139.1\|6211_8095_+	hypothetical protein	NA	NA	NA	NA
WP_042512059.1\|9047_9971_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_042512154.1\|10185_10374_+	hypothetical protein	NA	NA	NA	NA
WP_052494310.1\|10530_10944_+	hypothetical protein	NA	NA	NA	NA
WP_001233525.1\|11010_11361_+	PrgI family protein	NA	NA	NA	NA
WP_000892015.1\|11361_12276_+	hypothetical protein	NA	NA	NA	NA
WP_000765113.1\|12278_14378_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_042512060.1\|14408_18389_+	hypothetical protein	NA	NA	NA	NA
WP_042512061.1\|18385_20596_+	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	3.0e-15	40.7
WP_042512063.1\|20612_21188_+	hypothetical protein	NA	NA	NA	NA
WP_042512064.1\|21352_21736_+	membrane protein	NA	NA	NA	NA
WP_000426064.1\|21726_22032_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_042512066.1\|22116_22419_+	hypothetical protein	NA	NA	NA	NA
WP_042512067.1\|22575_23256_+	hypothetical protein	NA	NA	NA	NA
WP_042512068.1\|23274_24516_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	3.8e-23	25.8
WP_042512069.1\|24675_24858_+	hypothetical protein	A0A0U3B243	Bacillus_phage	6.5e-25	83.3
WP_080334501.1\|24946_25354_+	hypothetical protein	NA	NA	NA	NA
WP_001091677.1\|25386_25581_+	hypothetical protein	NA	NA	NA	NA
WP_042512070.1\|25658_26012_+	hypothetical protein	NA	NA	NA	NA
WP_042512071.1\|26246_26651_+	hypothetical protein	A0A0A7AR60	Bacillus_phage	1.3e-09	33.1
WP_000804598.1\|26682_27096_+	hypothetical protein	A0A1B1P7B4	Bacillus_phage	3.9e-65	83.2

DBSCAN-SWA_2

32997 : 37645

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000383879.1\|32997_33843_-	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	4.4e-23	42.9
WP_001226074.1\|33955_34531_-	recombinase family protein	M9Q1K0	Clostridium_phage	4.6e-16	30.3
WP_000861527.1\|34678_37645_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.5e-216	40.3

DBSCAN-SWA_3

45513 : 45786

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512080.1\|45513_45786_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.1e-23	67.8

DBSCAN-SWA_4

49416 : 52422

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000021286.1\|49416_49644_+	hypothetical protein	A0A217ERD4	Bacillus_phage	3.4e-07	55.4
WP_001123650.1\|49671_49875_+	hypothetical protein	NA	NA	NA	NA
WP_000843050.1\|49889_50168_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.7e-14	47.8
WP_033656436.1\|50341_50554_+	hypothetical protein	NA	NA	NA	NA
WP_042512087.1\|50818_51160_-	YolD-like family protein	A0A1Q1PW34	Staphylococcus_phage	7.2e-09	38.9
WP_042512088.1\|51156_52422_-	Y-family DNA polymerase	O64031	Bacillus_phage	9.9e-104	46.9

DBSCAN-SWA_5

59164 : 65353

Bacillus_phage(66.67%)

integrase

attL 53708:53725|attR 73868:73885

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
53708:53725	attL	NA	NA	NA	NA
WP_042512097.1\|59164_60388_+	hypothetical protein	A0A1B1P895	Bacillus_phage	3.6e-143	62.4
WP_042512098.1\|60742_61786_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	6.9e-10	24.1
WP_000149387.1\|62016_62367_+	hypothetical protein	NA	NA	NA	NA
WP_001108537.1\|62388_62901_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000107145.1\|64120_65353_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	4.8e-63	58.0
73868:73885	attR	NA	NA	NA	NA

DBSCAN-SWA_6

76634 : 77729

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512099.1\|76634_77729_-	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	3.3e-07	28.1

DBSCAN-SWA_7

84239 : 86348

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512105.1\|84239_86348_-	hypothetical protein	M1ICZ5	Pelagibacter_phage	8.3e-47	29.0

DBSCAN-SWA_8

93597 : 106246

uncultured_Caudovirales_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512112.1\|93597_94692_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.6e-95	48.2
WP_000751014.1\|94688_94820_+	hypothetical protein	NA	NA	NA	NA
WP_042512113.1\|95011_95197_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_000207868.1\|95504_95798_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042512114.1\|95870_96308_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_000084559.1\|96351_96639_-	hypothetical protein	NA	NA	NA	NA
WP_042512115.1\|96712_96916_-	hypothetical protein	NA	NA	NA	NA
WP_042512116.1\|96967_97612_-	thermonuclease family protein	A0A2P1JU10	Anoxybacillus_phage	8.3e-06	33.3
WP_042512118.1\|98040_100704_-	type IA DNA topoisomerase	A0A1V0SIB2	Klosneuvirus	9.9e-13	21.4
WP_002073819.1\|101934_103296_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A142F1Q5	Bacillus_phage	1.4e-79	38.1
WP_042512119.1\|103421_105251_+	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_000866031.1\|105607_106246_-	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	1.1e-21	34.6

DBSCAN-SWA_9

122130 : 123078

Bacillus_phage(100.0%)

integrase

attL 119155:119169|attR 129565:129579

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
119155:119169	attL	NA	NA	NA	NA
WP_042512125.1\|122130_123078_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	5.4e-38	32.0
WP_042512125.1\|122130_123078_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	5.4e-38	32.0
129565:129579	attR	NA	NA	NA	NA

DBSCAN-SWA_10

127820 : 129761

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048520063.1\|127820_129761_-	maturase	A0A0U4J920	Pseudomonas_phage	5.2e-27	28.7

DBSCAN-SWA_11

137243 : 142388

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002019929.1\|137243_139142_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	9.5e-26	28.7
WP_042512126.1\|139903_140260_-	hypothetical protein	Q0ILF6	Lactococcus_phage	3.8e-21	43.9
WP_001055070.1\|140282_140678_-	hypothetical protein	NA	NA	NA	NA
WP_002081521.1\|141077_141260_-	hypothetical protein	NA	NA	NA	NA
WP_000633806.1\|141327_141612_-	hypothetical protein	NA	NA	NA	NA
WP_001100171.1\|141872_142097_-	hypothetical protein	NA	NA	NA	NA
WP_000675279.1\|142115_142388_-	hypothetical protein	D2XR50	Bacillus_phage	9.8e-09	39.1

DBSCAN-SWA_12

147541 : 149188

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512127.1\|147541_149188_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.5e-78	35.9

DBSCAN-SWA_13

158398 : 159511

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512128.1\|158398_159511_-	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	2.0e-79	45.0

DBSCAN-SWA_14

184299 : 187975

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512146.1\|184299_186075_+	hypothetical protein	Q08J70	Stx2-converting_phage	1.4e-23	39.5
WP_042512147.1\|186064_187378_+	DUF3854 domain-containing protein	NA	NA	NA	NA
WP_042512149.1\|187654_187975_+	winged helix-turn-helix transcriptional regulator	A0A2H4PQT4	Staphylococcus_phage	4.1e-06	37.0

DBSCAN-SWA_15

193886 : 201409

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000229539.1\|193886_195350_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.3e-142	57.6
WP_000904931.1\|195530_196073_+	recombinase family protein	G8I4U3	Mycobacterium_phage	1.8e-09	28.8
WP_000536398.1\|196345_196699_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000021465.1\|196700_197141_+	hypothetical protein	NA	NA	NA	NA
WP_001214613.1\|197272_199036_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.6e-38	25.3
WP_000426344.1\|199122_199647_+	hypothetical protein	NA	NA	NA	NA
WP_000077294.1\|199688_199928_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_000067663.1\|200063_200405_+	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_000616114.1\|200992_201409_+	FosB family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	5.8e-53	85.3

DBSCAN-SWA_16

206371 : 208234

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000416301.1\|206371_206719_+	winged helix-turn-helix transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.7e-10	40.9
WP_000072354.1\|206747_207803_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_000428325.1\|207829_208234_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	5.3e-43	64.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009300

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009300_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009300_2

916633-917145

Orphan

Consensus_repeat	Method
NTGAGGTCCAGTNGCNCC	CRT

12 spacers

The CRISPR arrays of NZ_CP009300_2

>merge|NZ_CP009300|2|916633-917145|CRT
CTGAGGTCCAGTAGCACCTGTGTTACCTTGAGCACCTTGAGGTCCAGTAGCGCCAGTAGCACCCGCTGGTCCTTGAGCGCCTTGAGGTCCAGTAGCACCTGTGTTACCTTGAGCACCTTGAGGTCCAGTAGCGCCAGTAGCACCCGCTGGTCCTTGAGCGCCTTGAGGTCCAGTAGCGCCTGTGTTACCTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCACCTGTGTTACCTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCGCCCGTGTTACCTTGAACACCCTGAGGTCCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAACACCTTGAGGTCCAGTAGCGCCCGTGTTACCTTGAGCGCCTTGAGGTCCAGTGGCACCAGTAGCACCTGTGTTACCTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCACCTGTGTTACCTTGAGCACCCTGAGGTCCAGTAGCACCAGCTGGCCCAGTAGGCCCAGTAGGTCCAGTAGGTCC

>NZ_CP009300|2|2|916633-917145|CRT
CTGAGGTCCAGTAGCACC	TGTGTTACCTTGAGCACC
TTGAGGTCCAGTAGCGCC	AGTAGCACCCGCTGGTCCTTGAGCGCC
TTGAGGTCCAGTAGCACC	TGTGTTACCTTGAGCACC
TTGAGGTCCAGTAGCGCC	AGTAGCACCCGCTGGTCCTTGAGCGCC
TTGAGGTCCAGTAGCGCC	TGTGTTACCTTGAGCACC
TTGAGGTCCAGTGGCACC	AGTAGCACCTGTGTTACCTTGAGCACC
TTGAGGTCCAGTGGCACC	AGTAGCGCCCGTGTTACCTTGAACACC
CTGAGGTCCAGTAGCGCC	AGTAGCACCTGCTGGTCCTTGAACACC
TTGAGGTCCAGTAGCGCC	CGTGTTACCTTGAGCGCC
TTGAGGTCCAGTGGCACC	AGTAGCACCTGTGTTACCTTGAGCACC
TTGAGGTCCAGTGGCACC	AGTAGCACCTGTGTTACCTTGAGCACC
CTGAGGTCCAGTAGCACC	AGCTGGCCCAGTAGGCCC
AGTAGGTCCAGTAGGTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009300.1\|WP_000228316.1\|906195_906738_+\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP009300.1\|WP_000312272.1\|920034_920658_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP009300.1\|WP_001102624.1\|925559_925883_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP009300.1\|WP_000504940.1\|913477_914431_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP009300.1\|WP_000704637.1\|909850_911707_+\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|182066
NZ_CP009300.1\|WP_000813896.1\|914452_914677_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP009300.1\|WP_000734626.1\|912055_912988_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP009300.1\|WP_000368856.1\|925281_925440_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000460285.1\|922017_923289_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP009300.1\|WP_000957268.1\|908176_908929_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP009300.1\|WP_000135328.1\|923901_925236_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP009300.1\|WP_042512286.1\|908925_909837_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP009300.1\|WP_001179102.1\|906854_908018_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP009300.1\|WP_000814423.1\|913050_913296_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000438185.1\|918808_919765_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP009300.1\|WP_000032393.1\|925875_926418_+\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP009300.1\|WP_000391400.1\|920750_922025_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP009300.1\|WP_000656783.1\|923463_923853_+\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP009300.1\|WP_001989514.1\|905542_905884_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000450309.1\|917729_918695_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308

Protein	Function_ID	Function_description	E-value
NZ_CP009300.1\|WP_000228316.1\|906195_906738_+\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP009300.1\|WP_000734626.1\|912055_912988_+\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.45308e-35
NZ_CP009300.1\|WP_001102624.1\|925559_925883_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.87607e-24
NZ_CP009300.1\|WP_000504940.1\|913477_914431_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NZ_CP009300.1\|WP_000704637.1\|909850_911707_+\|PTS-transporter-subunit-EIIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	1.23985e-140
NZ_CP009300.1\|WP_000813896.1\|914452_914677_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP009300.1\|WP_000312272.1\|920034_920658_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60
NZ_CP009300.1\|WP_000460285.1\|922017_923289_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP009300.1\|WP_000957268.1\|908176_908929_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NZ_CP009300.1\|WP_000135328.1\|923901_925236_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP009300.1\|WP_042512286.1\|908925_909837_+\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.47236e-142
NZ_CP009300.1\|WP_001179102.1\|906854_908018_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP009300.1\|WP_000438185.1\|918808_919765_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NZ_CP009300.1\|WP_000032393.1\|925875_926418_+\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.79006e-84
NZ_CP009300.1\|WP_000391400.1\|920750_922025_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP009300.1\|WP_000656783.1\|923463_923853_+\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP009300.1\|WP_000450309.1\|917729_918695_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13

>NZ_CP009300.1|WP_000813896.1|914452_914677_+|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP009300.1|WP_000504940.1|913477_914431_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP009300.1|WP_000814423.1|913050_913296_-|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYVQNQFCSAYKIITGKTIYPFQ
>NZ_CP009300.1|WP_000734626.1|912055_912988_+|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVTKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP009300.1|WP_000704637.1|909850_911707_+|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKVDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP009300.1|WP_042512286.1|908925_909837_+|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQAEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP009300.1|WP_000957268.1|908176_908929_+|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP009300.1|WP_001179102.1|906854_908018_+|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NZ_CP009300.1|WP_000228316.1|906195_906738_+|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP009300.1|WP_001989514.1|905542_905884_+|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS
>NZ_CP009300.1|WP_000450309.1|917729_918695_-|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NZ_CP009300.1|WP_000438185.1|918808_919765_+|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NZ_CP009300.1|WP_000312272.1|920034_920658_-|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP009300.1|WP_000391400.1|920750_922025_+|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP009300.1|WP_000460285.1|922017_923289_+|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKLADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP009300.1|WP_000656783.1|923463_923853_+|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP009300.1|WP_000135328.1|923901_925236_+|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP009300.1|WP_000368856.1|925281_925440_+|hypothetical-protein
MDNIVVCEMNRMGARKTFEKNHEDYLKYVLAMNENVEIEICVVLIASWRGWM
>NZ_CP009300.1|WP_001102624.1|925559_925883_+|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGGTQLNLLVTEWRDFAKGVQEIIEGVQWDE
>NZ_CP009300.1|WP_000032393.1|925875_926418_+|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKNESDIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLLAIIAFIFSFWVGGIVSVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009300_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009300_1

915703-916557

Orphan

Consensus_repeat	Method
TCCAGTNGCNCCAGTAGC	CRT

19 spacers

The CRISPR arrays of NZ_CP009300_1

>merge|NZ_CP009300|1|915703-916557|CRT
TCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAACACCTTGAGGTCCAGTAGCACCGGTAGCACCTGCTGGTCCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGCCCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGCCCTTGAACACCTTGAGGTCCAGTGGCACCAGTAGCACCCGCTGGTCCTTGAGCGCCTTGAGGTCCAGTGGCACCAGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCCGCTGGTCCTTGAGCGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACACCTTGAGGTCCAGTGGCACCAGTAGCACCCGCTGGTCCTTGAGCGCCTTGAGGTCCAGTGGCACCAGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAATACCTTGAGGTCCAGTGGCACCGGTAGCACCCGCTGGTCCTTGAACACCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACACCCTGAGGTCCAGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCGCCTGCTGGTCCTTGAACACCTTGAGGTCCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAGCGCCTTGAGGTCCAGTGGCACCAGTAGCACCGGTGTTACCTTGAGGTCCAGTAGGTCCAGGAGG

>NZ_CP009300|1|1|915703-916557|CRT
TCCAGTGGCACCGGTAGC	ACCTGCTGGTCCTTGAGCACCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCTGCTGGTCCTTGAACACCTTGAGG
TCCAGTAGCACCGGTAGC	ACCTGCTGGTCCTTGAACACCTTGAGG
TCCAGTGGCACCGGTAGC	ACCTGCTGGCCCTTGAACACCTTGAGG
TCCAGTGGCACCGGTAGC	ACCTGCTGGCCCTTGAACACCTTGAGG
TCCAGTGGCACCAGTAGC	ACCCGCTGGTCCTTGAGCGCCTTGAGG
TCCAGTGGCACCAGTAGC	ACCCGTGTTACCTTGAACGCCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCCGCTGGTCCTTGAGCGCCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCTGTGTTACCTTGAACACCTTGAGG
TCCAGTGGCACCAGTAGC	ACCCGCTGGTCCTTGAGCGCCTTGAGG
TCCAGTGGCACCAGTAGC	ACCCGTGTTACCTTGAACGCCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCTGCTGGTCCTTGAATACCTTGAGG
TCCAGTGGCACCGGTAGC	ACCCGCTGGTCCTTGAACACCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCTGTGTTACCTTGAACGCCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCTGTGTTACCTTGAACACCCTGAGG
TCCAGTAGCACCTGTGTT	ACCTTGAACGCCTTGAGG
TCCAGTAGCGCCAGTAGC	GCCTGCTGGTCCTTGAACACCTTGAGG
TCCAGTAGCGCCAGTAGC	ACCTGCTGGTCCTTGAGCGCCTTGAGG
TCCAGTGGCACCAGTAGC	ACCGGTGTTACCTTGAGG
TCCAGTAGGTCCAGGAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009300.1\|WP_000228316.1\|906195_906738_+\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP009300.1\|WP_000312272.1\|920034_920658_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP009300.1\|WP_001102624.1\|925559_925883_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP009300.1\|WP_000504940.1\|913477_914431_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP009300.1\|WP_000704637.1\|909850_911707_+\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|182066
NZ_CP009300.1\|WP_000813896.1\|914452_914677_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP009300.1\|WP_000734626.1\|912055_912988_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP009300.1\|WP_000368856.1\|925281_925440_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000460285.1\|922017_923289_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP009300.1\|WP_000957268.1\|908176_908929_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP009300.1\|WP_000135328.1\|923901_925236_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP009300.1\|WP_042512286.1\|908925_909837_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP009300.1\|WP_001179102.1\|906854_908018_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP009300.1\|WP_000814423.1\|913050_913296_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000438185.1\|918808_919765_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP009300.1\|WP_000032393.1\|925875_926418_+\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP009300.1\|WP_000391400.1\|920750_922025_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP009300.1\|WP_000656783.1\|923463_923853_+\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP009300.1\|WP_001989514.1\|905542_905884_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000450309.1\|917729_918695_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308

Protein	Function_ID	Function_description	E-value
NZ_CP009300.1\|WP_000228316.1\|906195_906738_+\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP009300.1\|WP_000734626.1\|912055_912988_+\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.45308e-35
NZ_CP009300.1\|WP_001102624.1\|925559_925883_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.87607e-24
NZ_CP009300.1\|WP_000504940.1\|913477_914431_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NZ_CP009300.1\|WP_000704637.1\|909850_911707_+\|PTS-transporter-subunit-EIIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	1.23985e-140
NZ_CP009300.1\|WP_000813896.1\|914452_914677_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP009300.1\|WP_000312272.1\|920034_920658_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60
NZ_CP009300.1\|WP_000460285.1\|922017_923289_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP009300.1\|WP_000957268.1\|908176_908929_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NZ_CP009300.1\|WP_000135328.1\|923901_925236_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP009300.1\|WP_042512286.1\|908925_909837_+\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.47236e-142
NZ_CP009300.1\|WP_001179102.1\|906854_908018_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP009300.1\|WP_000438185.1\|918808_919765_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NZ_CP009300.1\|WP_000032393.1\|925875_926418_+\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.79006e-84
NZ_CP009300.1\|WP_000391400.1\|920750_922025_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP009300.1\|WP_000656783.1\|923463_923853_+\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP009300.1\|WP_000450309.1\|917729_918695_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13

>NZ_CP009300.1|WP_000813896.1|914452_914677_+|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP009300.1|WP_000504940.1|913477_914431_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP009300.1|WP_000814423.1|913050_913296_-|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYVQNQFCSAYKIITGKTIYPFQ
>NZ_CP009300.1|WP_000734626.1|912055_912988_+|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVTKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP009300.1|WP_000704637.1|909850_911707_+|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKVDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP009300.1|WP_042512286.1|908925_909837_+|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQAEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP009300.1|WP_000957268.1|908176_908929_+|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP009300.1|WP_001179102.1|906854_908018_+|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NZ_CP009300.1|WP_000228316.1|906195_906738_+|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP009300.1|WP_001989514.1|905542_905884_+|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS
>NZ_CP009300.1|WP_000450309.1|917729_918695_-|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NZ_CP009300.1|WP_000438185.1|918808_919765_+|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NZ_CP009300.1|WP_000312272.1|920034_920658_-|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP009300.1|WP_000391400.1|920750_922025_+|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP009300.1|WP_000460285.1|922017_923289_+|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKLADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP009300.1|WP_000656783.1|923463_923853_+|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP009300.1|WP_000135328.1|923901_925236_+|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP009300.1|WP_000368856.1|925281_925440_+|hypothetical-protein
MDNIVVCEMNRMGARKTFEKNHEDYLKYVLAMNENVEIEICVVLIASWRGWM
>NZ_CP009300.1|WP_001102624.1|925559_925883_+|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGGTQLNLLVTEWRDFAKGVQEIIEGVQWDE
>NZ_CP009300.1|WP_000032393.1|925875_926418_+|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKNESDIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLLAIIAFIFSFWVGGIVSVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009300_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009300_3

1142817-1142918

Orphan

Consensus_repeat	Method
ACATTCTCAAAAGAAACCTAAATT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP009300_3

>merge|NZ_CP009300|3|1142817-1142918|CRISPRCasFinder
ACATTCTCAAAAGAAACCTAAATTGTCAAGGAAGGAAAGGAGACAATCCACGGCTACTTCGGGGCATGTAAATATACCACATTCTCAAAAGAAACCTAAACT

>NZ_CP009300|3|1|1142817-1142918|CRISPRCasFinder
ACATTCTCAAAAGAAACCTAAATT	GTCAAGGAAGGAAAGGAGACAATCCACGGCTACTTCGGGGCATGTAAATATACC
ACATTCTCAAAAGAAACCTAAACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009300.1\|WP_001226311.1\|1143473_1144418_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP009300.1\|WP_000915189.1\|1148503_1149637_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP009300.1\|WP_000275811.1\|1133513_1134113_+\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NZ_CP009300.1\|WP_000538120.1\|1141255_1141507_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000445386.1\|1139295_1140915_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP009300.1\|WP_000719639.1\|1134187_1134325_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NZ_CP009300.1\|WP_000646424.1\|1137319_1138318_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP009300.1\|WP_001102735.1\|1134324_1135419_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP009300.1\|WP_011733155.1\|1146672_1147905_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP009300.1\|WP_000417235.1\|1141523_1142177_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_042512317.1\|1152583_1154125_+\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_CP009300.1\|WP_000129214.1\|1151576_1152368_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366312
NZ_CP009300.1\|WP_000236538.1\|1144462_1145140_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP009300.1\|WP_000571876.1\|1138427_1138832_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009300.1\|WP_000351707.1\|1145735_1146587_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP009300.1\|WP_000544588.1\|1145233_1145743_-\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP009300.1\|WP_000798779.1\|1148015_1148246_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_042512316.1\|1149672_1151460_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009300.1\|WP_000164935.1\|1135674_1137141_-\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP009300.1\|WP_001172046.1\|1132481_1132829_+\|DUF4260-domain-containing-protein	unknown	unknown	gnl\|CDD\|379455

Protein	Function_ID	Function_description	E-value
NZ_CP009300.1\|WP_001226311.1\|1143473_1144418_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	6.60592e-150
NZ_CP009300.1\|WP_000915189.1\|1148503_1149637_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	3.15391e-58
NZ_CP009300.1\|WP_000275811.1\|1133513_1134113_+\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.18494e-70
NZ_CP009300.1\|WP_000445386.1\|1139295_1140915_+\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	1.14997e-105
NZ_CP009300.1\|WP_000719639.1\|1134187_1134325_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	0.000197254
NZ_CP009300.1\|WP_000646424.1\|1137319_1138318_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.78698e-148
NZ_CP009300.1\|WP_001102735.1\|1134324_1135419_-\|hypothetical-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.15405e-16
NZ_CP009300.1\|WP_011733155.1\|1146672_1147905_+\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.98542e-95
NZ_CP009300.1\|WP_042512317.1\|1152583_1154125_+\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_CP009300.1\|WP_000129214.1\|1151576_1152368_-\|hypothetical-protein	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	4.3288e-48
NZ_CP009300.1\|WP_000236538.1\|1144462_1145140_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.39155e-21
NZ_CP009300.1\|WP_000571876.1\|1138427_1138832_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.00495e-15
NZ_CP009300.1\|WP_000351707.1\|1145735_1146587_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22301e-86
NZ_CP009300.1\|WP_000544588.1\|1145233_1145743_-\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	1.7183e-74
NZ_CP009300.1\|WP_042512316.1\|1149672_1151460_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009300.1\|WP_000164935.1\|1135674_1137141_-\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP009300.1\|WP_001172046.1\|1132481_1132829_+\|DUF4260-domain-containing-protein	gnl\|CDD\|379455	pfam14079, DUF4260, Domain of unknown function (DUF4260). This family of integral membrane proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 114 and 126 amino acids in length. There is a conserved GLK sequence motif.	1.75627e-48

>NZ_CP009300.1|WP_000417235.1|1141523_1142177_+|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLFIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFLLYIFTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICVGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKKMDGMHNGQI
>NZ_CP009300.1|WP_000538120.1|1141255_1141507_+|hypothetical-protein
MGVGTTAVSAFAGTKAGALVGTFWGGPIGTAAGACIGFGVSIGASIVTDGIKFNKGDWNHDGKQDSIKDKVKTGIGADLDKIF
>NZ_CP009300.1|WP_000445386.1|1139295_1140915_+|FAD-dependent-monooxygenase
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKALENCRGRIAVHTIAEANQEELAQMRATQYGNDEKLLQKIEEISPSKQTACYQITLEEMMLLEAKTLGGQLSFYHELVSFEQKENGVIATILDRETEKESVVHCDYVIAADGAKSKIREQLRISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFTMVLHPEVLGALIPVDNERRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTKVESEIVSVLPWEATESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDVHNLAWKLAAVIKGKAKPKLLETYHEERYPVAKLTTEYASSLLFRAANREEGSLNNTDGLAVTVGYQYCSEAIIDDSVTPHRMDSVKLNGRPGTRAPHFFGTYDGKEISILDLLGNDFVLLTIAENRTWAECVQNVSSTLGINIKFYSVGLRGDFIAQEDIFSKLYGIENGGAVLIRPDGFIGWRSEKEVVNLDVVLEEVMGNLLCDF
>NZ_CP009300.1|WP_000571876.1|1138427_1138832_-|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILFVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLGLLKNLVLDIEKLLHNFYPTLTGSKTPTSEFSESKEFR
>NZ_CP009300.1|WP_000646424.1|1137319_1138318_-|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVIVKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSNLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKPVIDRVFSFEDAQKAMEYSEAGRAKGKIIVKIK
>NZ_CP009300.1|WP_000164935.1|1135674_1137141_-|YdiU-family-protein
MTKNNEVGWNLDNSYATLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYEKQWFIGMKKKLGLFSNEEQDQSLIEQLFKMMEKYKADYTNTFRSLTLDTLENTPLFDSPEFKEWYKLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNRPYRTFCGT
>NZ_CP009300.1|WP_001102735.1|1134324_1135419_-|hypothetical-protein
MNVQLQGNEQITKLFNDWYRIILQHQTIEATKIKNDIEDKISNSDKDTNLLLYYSLLNFRYEVLTNGLNITKDAFNKIDSYPIPENNCLTYYYHFFKAIHNTILADYNEAKNHFEKAEKLLKYVPEELELAEFNYRIASFYYQIYKPLLAINYIQQAKIFFSTHTGYEVNLAACDNVFGLSCLDLRQFEQAEESFNSAIDILKKKGEESLLLRTRNNIGLLYANQNLSSLAIRHLSEVTESMPNHFKALYLQADEYLKLGEKESASQFIERGLSVCNKLEIKEYQYRFKILDELCKESNTIEIEKVVLAGVSYFETEELWECIEEYTERIANKFYAEENHFKASKYFYLSNQARKKSLAKGALK
>NZ_CP009300.1|WP_000719639.1|1134187_1134325_-|Phr-family-secreted-Rap-phosphatase-inhibitor
MKKIGLTLSAIALTLILSFGFSHNSKDVALNKGDTWSPAYGLKQA
>NZ_CP009300.1|WP_000275811.1|1133513_1134113_+|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYKIIEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDLNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVERRKLVVGELEKVGSEGSRGIAELMKD
>NZ_CP009300.1|WP_001172046.1|1132481_1132829_+|DUF4260-domain-containing-protein
MQKRIVHFEGLVVFVAAIYMYSLYEFSWIIFWIFLLAPDLSMLAYGINNHIGANIYNLFHTYIISILIVIIGVYFKVDTVIMIGLIWTAHIGMDRMFGYGLKYEMDFKDTHIQRL
>NZ_CP009300.1|WP_001226311.1|1143473_1144418_+|glycerophosphodiester-phosphodiesterase
MRKIINVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKIPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLNKYNLVGQNMSSSRVMIQSFSKDSLKKIHSMNKNIPLVQLLWYYSNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARKNGLLIHPYTINEKPDMRLLIKWGATGMFTNYPDRLHSVLKEK
>NZ_CP009300.1|WP_000236538.1|1144462_1145140_-|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDAIFVFGGSHPGNWQAPLEAYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMEHGVPTDAILFETNSLHSIANVMEAKKIFDFTKVNRLLFVCKSLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPKKEVQGLEEYVSYYYNLA
>NZ_CP009300.1|WP_000544588.1|1145233_1145743_-|DUF3916-domain-containing-protein
MHEKKIRGIKRKANAMIKRIEEHTKTFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIKPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFTRNNEFQKWILLSNEIDFWETWRISICPTPQMLHFQEVIYDEDAIDEKEIWFIGELS
>NZ_CP009300.1|WP_000351707.1|1145735_1146587_-|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLISLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKPLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKEHEHDVLFNPLPNSFKKVPTTFITRKDIFRSASLQKFMEVTHNA
>NZ_CP009300.1|WP_011733155.1|1146672_1147905_+|MFS-transporter
MEEDGGIIVLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFVGRLLDQYNEKILISISSFLLGSSLLLTNIVSRFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGTLAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVEGEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRIALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMNIHTITSGVLYSISALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYTHAWLCIVLLLSISAVSLYSKNKK
>NZ_CP009300.1|WP_000798779.1|1148015_1148246_-|hypothetical-protein
MKNTDKRNRLDAMMFHYRVTKNNIVLIEYYGKQIMILKGTDAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNERQ
>NZ_CP009300.1|WP_000915189.1|1148503_1149637_+|serine-hydrolase
MLKKWLIVFFIFAIFGGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANMKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKRTFVILFSNVQNGMNDAFNQEFRKMANDLIEGKGA
>NZ_CP009300.1|WP_042512316.1|1149672_1151460_-|oligoendopeptidase-F
MTELKDRLQVADKEKWDLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSIDEDTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTTDNGEKVTLTRGMYAKLIEDENREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIETTKKNIQSLHTYNELRKEKLHVDELRQYDLSVDLVTGVKQDIPYDKAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NZ_CP009300.1|WP_000129214.1|1151576_1152368_-|hypothetical-protein
MTDFQKQFFARLNIEEKQKVSFEDLSNIMYAMAQTVPFENLNILENNFTEISKENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATVLKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKANAAQKIIVEHDGSPFNKVPLIVKLTEDGHASLTKDSLTIAKNGKKTKEKVTDVQYKNLLHSKFGITL
>NZ_CP009300.1|WP_042512317.1|1152583_1154125_+|alpha-amylase
MFKKITIVGLSVVLFLPSIYGGSKVYADTVNNGTLMQYFEWYAPSDGNHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEAVHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNIEVSGDYEINAWTGFNFPGRGDAYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILMARKNFAYGTQRDYLDHPDVIGWTREGDGVHADSGLATLISDGPGGSKWMEVGKNNAGEVWYDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009300_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009300_4

3320657-3320912

Orphan

Consensus_repeat	Method
TTCTCATGCGGAAGGTAAACATACA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009300_4

>merge|NZ_CP009300|4|3320657-3320912|CRISPRCasFinder
CTCTCATGCAGAGGGTACAGCTTCACATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTTCTCTCATGCAGAAGGATCAAAAACGAAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTATTCTCATGCGGAAGGTAAACATACAATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTCTTCTCATGCGGAAGGTAATCATACA

>NZ_CP009300|4|2|3320657-3320912|CRISPRCasFinder
CTCTCATGCAGAGGGTACAGCTTCA	CATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTT
CTCTCATGCAGAAGGATCAAAAACG	AAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTA
TTCTCATGCGGAAGGTAAACATACA	ATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTC
TTCTCATGCGGAAGGTAATCATACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009300.1\|WP_042513093.1\|3314093_3315062_+\|collagen-like-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP009300.1\|WP_001078427.1\|3311929_3312619_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP009300.1\|WP_001079116.1\|3321608_3322502_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP009300.1\|WP_000003393.1\|3327093_3328920_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009300.1\|WP_001294612.1\|3316244_3316997_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009300.1\|WP_042513092.1\|3312830_3313928_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP009300.1\|WP_001271183.1\|3311246_3311933_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009300.1\|WP_001994556.1\|3317010_3317937_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP009300.1\|WP_001081482.1\|3323333_3323972_-\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP009300.1\|WP_000673194.1\|3322517_3323315_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP009300.1\|WP_001180009.1\|3324002_3324374_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000872717.1\|3319290_3320031_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP009300.1\|WP_000043381.1\|3325279_3325678_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP009300.1\|WP_000191105.1\|3324520_3325099_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP009300.1\|WP_000360638.1\|3325677_3326571_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP009300.1\|WP_000651527.1\|3310551_3311232_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009300.1\|WP_042513094.1\|3328970_3330215_-\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP009300.1\|WP_000444380.1\|3315184_3316030_+\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP009300.1\|WP_000654717.1\|3318055_3319216_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP009300.1\|WP_000799201.1\|3330296_3331841_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967

Protein	Function_ID	Function_description	E-value
NZ_CP009300.1\|WP_042513093.1\|3314093_3315062_+\|collagen-like-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.10989e-17
NZ_CP009300.1\|WP_001078427.1\|3311929_3312619_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	3.57676e-18
NZ_CP009300.1\|WP_001079116.1\|3321608_3322502_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	3.88119e-102
NZ_CP009300.1\|WP_000003393.1\|3327093_3328920_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009300.1\|WP_001294612.1\|3316244_3316997_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.63146e-19
NZ_CP009300.1\|WP_042513092.1\|3312830_3313928_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	2.26497e-54
NZ_CP009300.1\|WP_001271183.1\|3311246_3311933_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.25249e-108
NZ_CP009300.1\|WP_001994556.1\|3317010_3317937_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2498e-25
NZ_CP009300.1\|WP_001081482.1\|3323333_3323972_-\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP009300.1\|WP_000673194.1\|3322517_3323315_-\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP009300.1\|WP_000872717.1\|3319290_3320031_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP009300.1\|WP_000043381.1\|3325279_3325678_+\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NZ_CP009300.1\|WP_000191105.1\|3324520_3325099_+\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NZ_CP009300.1\|WP_000360638.1\|3325677_3326571_+\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	5.36453e-93
NZ_CP009300.1\|WP_000651527.1\|3310551_3311232_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.1131e-109
NZ_CP009300.1\|WP_042513094.1\|3328970_3330215_-\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.11613e-58
NZ_CP009300.1\|WP_000444380.1\|3315184_3316030_+\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.59865e-154
NZ_CP009300.1\|WP_000654717.1\|3318055_3319216_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.52178e-99
NZ_CP009300.1\|WP_000799201.1\|3330296_3331841_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0

>NZ_CP009300.1|WP_000872717.1|3319290_3320031_+|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKEAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP009300.1|WP_000654717.1|3318055_3319216_+|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGTVSCFAIASAQVSLPPFLQNVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFATAVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASIIITLFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP009300.1|WP_001994556.1|3317010_3317937_+|glycosyltransferase-family-2-protein
MTSEKDLPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIIGDDSTNDETETLIHEQYLPHYKNVTYIRNTPPLGQFHNDLMLLEKSNGEYINFLMDDDVFYKHKIQKMMDYFEQDTNKALALVTSYRVRIDDHGDLIGDAHPTQRLYSEDTPLNGMFLGDWMLKEGHNIIGEPTTTLFRKELLTEPFGTLKERQYSCSVDMASWISLLSKGDAVYISEPLSQFRYHAGQQIHNKLLQGCEDFTHLVITAKEYGFLQNTTDYRTALLSAYKWCKSSLKYYLHQLDIFPDAHVRLSHCLVIIIKELNN
>NZ_CP009300.1|WP_001294612.1|3316244_3316997_+|class-I-SAM-dependent-methyltransferase
MSEPNKEITLLPPPELVQYVGGDFKEVGKEFLTHFIQIGALKSNEKVLDVGCGVGRMAVPLMNYLTDDGAYYGFDLFKDGITWCQNNIATIRNNFHFEHVDIYNQFYNPEGKEDASQYRFPYEDETFDFIFLTSVFTHLLPKELEHYLSEIVRVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIENCYVVNKDIPNFAVAYPETNIYSLLNKYGLEAINKPYYGLWCGRHEYTSYQDIVITKKRV
>NZ_CP009300.1|WP_000444380.1|3315184_3316030_+|macrocin-O-methyltransferase
MESKSAVQLYLELLKKTILFEIWLEYEAYLPASLHISKELEFEPVTVPLPLFIKQYAENHNLKIVKPNVSKSERHDGMDWPRAAHSMIGRERMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRNVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLEQVQENFKKYDLLNDQVKFLKGWFKDTLPTAPIEKIAIARLDGDMYESTMDGLVNLYDKVSKGGYIIIDDYGLPPCAEAVTDFRNHRNLKAPITKIDVFGVYWRKE
>NZ_CP009300.1|WP_042513093.1|3314093_3315062_+|collagen-like-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGDTGATGATGATGPTGPTGDTGATGPTGPTGDTGATGLTGPTGDTGATGPTGPTGDTGATGATGATGPTGPTGDTGATGLTGPTGDTGATGLTGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATVSLLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP009300.1|WP_042513092.1|3312830_3313928_-|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKREIDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGEVFSSNVAITHKKEKKVTDRNLKIFQNTVAAGEELSPRDLFYYANESTDNQKYDDAVFLYETFLNQDEGWYEEKIYACGKLGDCYAKLGMWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQEKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSRLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRGVFDKPYKV
>NZ_CP009300.1|WP_001078427.1|3311929_3312619_-|class-I-SAM-dependent-methyltransferase
MNREKSSLYEEKSEHYYNAANPNLLKHIKKEWKEVLDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP009300.1|WP_001271183.1|3311246_3311933_-|streptomycin-biosynthesis-protein-StrF
MSAADKTILFVTCINDRKLYANCVRHILQLLVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYLHQDVFIINRAFLYGLLQLFEEHEHLGMIGMVGAQYVPPTGVWNEGRGIVGKVIGYMNDLFYMASLEQPYHESKTFIPVECIDGLLMATQYDVPWREDLFDGFDFYDVSQSFEFKKAGYTVGVPVQRDAWCIHYHFDVNMTNYEKYRKIFVEHYMSDVNKEE
>NZ_CP009300.1|WP_000651527.1|3310551_3311232_-|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCVNNEELFKQCESQIRNIFVPPGYVVQIFPIRDAQSMASAYNRALSYPAKYKVYIHQDTYLINRDMFSTLISLFKENEKLGLIGVAGAQFLPNNGIWWEGKNLVGKVIEYRRRNYQLLNLDQVFYGNQPFLSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS
>NZ_CP009300.1|WP_001079116.1|3321608_3322502_-|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFQGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTAMIPSDMQEVLRQT
>NZ_CP009300.1|WP_000673194.1|3322517_3323315_-|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP009300.1|WP_001081482.1|3323333_3323972_-|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP009300.1|WP_001180009.1|3324002_3324374_-|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP009300.1|WP_000191105.1|3324520_3325099_+|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP009300.1|WP_000043381.1|3325279_3325678_+|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP009300.1|WP_000360638.1|3325677_3326571_+|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP009300.1|WP_000003393.1|3327093_3328920_-|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP009300.1|WP_042513094.1|3328970_3330215_-|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNTANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYQVGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP009300.1|WP_000799201.1|3330296_3331841_-|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLFDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009300_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009300_5

5165114-5165220

Orphan

Consensus_repeat	Method
TATATCGGCGATTTTTAAGATATATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009300_5

>merge|NZ_CP009300|5|5165114-5165220|CRISPRCasFinder
TATATCGGCGATTTTTAAGATATATCAGCGATTCTTAACTTTTATCGGCGATTTTCACATTTTATCGACCGATACTTAAAATATATCAGCGATTTTTAAGATATATC

>NZ_CP009300|5|3|5165114-5165220|CRISPRCasFinder
TATATCGGCGATTTTTAAGATATATC	AGCGATTCTTAACTTTTATCGGCGATTTTCACATTTTATCGACCGATACTTAAAA
TATATCAGCGATTTTTAAGATATATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009300.1\|WP_000957374.1\|5167859_5168591_-\|yteA-family-sporulation-protein	unknown	unknown	gnl\|CDD\|274340
NZ_CP009300.1\|WP_001147838.1\|5166505_5167288_-\|TIGR00266-family-protein	unknown	unknown	gnl\|CDD\|376704
NZ_CP009300.1\|WP_042513485.1\|5174921_5176367_+\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|235146
NZ_CP009300.1\|WP_001103368.1\|5172990_5173803_+\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	unknown	unknown	gnl\|CDD\|274729
NZ_CP009300.1\|WP_042513482.1\|5151710_5155934_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173800
NZ_CP009300.1\|WP_033681254.1\|5161220_5162651_+\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP009300.1\|WP_000504155.1\|5160073_5161108_+\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP009300.1\|WP_000616715.1\|5169848_5171243_+\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
NZ_CP009300.1\|WP_000057610.1\|5158924_5160055_+\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP009300.1\|WP_000963876.1\|5173872_5174691_+\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|180958
NZ_CP009300.1\|WP_042513484.1\|5171239_5172994_+\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|236020
NZ_CP009300.1\|WP_000842310.1\|5140911_5141907_-\|potassium-channel-protein	unknown	unknown	gnl\|CDD\|369572
NZ_CP009300.1\|WP_000386685.1\|5142002_5142683_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP009300.1\|WP_042513483.1\|5157039_5158977_+\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445
NZ_CP009300.1\|WP_001260120.1\|5165504_5166227_-\|lipase-family-protein	unknown	unknown	gnl\|CDD\|238287
NZ_CP009300.1\|WP_001193054.1\|5167614_5167815_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP009300.1\|WP_000425747.1\|5168700_5169654_-\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP009300.1\|WP_000053948.1\|5155966_5156572_-\|cell-division-protein-FtsN	unknown	unknown	gnl\|CDD\|372085
NZ_CP009300.1\|WP_000494083.1\|5162669_5165078_+\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|340853
NZ_CP009300.1\|WP_000715339.1\|5150594_5151539_+\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|178836

Protein	Function_ID	Function_description	E-value
NZ_CP009300.1\|WP_000957374.1\|5167859_5168591_-\|yteA-family-sporulation-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	7.0071e-76
NZ_CP009300.1\|WP_001147838.1\|5166505_5167288_-\|TIGR00266-family-protein	gnl\|CDD\|376704	pfam01987, AIM24, Mitochondrial biogenesis AIM24. In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.	2.19617e-86
NZ_CP009300.1\|WP_042513485.1\|5174921_5176367_+\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|235146	PRK03640, PRK03640, o-succinylbenzoate--CoA ligase.	0
NZ_CP009300.1\|WP_001103368.1\|5172990_5173803_+\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	9.62975e-130
NZ_CP009300.1\|WP_042513482.1\|5151710_5155934_-\|S8-family-serine-peptidase	gnl\|CDD\|173800	cd07474, Peptidases_S8_subtilisin_Vpr-like, Peptidase S8 family domain in Vpr-like proteins. The maturation of the peptide antibiotic (lantibiotic) subtilin in Bacillus subtilis ATCC 6633 includes posttranslational modifications of the propeptide and proteolytic cleavage of the leader peptide. Vpr was identified as one of the proteases, along with WprA, that are capable of processing subtilin. Asp, Ser, His triadPeptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	1.23638e-72
NZ_CP009300.1\|WP_033681254.1\|5161220_5162651_+\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP009300.1\|WP_000504155.1\|5160073_5161108_+\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	1.51781e-124
NZ_CP009300.1\|WP_000616715.1\|5169848_5171243_+\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	2.58992e-115
NZ_CP009300.1\|WP_000057610.1\|5158924_5160055_+\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP009300.1\|WP_000963876.1\|5173872_5174691_+\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|180958	PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated.	0
NZ_CP009300.1\|WP_042513484.1\|5171239_5172994_+\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|236020	PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated.	0
NZ_CP009300.1\|WP_000842310.1\|5140911_5141907_-\|potassium-channel-protein	gnl\|CDD\|369572	pfam07885, Ion_trans_2, Ion channel. This family includes the two membrane helix type ion channels found in bacteria.	1.50592e-14
NZ_CP009300.1\|WP_000386685.1\|5142002_5142683_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	4.42486e-52
NZ_CP009300.1\|WP_042513483.1\|5157039_5158977_+\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
NZ_CP009300.1\|WP_001260120.1\|5165504_5166227_-\|lipase-family-protein	gnl\|CDD\|238287	cd00519, Lipase_3, Lipase (class 3). Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. .	6.32344e-48
NZ_CP009300.1\|WP_001193054.1\|5167614_5167815_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	2.0492e-32
NZ_CP009300.1\|WP_000425747.1\|5168700_5169654_-\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	1.86783e-131
NZ_CP009300.1\|WP_000053948.1\|5155966_5156572_-\|cell-division-protein-FtsN	gnl\|CDD\|372085	pfam12389, Peptidase_M73, Camelysin metallo-endopeptidase.	1.26785e-97
NZ_CP009300.1\|WP_000494083.1\|5162669_5165078_+\|glycogen-phosphorylase	gnl\|CDD\|340853	cd04300, GT35_Glycogen_Phosphorylase, glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0
NZ_CP009300.1\|WP_000715339.1\|5150594_5151539_+\|L-lactate-dehydrogenase	gnl\|CDD\|178836	PRK00066, ldh, L-lactate dehydrogenase; Reviewed.	0

>NZ_CP009300.1|WP_000494083.1|5162669_5165078_+|glycogen-phosphorylase
MFTHVESFKSAFLEKLETMYGKSFKDSTTRDQYNTLGYMVREYMNSQWIATNESYRSGERKQMYYLSIEFLLGRLLGSNILNLGIRDVCEQGLSELGISLQQLEEVEADAGLGNGGLGRLAACFLDSLASLNLPGHGCGIRYKHGLFDQKIVDGYQVEFPEQWLLHENVWEVRRHDQAVEVSYFGNVEPLYIDGRLEFRHTNAEVIMAVPYDVPVVGYETSTVNTLRLWNAEPVPFPQNCKDILKYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVSASLQNIVRLHRERYGDLRQLHEKIAIHINDTHPVLAIPELMRILLDEEKLAWEEAWHITTQTISYTNHTTLSEALEKWPIHIFKPLLPRIYMIIEEINERFCHELWERYPYEWHRIEEMAIIAHDLVKMAHLAIVGSHSVNGVAKIHTEILKQREMRLFYEFYPDKFNNKTNGIAHRRWLMKANPQLTNLISEAIGTEWKKEPIKLQELQLVQYDASFQEKFAEVKQERKEILAERIHNTMGITIDPNSIFDVQVKRLHAYKRQLLNVLHILYLYNRLKEDASFTFYPRTFIFGAKASPGYYYAKKIIKLINELARKVNNDPYVSQYMKVIFLENYRVSLAEDIFPAADVSEQISTASKEASGTGNMKFMMNGAITLGTLDGANIEIKDRVGDDNCFIFGLTAEEVLHYYQNGGYRASDYYHHNGHIKKVVDQLTNGFFAQSGAEFEAIYDSLVIQNDEYFVLRDFGPYAERQEAVGRAYENRTKWLEMSILNIAQSGHFASDRTILQYSNEIWGIGNTVTQI
>NZ_CP009300.1|WP_033681254.1|5161220_5162651_+|glycogen-synthase-GlgA
MNILFAVSECVPFVKSGGLADVAGALPKELKKLGVEVRIILPNYSLIPQKLRDGCTLHKVINVPLGWRNQYCGILKGEQDGITYYLIDNEYYFKRDSLYGHYDDGERFSYFSKAVLECIPHLDFEVDVLHSHDWHTAMVNFLLREKYQDNPLYEHIKTVYTIHNLQFQGVFPPEVMYDLLELGDEYFHSEQLEFYGNVNFMKGGIIASDQITAVSPTYKEEIQYEFFGEKLDGLLRKYNDKLSGIVNGIDTSVYNPETDSYITAQYAVDSLYEKNENKRALQRYFGLPEKEDTPIISMVTRLTKQKGLDLVRTVFREIMEEDVQCIILGSGDSEYEQFFEWMAYEYPEKVKVYIGFNEELAHQVYAGSDLFLMPSLFEPCGLGQLIALAYGTIPIVRETGGLNDTVQSYDEETGEGNGFSFTNFNAHDMLHTVLRAIEFYHDKPVWDRLVKQAMTEDYSWEKSALAYKKLYKSLME
>NZ_CP009300.1|WP_000504155.1|5160073_5161108_+|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MGEKMLGIINATGSFPSLKKVTGHRSLAALPFGGRYRLIDFMLSNMVNSNIHSVAVFTSHKNRSLMDHVGSGKQWDLDRKRDGLFLFPPNCQCDQDEFGSFAHFRRHIDYFLRSREEYVVITNSHLVTALNFQAVLERHIHTAADITEVCHEGVSLQTYVLKKQLLLDLFEAYKDMEQYSLFDVVREKRGKSLHIATYEHTGYVAIIDSIESYYKHSLEILQPAIWKQVFKKEAPIFTKVKDEPPTRYVKGAAVKNTMIANGSIIEGEVENSVVSRSVKIGKGSIVRNSIIMQKSQIGDNCIIDGVIIDKDVKIGDGVVLKGNADEPYVVEKGSVQNSTINSYS
>NZ_CP009300.1|WP_000057610.1|5158924_5160055_+|glucose-1-phosphate-adenylyltransferase
MAQKQKCVAMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPDYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVEFEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVGTVKSLWEANMDLLRDETSLNLNDRDWRIYSVNPNEPPQYIAEKAKVEESLINEGCVIEGDVKHSVLFQGVTVEEGSMVIDSVVMPGAKIGKNVVIERAIVGSEMVIEDGTIIRPEKNVDDVVLIAEGK
>NZ_CP009300.1|WP_042513483.1|5157039_5158977_+|1,4-alpha-glucan-branching-protein-GlgB
MSVINCEEVKRDEFHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDYEQHKMLQVTEEGIWSLFIPHIEEREIYKYAIETMAGAVIFKADPYAVYAEVRPNTASVVFDIKGYEWNDKNWSRKKKKKSVYKEAMTVYELHFGSWKKKEDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPYDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRYFHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLVTAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHDKMTFSLLYTYSENFILPLSHDEVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDWNLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSREGFQWIDANNNEQSIFSFIRQGDKQEDALVVVCNFTKATYENYKVGVPDFEYYNEILNSDAEQYGGSGQVNKKRLKTIQEPYHNQTAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
>NZ_CP009300.1|WP_000053948.1|5155966_5156572_-|cell-division-protein-FtsN
MSLKQKVGMGVVTATLGLSLTFGGVFAYFSDSETSSNSFQAGTLDLSINPSVIIDVKDLKPGDFIERNFTLENKGTLDIAKVALETSYEVTDAKKNNDGEDLGDHIIVKFLVNDGKPSNPNDDHEILWETKLSQLKTMKPEDVATSLERHNLIDGIKSGETDYLHVLFSFEDNEQDQNTFQGDSLQLNWTFHAKQTPGTEK
>NZ_CP009300.1|WP_042513482.1|5151710_5155934_-|S8-family-serine-peptidase
MKKKNRFVTGIVTAGVLFSTALPFNVLAENPINQIDSSNAQSLLSKLSKEQRQALQTLDANPGFTISPDINTSSSEPVNIIVEFQTAPVKINELKQKEKGLQAAPENIKARIDQEHEEFQKGLKRLYHFSPSVKSGNFQSVQIKRSYKHAINGVALTLPANIVEELLRIGVVKRIWKDYEVKLNLPKQSEQKAPQKLTDSIPQIGVDKLHSEGITGKGIKVGVLDTGIDYNHPDLKDVYKGYRAKPGEDSSKIDPNSVKGWDFISNDADPMETTYTEWQQSGAPEFDDRGSSFYTAHGTHVAGIVSAQKKNKSDSAVKGVAPDIELYNYRVLGPYGSGASSGIIAAIDKSISDGMNVINLSLGDDSNNPLDPTSIAVNNAMLSGVVTVVAAGNSGPNPATLGSPGASPFAITVGASDSSISLPKLSGHAGQVQFPNLILFGKNFTDKIEDFKGQSLPIESVGIGTANEFSQKDVKGKIALIARGTLSFDEKIANAKQAGAKAVIIYNNVDGEIPFYIGESTKYIPAFRLTKEDGEKLKAQIEQGNTSFTFDELTYIQTEGDHLADFSSRGPVTSNDDIKPDITAPGVAVLSTVPEYINDPQEGENYDVSYERMQGTSMASPHIAGVAALILQEHPEYSPFDVKASLMNTADDLKEKYSVYEVGAGRIDAYNAVHTETSFKVLDTTKTVVNDEIIEVPEETGSIAFGKFYQKDGEALEQKRNIKVENHNKQEKKEFKTEISYTPASSSINDAIANGVKVSTPETITLDAGKSDEIEAKINVPAGVKQGRYEGYIHITNTKNKEETYQIPFSIRVSEPGIEDAVLSRKSISTDTTKFNPYRESYVHGAFQLNSNLETLDLIVKDSKTNKALGFLGTLNTSGLQTDVYYYLESFFNGKVYPFTNDSAKPIGDEKIDLPEGDYTIEFVGYDKDGKARVKDDYVVIDNTPPEVKLTGLKPGIYELNEENYAVEDGKKALWIKGNVYDSNVDYLKGKGLNITQEANGVMYYDYSPYLHKFLPIDANGDFKIGITPESFKVEGPMNTGVYIFDYATAGPDYPSGVNNYWFIQQGAQYAKASYDKKELYKGDEFTVTLNAKHVKQFVAGEFNVKFLEKNFKFANVKLNPAFEKLLSEKGVTAKVNEPKLEEGSVTVGGTIDDKNFAGLDGDFPFIDVTFKVENDEFYEANAQLESPVFVYWKPGETEPNRMRVLQDQTFSVMSLNSLVEGNIKPGAFLNERGYLDEKFDYTKLGVKVYATDSYRHKFEGSLDKYGYFKLNGLPVNKRDYNLFVEVPGHLTSRLTTKLGTEKDGKLLGQYYYARLDENLAGDVNGDKVIDIKDAEIIASNYGKKGLSVKDGDLNKDGIVDEKDIRFVEKNFLKKGPDASKSQTAAEKSKSGTLADILKKLGLTPKK
>NZ_CP009300.1|WP_000715339.1|5150594_5151539_+|L-lactate-dehydrogenase
MKKGINRVVLVGTGAVGCSYAYSMINQGVAEEFVLVDVNEAKAEGEAMDLSHAVPFSPSPTKVWSGSYADCKDADLVVITAGLPQKPGETRLDLVEKNTKIFKQIVRGIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGDYLDVDPRNVHAYIVGEHGDTELPVWSHATIGVQKLETILANNEQYKQEDLDKIFENVRDAAYHIIERKGATYYGIGMSLLRVTKAILNNENSVLTVSAYLEGQYGEKDAYVGVPAVINREGVREIVELELNEEEKAKFAHSVKVLKETMAPVL
>NZ_CP009300.1|WP_000386685.1|5142002_5142683_-|MgtC/SapB-family-protein
MDYTDLLIKLGLSAILGFAIGLERELKRKPLGLKTCLVISIISCLLTIVSIKAAYNLPHTDHMNMDPLRLAAQIVSGIGFLGAGVILRRGNDSIAGLTTAAMIWGASGIGIAVGAGFYIEAIFGMCFLMISVELIPLTMKFVGPRSFRQRDIVVKLVVRNMDNIPVVIEEIKEMDIKVKNMKLKTLENGSHYLHLKLCIDQKRHTADVYYALQHLESVQQTEVESM
>NZ_CP009300.1|WP_000842310.1|5140911_5141907_-|potassium-channel-protein
MKSRPKLVDAFRDSIIFRLICFIVVLTAFSGFLIHILEPSHFTTWFDGIWWSIVTIFTVGYGDFAPHTLIGKLIGIGIILFGTGFCSYYMVLFATDMINKQYMKVKGEEAATSNGHMIIVGWNERAKHVVKQMHILQPNLDIVLIDETLSLLPKPFHHLEFIKGCPHHDQTLLKANITTAHTILITADKEKNESLADTQSILNILTAKGLNPNIHCIAELLTSEQIQNATRAGASEIIEGNKLTSYVFTASLLFPSISGVLFSLYNEISDNKLQLMELPSSCTGQTFANCSYTLLKQNILLLGIKRDEQYMINPVHSFVLIQSDILIVIHH
>NZ_CP009300.1|WP_001260120.1|5165504_5166227_-|lipase-family-protein
MRTPLSFDKDTAILLASCCELTYEQYKQNGIFEIPDGFQYVQGFQGKTIQTTEWFGFILESEDTIIVAFRGTQTDTDWIIDSLVNQKPYPYALNSGNVHNGFLSIYESCRDSIMDMLVSLPAHKKLLATGHSLGGALATLHILDARINTAFAQYGLYTFASPKVGDIAFRNYYKLQVASSFRFVNLFDVVPLLPPRNVHFNEQDWEYAHVHHNMTFTKNTKSIANNHAMTTYKTCLTSHF
>NZ_CP009300.1|WP_001147838.1|5166505_5167288_-|TIGR00266-family-protein
MQAHEIEYKLYGDDMQFVEIELDPEESVIAEAGAMMMMEDYIEMETIFGDGSGPSGGLFGKLMGAGKRLVTGESMFMTVFTNTGHGKRHVSFAAPYPGKIIPVDLTEYQGKVVCQKDAFLCAAKGVSIGIEFTKKIGTGFFGGEGFIMQKLEGDGLAFMHAGGTVYKRELKPGEKLRIDTGCLVAMTKDVNYDVEFVGKVKTALFGGEGLFFATLEGPGTVWIQSLTLSRLSARLTSPAAQGSGEGSVLGGLGRLLDGKE
>NZ_CP009300.1|WP_001193054.1|5167614_5167815_+|cold-shock-protein
MQTGKVKWFNSEKGFGFIEVEGGDDVFVHFSAIQGDGFKTLEEGQEVSFEIVEGNRGPQAANVTKN
>NZ_CP009300.1|WP_000957374.1|5167859_5168591_-|yteA-family-sporulation-protein
MLTPQQINQFKSVLEKQKQELEQTIQTHENEDRASERESVGELSSYDNHPADMATELYEREKDFGLIELWHKQLEDTKHALQKIEAGTYGICEVSGEEIPFERLEAMPTATTCIQHATNKLNMDTRPVEEEVLSPSFHKHDEDRSVEYDAEDAWQDVANYGTSETPADLERRDSKNYNGMYVNSEENVGYVEDFENFIGTDMYGKNPQVFATEEHEEYEQMLDDFEDRTFKGELSSNESSSKE
>NZ_CP009300.1|WP_000425747.1|5168700_5169654_-|1,4-dihydroxy-2-naphthoate-polyprenyltransferase
MEMNVETNSSPTAPKPSKQTGWRIWWSLLRPHTLTAAFVPVFIGTAYAMQVGGINQIHLPLFLIMLLACLLIQAATNMFNEYFDYKRGLDHEGSVGIGGAIVRDGIQPKTVLNLAFGFFGIAILLGVYICMNSSWWLAAIGLVCMAVAYLYTGGPLPIAYTPFGELTAGLFMGVIIIGISFFIQTGTVTSEVVLLSIPSSILIGAILLANNIRDLDGDKENGRKTLAILVGRERAVGVLASMFIVSYIWTIALIIVGIVSPWMLIVFLSAPKAFKATKGFIGKSIPMEMVPAMIATAKTNTIFGLLMGIGLLLGYFL
>NZ_CP009300.1|WP_000616715.1|5169848_5171243_+|isochorismate-synthase
MIQTKQIGLQEVLSAAIKRATDEKILVSFVKQIDWMDPLLFYAAGKRIAFENRCYFADPAQHVIFAGIGSVFTIATASHKRFQTARDEWDKVKEKAFVQREKYEFGTGPLLFGGFSFDQEKEKTDLWKEFDDTTFSLPAFLLTVKNEKAWLTMNTFVSATDCAETLYNEIVSLEEKIFEESKCALEGSKLTVTSKVEVDPKGWMKAIEKVQDEMKQGNVQKVVLARELKVEMDHHIDSALVLEALRIGQPDCYVFSFDYKGACFLGATPERLIRKEDEKFTSMCLAGSTGHGQSIEESKRNSNALLHDEKNLAEHGYVVNMIRSVLNEHCEYVNIPESPGLLTTKNLIHLYTPVEAKGDASLLTMVEELHPTPALGGTPRLEAMKLIRDVELLDRGLYGAPIGWIDDEGNGEFAVALRCGLLNGEKASLFAGCGIVIDSVPQLEYEETSLKFRPMLGALEELMK
>NZ_CP009300.1|WP_042513484.1|5171239_5172994_+|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MNNHIEALSYYLGAFVDELTRLNVCDVVISPGSRSTPIALLMEQHEGMNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQINLYGTFVKQFTEMALPEANEAMYHYARMTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLESLWDKGRGEYTGVVQQGNVTMPSEYVDSLVGRLSHMEKGLIICGDDSHSEIATFAAELAEKTGYPILADPLSNIRSGHHDKTMVIDCYDTFLRNELLKETWKPDVLIRFGGMPVSKALTQFIKKQTKAVHIVVDESGQWRDPALVATEVVQASDIAFCSALIEKMPVMKKNDWFRMWQHINEKTKETLREMETYDTAFEGRVITDIVRVLPEGATLFASNSMPIRDTDSFFFTSDKNIQVMANRGVNGIDGIISTALGASMICDPLVLVIGDLSFYHDLNGLLAAKLHELDITIVVVNNDGGGIFSFLPQYEKKEHFESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGTRAEGLHVVEICTNRDENLTLHRKLWAKTQDVITTSLQGESK
>NZ_CP009300.1|WP_001103368.1|5172990_5173803_+|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLEREDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNSNGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDEKFFRILKNIEKCVSDAKFVKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
>NZ_CP009300.1|WP_000963876.1|5173872_5174691_+|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MAIEWVKEGNYEDIIYSTYNGIAKISINRPEVHNAFRPKTVMELIDAFAHARDDANVGVIILTGEGGRAFCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRAIPKPVIAMVAGYAIGGGHVLHIVCDLTIAADNAVFGQTGPKVGSFDGGYGAGYLARMVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQLEAETVQWAQEILANSPMALRFLKAAFNADTDGLAGIQQLAGDATLLYYTTDEAKEGRDAFKEKRSPDFGQFPRFP
>NZ_CP009300.1|WP_042513485.1|5174921_5176367_+|o-succinylbenzoate--CoA-ligase
METMPNWLMQRAFLTPDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKHGQKVAVLMKNGMEMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQDFEAKDIPVYSFAEIMNGPKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDANFIHKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMLLGGGPAPKPLLETCVDKGIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLRIEKDGVVVPPFVEGEIVVKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPAQIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVVKSGEITEEEILHFCEEKLAKYKVPKKACFLEELPRNASKKLLRRELRQLVEEM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009300_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009300_6

5340693-5340800

Orphan

Consensus_repeat	Method
GATATATTTAAAAAATCGCTGATATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009300_6

>merge|NZ_CP009300|6|5340693-5340800|CRISPRCasFinder
GATATATTCAAAAAATCGCTGATATATTTCGAGTTGTGGTCGATATATTTAAAAAATCGCTGATATATTTCGAGTTGTGGTCGATATATTTAAAAAATCGCTGATATA

>NZ_CP009300|6|4|5340693-5340800|CRISPRCasFinder
GATATATTCAAAAAATCGCTGATATA	TTTCGAGTTGTGGTCGATATATTTAAAAAATCGCTGATATATTTCGAGTTGTGGTC
GATATATTTAAAAAATCGCTGATATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009300.1\|WP_000475170.1\|5345159_5345840_-\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP009300.1\|WP_001057490.1\|5339026_5339353_+\|bacillithiol-system-redox-active-protein-YtxJ	unknown	unknown	gnl\|CDD\|378538
NZ_CP009300.1\|WP_042513530.1\|5345989_5347444_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP009300.1\|WP_042513527.1\|5336544_5336727_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000636582.1\|5343302_5343575_+\|DUF3917-domain-containing-protein	unknown	unknown	gnl\|CDD\|372449
NZ_CP009300.1\|WP_001010613.1\|5336143_5336548_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369049
NZ_CP009300.1\|WP_001103285.1\|5341139_5342138_+\|catabolite-control-protein-A	unknown	unknown	gnl\|CDD\|130546
NZ_CP009300.1\|WP_000267006.1\|5343626_5344025_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|184416
NZ_CP009300.1\|WP_000738004.1\|5339471_5340488_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227188
NZ_CP009300.1\|WP_001994537.1\|5342173_5342536_-\|DUF4288-domain-containing-protein	unknown	unknown	gnl\|CDD\|379479
NZ_CP009300.1\|WP_000637893.1\|5342537_5342774_-\|DUF3949-domain-containing-protein	unknown	unknown	gnl\|CDD\|315735
NZ_CP009300.1\|WP_042513528.1\|5336742_5337177_+\|lipoprotein	unknown	unknown	unknown
NZ_CP009300.1\|WP_042513529.1\|5344153_5345080_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP009300.1\|WP_000494668.1\|5331191_5331740_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP009300.1\|WP_000502333.1\|5348256_5348526_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_042513526.1\|5333771_5335742_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
NZ_CP009300.1\|WP_000389138.1\|5342855_5343152_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009300.1\|WP_000654739.1\|5337211_5338327_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|225191
NZ_CP009300.1\|WP_001998456.1\|5338469_5339027_+\|DUF948-domain-containing-protein	unknown	unknown	gnl\|CDD\|227109
NZ_CP009300.1\|WP_042513525.1\|5333023_5333797_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059

Protein	Function_ID	Function_description	E-value
NZ_CP009300.1\|WP_000475170.1\|5345159_5345840_-\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	8.19323e-25
NZ_CP009300.1\|WP_001057490.1\|5339026_5339353_+\|bacillithiol-system-redox-active-protein-YtxJ	gnl\|CDD\|378538	pfam11009, DUF2847, Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed.	4.38943e-48
NZ_CP009300.1\|WP_042513530.1\|5345989_5347444_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.83475e-61
NZ_CP009300.1\|WP_000636582.1\|5343302_5343575_+\|DUF3917-domain-containing-protein	gnl\|CDD\|372449	pfam13055, DUF3917, Protein of unknown function (DUF3917). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	5.52795e-24
NZ_CP009300.1\|WP_000738004.1\|5339471_5340488_+\|hypothetical-protein	gnl\|CDD\|227188	COG4851, CamS, Protein involved in sex pheromone biosynthesis [General function prediction only].	4.95096e-63
NZ_CP009300.1\|WP_000267006.1\|5343626_5344025_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|184416	PRK13955, mscL, large conductance mechanosensitive channel protein MscL.	1.03243e-76
NZ_CP009300.1\|WP_001010613.1\|5336143_5336548_+\|PH-domain-containing-protein	gnl\|CDD\|369049	pfam06713, bPH_4, Bacterial PH domain. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown. Members of this family have a PH domain like structure.	2.42768e-11
NZ_CP009300.1\|WP_001994537.1\|5342173_5342536_-\|DUF4288-domain-containing-protein	gnl\|CDD\|379479	pfam14119, DUF4288, Domain of unknown function (DUF4288). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.	5.53555e-20
NZ_CP009300.1\|WP_000637893.1\|5342537_5342774_-\|DUF3949-domain-containing-protein	gnl\|CDD\|315735	pfam13133, DUF3949, Protein of unknown function (DUF3949). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 69 and 87 amino acids in length.	3.45415e-24
NZ_CP009300.1\|WP_001103285.1\|5341139_5342138_+\|catabolite-control-protein-A	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	0
NZ_CP009300.1\|WP_042513529.1\|5344153_5345080_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	1.39467e-48
NZ_CP009300.1\|WP_000494668.1\|5331191_5331740_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.35937e-28
NZ_CP009300.1\|WP_042513526.1\|5333771_5335742_+\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	1.23352e-06
NZ_CP009300.1\|WP_000654739.1\|5337211_5338327_-\|aminopeptidase	gnl\|CDD\|225191	COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism].	2.90365e-128
NZ_CP009300.1\|WP_001998456.1\|5338469_5339027_+\|DUF948-domain-containing-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	4.44562e-36
NZ_CP009300.1\|WP_042513525.1\|5333023_5333797_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	2.38058e-109

>NZ_CP009300.1|WP_000738004.1|5339471_5340488_+|hypothetical-protein
MKKMALSFAVVSLLLGACSNDTISKKDEVIQKDTKEKSMIPRTAVSKDYYRTVIPLKEQKVINTANIKTNSKLDLAEYENGLMNIAKEQFDTENHVLQLNQYIPEKLVDELVAKVEAPVLTNIIEQDYFGKQNSNELSLSGVMIGLAMSSSVSNEEAMSKGTEVANQLIEAIHKNDKYNKSPITFAIFKQESTSSLKNGTYIASATVQKNDTNLGNWNAIEEKAYSYPSDEFTQAHGEDNTKINKFAEEMKGFSPGDFIPVNAKVSYKKNQMDTLNMNIVIKYNGKTELMALTQLAAQIMLEQLPKDAKVQLQIKSENKIEAIVIKEKNSDKPFVSFL
>NZ_CP009300.1|WP_001057490.1|5339026_5339353_+|bacillithiol-system-redox-active-protein-YtxJ
MNMTKVETIEELEVLVEKNEPYVLFKHSTTCPISHGAYTEFQAYCSEERAVPAYYLYVQDARDVSNRVAEQYSIKHESPQVLYIKDGMVVWNTSHWNIKKDALEENIK
>NZ_CP009300.1|WP_001998456.1|5338469_5339027_+|DUF948-domain-containing-protein
MYNRGKYEKDKGSDEMQVLLYVSAAIIAVAFAVLVVYVCRTLLSVQKTLENVASTLEGLEKQMQGISVETEQLLHKTNALADDIQQKSQSLNKVVSGVDGIGTTIHSLNTKLRNVSESVTDEIENNADKVAQVVQWSSAAIEVYNHYRATRQEKKVEKEERKLERLEKKAEKKEKRSRLRMRGES
>NZ_CP009300.1|WP_000654739.1|5337211_5338327_-|aminopeptidase
MKDPRIEKLAYNLINYSIRLQKGEKVLIENFGLQKELVTALVKEAYAAGGFPFVSLKDHQVDRSLLMGATEEHFEQIAAYEASVMKDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDIRVPKTRWVVLRYPNASMAQLAKMSTEAFEDFYFEVCNLDYGKMDKAMDSLVTLMNKTDKVRLTGPGTDLTFSIKDIPAIKCSGHLNIPDGEVYSAPVRDSVNGTVSYNTPSPYNGYTFENVQLKFENGQIVEATANDTERINKIFDTDEGARYVGEFAIGVNPYILHPMGDILFDEKIDGSFHFTPGQAYDDAWNGNNSNIHWDLVCIQRPEYGGGEIYFDDVLIRKDGRFVVPELEALNPENLK
>NZ_CP009300.1|WP_042513528.1|5336742_5337177_+|lipoprotein
MKKVLMLFVLLLTASVLLLGCSTKKEKAGMNLEKAQKVEIESLTDSSEKKVITDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKELHEIGTMTVYKDVPYVEVEMKNKKMSFKVPEDVAKDLLKY
>NZ_CP009300.1|WP_042513527.1|5336544_5336727_+|hypothetical-protein
MKYVKPLFCLEILLVIVICTRGYMKWDLPLYVPILIGIIAVALLYYFHFQQTKSEKSSSI
>NZ_CP009300.1|WP_001010613.1|5336143_5336548_+|PH-domain-containing-protein
MNFPIQRSKSVVFFVCLTLAFMFVYPLVMIIANKEQWMSALIGMGLCFIVNVPLVWEVFIKKHKVENGVLKYGILNDDIVLKEIRIIRQVGKNLEITTNAYKVHMVAMPQHMEQFLSLVEKENPHVKIEMVGKK
>NZ_CP009300.1|WP_042513526.1|5333771_5335742_+|ABC-transporter-permease
MNFRQFALNNVIRNKRLYLGHFLSSTFAVIILFTFELLTFHPNFTGNLVSTSATISALGTQGFKIAQYLIIFFSFFFILYSITTFLKARKKEFGILILHGMSNSQLKKLIFMENLLIGCSAIIVGIGTGLVFGKLILLISASIFLLEGGLPFYFPIKAILVTSSMFFILFILVSFFTVRVMKVSQVIELLKAEEKPKKEPKSSKWLAFFSILCIIIGYVSAFCLDTALNNGNAYIYVMLICVCSSVLGTYFLFTQLSFYVIKMLKKRQHTFLKRTNMLTISELTYRITDNARTLFLVSILSAVAFTSIGACLAIGNGALAEVDSPYAFEYTSLKGNKEESSHISQIEKQLHDAGFSYKLVTSTGFDTEDGSTIMNLTDYNATAKTLGYSAEILKKETDSLILASKKYLRTTSQKELKKVSSSLTIEHGNMHFNLSGNKILRDNIISPSSHISVVVSDSMYETILNKKQLAEVKADQYKVYRFLIENMHETAAVAKKLEKLIPNDYVNPYRLFMFKCSVLNWLEGKQVNAILSIISVLVGVVFFIFAISFLYFRLFTDLDRDKSQFQMLSKIGLTKRELKKTVTQQTSILFFVPILISVLHSSVAFLAIRFLAQKKQIELPVAENSILIFTSFISVQIIYYLIIRKKYLRQILHSIK
>NZ_CP009300.1|WP_042513525.1|5333023_5333797_+|ABC-transporter-ATP-binding-protein
MSILTVRNLNKIYSTGKVSYKALSNIDLTIQKGEFVGIMGASGSGKSTLLNMISTIDTPTFGEVFINEKNPYCLSSNDLALFRRRELGFVFQSFNLMNTLTVKENIVLPLTLDNVSLNDMNEKVEVISKQLGIEKILNKRTYEISGGQAQRTAIARALIHSPQLILADEPTGNLDSKAANDVMELLKKLNQEEQVTMMLVIHDPVAASYCDRVVFMKDGSFYNEIYCGENRSIFHKNIMGVVSLLGGNQHEFSSVRA
>NZ_CP009300.1|WP_000494668.1|5331191_5331740_+|GNAT-family-N-acetyltransferase
MFTLRVDDEIELQLLEKHHKEELYQLINQNRNHLRRWLPWVDGTKSADAYNEICPMWLKKFAEGDGFESGIRYKGKLVGMVGIHPVSWGKKAASLGYYLAEDAGGKGIMTRSVKAVLHYAFENLKLNKMEIRCGVDNVKSRAIPERLGFKLDGILRDEEWLYDHFHDIAVYSLLASEWKEIR
>NZ_CP009300.1|WP_001103285.1|5341139_5342138_+|catabolite-control-protein-A
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKTTTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGIVFMGEDITDIHAEEFKKSPVPIVLAASFDEQNETPSVNIDYTQAAYDAMKHFIEQGHKRIGFVSGPFIDKAGSAKKLQGYRKALEEAGISYDENLVIDGDYTYDSGIEAFEKLWSLDEKPTAIFVSSDEMALGVIHAAQDAGLNVPTDVEVLGFDNTRLALMVRPQLSTVVQPMYDIGAVAMRLLTKYMNKEKVEDHTVILPHRIQFRDSTK
>NZ_CP009300.1|WP_001994537.1|5342173_5342536_-|DUF4288-domain-containing-protein
MYAVKLLFESVHSGEPDPTKMDGHYEENHDTLFEESIILVKASSLEEAHALSEQIAIQSEHTYVNMYDEQITWTFRKVLHVFELDNAPFETGKELYARFLHVKKNETVDTIVQTYYPEYK
>NZ_CP009300.1|WP_000637893.1|5342537_5342774_-|DUF3949-domain-containing-protein
MIWISLIVLAYFIILVPIQYNYIKLLKEKQKKLNVSQNELYDNMSYEESQVHYHYQSNVFTIPASLVASIIYRVKHAA
>NZ_CP009300.1|WP_000389138.1|5342855_5343152_-|hypothetical-protein
MEDDIVGYFTQVERFDYITIDLDKKFFYMEVVQLETNITLLKISLNLDKDETIIAGNVKQYDPSRLEQFIQSFKHTAQTCLAHNLRSPEELFAFWKGN
>NZ_CP009300.1|WP_000636582.1|5343302_5343575_+|DUF3917-domain-containing-protein
MIVLWIITLCITAIFAYMTLKQNGLKRFVPGSILAGIALITYVTSIFIESVSVDMSTSFMFMGITLFASSLMILMVAGIILFIHMNSETL
>NZ_CP009300.1|WP_000267006.1|5343626_5344025_-|large-conductance-mechanosensitive-channel-protein-MscL
MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTGLKITFGKASIMYGKFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEELPEPTKEEELLGEIRDLLKQQNSSKDRA
>NZ_CP009300.1|WP_042513529.1|5344153_5345080_-|Gfo/Idh/MocA-family-oxidoreductase
MNKPNIGMIGLGSIAQKAYLPTFTKETNWNFVGAFTPNAEKRKQVCQQYRIQDFHSIETLASECDAIFVHSSTATHYEIVSELLKKGIDVYVDKPLAATVEQAEKLVELSEKYNRKLMVGFNRRFVPMYVAAKEQAHHISWIRIEKHRTNKVGPYTYDFTMLDDYLHIVDTARWLANDELNVVHNMMQINEKNELLYGHHTYATANGLLLSTAMHRHAGTNLEQIELVTAGKIIRVKNMNTFEVEQENSVSQSGSPSWETTLKQRGFEDAVHHFIDCVHGDTKPVVDGLEGLRTQQLLQSLLDDANKK
>NZ_CP009300.1|WP_000475170.1|5345159_5345840_-|ankyrin-repeat-domain-containing-protein
MFKKTVSMICCVIFLQGCSQEQEVKKEMTNMETALLTATEKQETNTVISLLKKGADINITDNKGRTPLMIATYKNDVKTAKALIDAGADVNIQDDMKNNPFLYAGAEGYLHILKLTIDAGADPSLTNRYGGTALIPASEHGYIDVIKELLTRTNIDINHVNKLGWTALMEAIVLSNGNETQQQVIRLLIEHGADINIPDNDGITPLEHARAHHFEEIEKILLEGHK
>NZ_CP009300.1|WP_042513530.1|5345989_5347444_+|HAMP-domain-containing-histidine-kinase
MSIKTRFLFSYIAVILVSITLILIAGFLIVFSITGDLEAVKNFYKSSYIQKPLTSEEENAYIELKTAAKKHQSQLLDESFVSSLEKEGVKIVVRKGETISYATKVFESVALKEALPKFESANINSRGTTELGDTFYRYVKFDFYFPQEEEGSIFVLKKQSSFVDLTQKLFPILFVSLLLLAILLIGLLSYLVSRSVIKPIFVLKDATGKIKEGNLDFQIPVTSHDEIGQLNQGFEEMRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLTTIHTKARHMDTLIDELFLFSKLDLNRVPFQFETVELNMFMQELIEEMQMDLSKEGIEVNLQLHASPLYVTADCEKINRVISNLIHNSVKYMDKEEKKITVTVSSDNNKVIVKVMDNGSGIESDTLPYIFERFYRAEQSRNSSTGGSGLGLAIAKQIIEEHGGNIWAESELGKGTSIFFSLEKVEKCGE
>NZ_CP009300.1|WP_000502333.1|5348256_5348526_+|hypothetical-protein
MGDILKDNKSNKILKVGTNIILVLLLIGAIQMFYDDNYTNDHFGGLFMMGFFGIKIISSFIMSIKEGDKKAVFLDVGLMIVLFCLLFLV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP009300.1	915505-915531	0	1.0
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009300.1	915640-915666	0	1.0
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009300.1	915640-915666	0	1.0
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009300.1	915460-915486	0	1.0
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NZ_CP009300.1	915634-915660	0	1.0
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP009300.1	915640-915666	1	0.963
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP009300.1	3088418-3088444	1	0.963
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009300.1	915460-915486	1	0.963
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009300.1	915505-915531	1	0.963
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009300.1	915595-915621	1	0.963
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009300.1	915460-915486	1	0.963
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009300.1	915505-915531	1	0.963
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009300.1	915595-915621	1	0.963
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	915640-915666	1	0.963
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	3088418-3088444	1	0.963
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	915640-915666	1	0.963
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	3088418-3088444	1	0.963
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009300.1	915640-915666	1	0.963
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	915640-915666	1	0.963
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NZ_CP009300.1	915550-915576	1	0.963
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP009300.1	915505-915531	1	0.963
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP009300.1	915595-915621	1	0.963
NZ_CP009300_2	2.7\|916894\|27\|NZ_CP009300\|CRT	916894-916920	27	NZ_CP009300.1	915670-915696	1	0.963
NZ_CP009300_2	2.7\|916894\|27\|NZ_CP009300\|CRT	916894-916920	27	NZ_CP009300.1	916606-916632	1	0.963
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NZ_CP009300.1	915499-915525	1	0.963
NZ_CP009300_2	2.9\|916984\|18\|NZ_CP009300\|CRT	916984-917001	18	NZ_CP009300.1	915679-915696	1	0.944
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP009300.1	915244-915270	2	0.926
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP009300.1	915460-915486	2	0.926
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009300.1	3088418-3088444	2	0.926
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009300.1	3088679-3088705	2	0.926
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009300.1	3088418-3088444	2	0.926
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009300.1	3088679-3088705	2	0.926
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	915199-915225	2	0.926
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	915415-915441	2	0.926
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	915460-915486	2	0.926
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.4\|915856\|27\|NZ_CP009300\|CRT	915856-915882	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	915199-915225	2	0.926
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	915415-915441	2	0.926
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	915460-915486	2	0.926
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.5\|915901\|27\|NZ_CP009300\|CRT	915901-915927	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009300.1	3088472-3088498	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009300.1	3088526-3088552	2	0.926
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	915199-915225	2	0.926
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	915415-915441	2	0.926
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	915460-915486	2	0.926
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	915505-915531	2	0.926
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	915595-915621	2	0.926
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009300.1	3088679-3088705	2	0.926
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP009300.1	915640-915666	2	0.926
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP009300.1	3088418-3088444	2	0.926
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	NZ_CP009300.1	915499-915525	2	0.926
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	NZ_CP009300.1	915499-915525	2	0.926
NZ_CP009300_2	2.6\|916849\|27\|NZ_CP009300\|CRT	916849-916875	27	NZ_CP009300.1	915670-915696	2	0.926
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NZ_CP009300.1	915454-915480	2	0.926
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NZ_CP009300.1	3088577-3088603	2	0.926
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NZ_CP009300.1	3088685-3088711	2	0.926
NZ_CP009300_2	2.10\|917020\|27\|NZ_CP009300\|CRT	917020-917046	27	NZ_CP009300.1	915670-915696	2	0.926
NZ_CP009300_2	2.11\|917065\|27\|NZ_CP009300\|CRT	917065-917091	27	NZ_CP009300.1	915670-915696	2	0.926

1. spacer 1.1|915721|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 0, identity: 1.0

acctgctggtccttgagcaccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
***************************

2. spacer 1.2|915766|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 0, identity: 1.0

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
***************************

3. spacer 1.3|915811|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 0, identity: 1.0

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
***************************

4. spacer 1.12|916216|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 0, identity: 1.0

acctgctggtccttgaataccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
***************************

5. spacer 2.8|916939|27|NZ_CP009300|CRT matches to position: 915634-915660, mismatch: 0, identity: 1.0

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
***************************

6. spacer 1.1|915721|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 1, identity: 0.963

acctgctggtccttgagcaccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
****************.**********

7. spacer 1.1|915721|27|NZ_CP009300|CRT matches to position: 3088418-3088444, mismatch: 1, identity: 0.963

acctgctggtccttgagcaccttgagg	CRISPR spacer
acctgctggcccttgagcaccttgagg	Protospacer
*********.*****************

8. spacer 1.2|915766|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 1, identity: 0.963

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
*****************.*********

9. spacer 1.2|915766|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 1, identity: 0.963

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
****************.**********

10. spacer 1.2|915766|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 1, identity: 0.963

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
******************.********

11. spacer 1.3|915811|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 1, identity: 0.963

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
*****************.*********

12. spacer 1.3|915811|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 1, identity: 0.963

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
****************.**********

13. spacer 1.3|915811|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 1, identity: 0.963

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
******************.********

14. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 1, identity: 0.963

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
*********.*****************

15. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 3088418-3088444, mismatch: 1, identity: 0.963

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggcccttgagcaccttgagg	Protospacer
****************.**********

16. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 1, identity: 0.963

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
*********.*****************

17. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 3088418-3088444, mismatch: 1, identity: 0.963

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggcccttgagcaccttgagg	Protospacer
****************.**********

18. spacer 1.12|916216|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 1, identity: 0.963

acctgctggtccttgaataccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
*****************.*********

19. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 1, identity: 0.963

acccgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
***.***********************

20. spacer 1.17|916432|27|NZ_CP009300|CRT matches to position: 915550-915576, mismatch: 1, identity: 0.963

gcctgctggtccttgaacaccttgagg	CRISPR spacer
gcctgctggtccttgagcaccttgagg	Protospacer
****************.**********

21. spacer 1.18|916477|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 1, identity: 0.963

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
******************.********

22. spacer 1.18|916477|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 1, identity: 0.963

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
****************.**********

23. spacer 2.7|916894|27|NZ_CP009300|CRT matches to position: 915670-915696, mismatch: 1, identity: 0.963

agtagcgcccgtgttaccttgaacacc	CRISPR spacer
agtagcgcccgtgttaccttgagcacc	Protospacer
**********************.****

24. spacer 2.7|916894|27|NZ_CP009300|CRT matches to position: 916606-916632, mismatch: 1, identity: 0.963

agtagcgcccgtgttaccttgaacacc	CRISPR spacer
agtagcgcccgtgttaccttgaatacc	Protospacer
***********************.***

25. spacer 2.8|916939|27|NZ_CP009300|CRT matches to position: 915499-915525, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgagcacc	Protospacer
**********************.****

26. spacer 2.9|916984|18|NZ_CP009300|CRT matches to position: 915679-915696, mismatch: 1, identity: 0.944

cgtgttaccttgagcgcc	CRISPR spacer
cgtgttaccttgagcacc	Protospacer
***************.**

27. spacer 1.1|915721|27|NZ_CP009300|CRT matches to position: 915244-915270, mismatch: 2, identity: 0.926

acctgctggtccttgagcaccttgagg	CRISPR spacer
accagccggtccttgagcaccttgagg	Protospacer
*** **.********************

28. spacer 1.1|915721|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 2, identity: 0.926

acctgctggtccttgagcaccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
****************..*********

29. spacer 1.1|915721|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acctgctggtccttgagcaccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
****************.*.********

30. spacer 1.2|915766|27|NZ_CP009300|CRT matches to position: 3088418-3088444, mismatch: 2, identity: 0.926

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggcccttgagcaccttgagg	Protospacer
*********.******.**********

31. spacer 1.2|915766|27|NZ_CP009300|CRT matches to position: 3088679-3088705, mismatch: 2, identity: 0.926

acctgctggtccttgaacaccttgagg	CRISPR spacer
accagcaggtccttgaacaccttgagg	Protospacer
*** ** ********************

32. spacer 1.3|915811|27|NZ_CP009300|CRT matches to position: 3088418-3088444, mismatch: 2, identity: 0.926

acctgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggcccttgagcaccttgagg	Protospacer
*********.******.**********

33. spacer 1.3|915811|27|NZ_CP009300|CRT matches to position: 3088679-3088705, mismatch: 2, identity: 0.926

acctgctggtccttgaacaccttgagg	CRISPR spacer
accagcaggtccttgaacaccttgagg	Protospacer
*** ** ********************

34. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 915199-915225, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acccgttggcccttgaacaccttgagg	Protospacer
***.*.*********************

35. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 915415-915441, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acccgttggcccttgaacaccttgagg	Protospacer
***.*.*********************

36. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
*********.*******.*********

37. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
*********.******.**********

38. spacer 1.4|915856|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
*********.********.********

39. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 915199-915225, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acccgttggcccttgaacaccttgagg	Protospacer
***.*.*********************

40. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 915415-915441, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acccgttggcccttgaacaccttgagg	Protospacer
***.*.*********************

41. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
*********.*******.*********

42. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
*********.******.**********

43. spacer 1.5|915901|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acctgctggcccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
*********.********.********

44. spacer 1.6|915946|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acccgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
***.**************.********

45. spacer 1.6|915946|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acccgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
***.************.**********

46. spacer 1.8|916036|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acccgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
***.**************.********

47. spacer 1.8|916036|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acccgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
***.************.**********

48. spacer 1.10|916126|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acccgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
***.**************.********

49. spacer 1.10|916126|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acccgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
***.************.**********

50. spacer 1.12|916216|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
****************..*********

51. spacer 1.12|916216|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
*****************..********

52. spacer 1.12|916216|27|NZ_CP009300|CRT matches to position: 3088472-3088498, mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
accagcaggtccttgaataccttgagg	Protospacer
*** ** ********************

53. spacer 1.12|916216|27|NZ_CP009300|CRT matches to position: 3088526-3088552, mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
accagcaggtccttgaataccttgagg	Protospacer
*** ** ********************

54. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 915199-915225, mismatch: 2, identity: 0.926

acccgctggtccttgaacaccttgagg	CRISPR spacer
acccgttggcccttgaacaccttgagg	Protospacer
*****.***.*****************

55. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 915415-915441, mismatch: 2, identity: 0.926

acccgctggtccttgaacaccttgagg	CRISPR spacer
acccgttggcccttgaacaccttgagg	Protospacer
*****.***.*****************

56. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 915460-915486, mismatch: 2, identity: 0.926

acccgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaataccttgagg	Protospacer
***.*************.*********

57. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 915505-915531, mismatch: 2, identity: 0.926

acccgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgagcaccttgagg	Protospacer
***.************.**********

58. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 915595-915621, mismatch: 2, identity: 0.926

acccgctggtccttgaacaccttgagg	CRISPR spacer
acctgctggtccttgaacgccttgagg	Protospacer
***.**************.********

59. spacer 1.13|916261|27|NZ_CP009300|CRT matches to position: 3088679-3088705, mismatch: 2, identity: 0.926

acccgctggtccttgaacaccttgagg	CRISPR spacer
accagcaggtccttgaacaccttgagg	Protospacer
*** ** ********************

60. spacer 1.18|916477|27|NZ_CP009300|CRT matches to position: 915640-915666, mismatch: 2, identity: 0.926

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgaacaccttgagg	Protospacer
****************.*.********

61. spacer 1.18|916477|27|NZ_CP009300|CRT matches to position: 3088418-3088444, mismatch: 2, identity: 0.926

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggcccttgagcaccttgagg	Protospacer
*********.********.********

62. spacer 2.2|916687|27|NZ_CP009300|CRT matches to position: 915499-915525, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agtagcacctgctggtccttgagcacc	Protospacer
*********.**************.**

63. spacer 2.4|916768|27|NZ_CP009300|CRT matches to position: 915499-915525, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agtagcacctgctggtccttgagcacc	Protospacer
*********.**************.**

64. spacer 2.6|916849|27|NZ_CP009300|CRT matches to position: 915670-915696, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgagcacc	CRISPR spacer
agtagcgcccgtgttaccttgagcacc	Protospacer
******.**.*****************

65. spacer 2.8|916939|27|NZ_CP009300|CRT matches to position: 915454-915480, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtggcacctgctggtccttgaatacc	Protospacer
***.*******************.***

66. spacer 2.8|916939|27|NZ_CP009300|CRT matches to position: 3088577-3088603, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcaccagcaggtccttgaacacc	Protospacer
********* ** **************

67. spacer 2.8|916939|27|NZ_CP009300|CRT matches to position: 3088685-3088711, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcaccagcaggtccttgaacacc	Protospacer
********* ** **************

68. spacer 2.10|917020|27|NZ_CP009300|CRT matches to position: 915670-915696, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgagcacc	CRISPR spacer
agtagcgcccgtgttaccttgagcacc	Protospacer
******.**.*****************

69. spacer 2.11|917065|27|NZ_CP009300|CRT matches to position: 915670-915696, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgagcacc	CRISPR spacer
agtagcgcccgtgttaccttgagcacc	Protospacer
******.**.*****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MH937499	Streptococcus phage CHPC1062, complete genome	17289-17315	2	0.926
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MH937499	Streptococcus phage CHPC1062, complete genome	17289-17315	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3055-3081	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2912-2938	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	413-439	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	196-222	2	0.926
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_024210	Escherichia phage e4/1c, complete genome	7548-7574	2	0.926
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98392-98418	2	0.926
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2912-2938	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3055-3081	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	413-439	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	196-222	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32203-32229	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1607-1633	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21480-21506	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33329-33355	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33174-33200	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98392-98418	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32439-32465	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35191-35217	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32439-32465	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	AF246223	Mycoplasma virus P1, complete genome	8389-8415	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32523-32549	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32441-32467	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48936-48962	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	18998-19024	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32828-32854	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41360-41386	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22386-22412	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22372-22398	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21386-21412	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22697-22723	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58074-58100	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32912-32938	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9062-9088	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33330-33356	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21779-21805	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59501-59527	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20463-20489	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50198-50224	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21612-21638	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32829-32855	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_024210	Escherichia phage e4/1c, complete genome	7548-7574	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43890-43916	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_002515	Mycoplasma phage P1, complete genome	8389-8415	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22716-22742	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21791-21817	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21155-21181	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33224-33250	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32517-32543	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22357-22383	3	0.889
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2489-2515	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2912-2938	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3055-3081	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	413-439	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	196-222	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32203-32229	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1607-1633	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21480-21506	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33329-33355	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33174-33200	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98392-98418	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32439-32465	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35191-35217	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32439-32465	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	AF246223	Mycoplasma virus P1, complete genome	8389-8415	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32523-32549	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32441-32467	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48936-48962	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	18998-19024	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32828-32854	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41360-41386	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22386-22412	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22372-22398	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21386-21412	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22697-22723	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58074-58100	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32912-32938	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9062-9088	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33330-33356	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21779-21805	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59501-59527	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20463-20489	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50198-50224	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21612-21638	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32829-32855	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_024210	Escherichia phage e4/1c, complete genome	7548-7574	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43890-43916	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_002515	Mycoplasma phage P1, complete genome	8389-8415	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22716-22742	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21791-21817	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21155-21181	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33224-33250	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32517-32543	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22357-22383	3	0.889
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2489-2515	3	0.889
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98392-98418	3	0.889
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	57793-57819	3	0.889
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	109984-110010	3	0.889
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	110124-110150	3	0.889
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3055-3081	3	0.889
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2912-2938	3	0.889
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	413-439	3	0.889
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	196-222	3	0.889
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_024210	Escherichia phage e4/1c, complete genome	7548-7574	3	0.889
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MH937499	Streptococcus phage CHPC1062, complete genome	17289-17315	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2912-2938	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3055-3081	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	413-439	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	196-222	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32203-32229	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1607-1633	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21480-21506	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33329-33355	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33174-33200	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32439-32465	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35191-35217	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32439-32465	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	AF246223	Mycoplasma virus P1, complete genome	8389-8415	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32523-32549	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32441-32467	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48936-48962	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	18998-19024	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32828-32854	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41360-41386	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22386-22412	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22372-22398	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21386-21412	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MH937499	Streptococcus phage CHPC1062, complete genome	17289-17315	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22697-22723	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58074-58100	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32912-32938	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9062-9088	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33330-33356	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21779-21805	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59501-59527	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20463-20489	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50198-50224	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21612-21638	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32829-32855	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_024210	Escherichia phage e4/1c, complete genome	7548-7574	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32529-32555	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43890-43916	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_002515	Mycoplasma phage P1, complete genome	8389-8415	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22716-22742	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21791-21817	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32530-32556	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21155-21181	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33224-33250	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32440-32466	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32517-32543	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22357-22383	3	0.889
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2489-2515	3	0.889
NZ_CP009300_2	2.6\|916849\|27\|NZ_CP009300\|CRT	916849-916875	27	JQ691611	Cronobacter phage CR9, complete genome	9700-9726	3	0.889
NZ_CP009300_2	2.10\|917020\|27\|NZ_CP009300\|CRT	917020-917046	27	JQ691611	Cronobacter phage CR9, complete genome	9700-9726	3	0.889
NZ_CP009300_2	2.11\|917065\|27\|NZ_CP009300\|CRT	917065-917091	27	JQ691611	Cronobacter phage CR9, complete genome	9700-9726	3	0.889
NZ_CP009300_1	1.7\|915991\|27\|NZ_CP009300\|CRT	915991-916017	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239867-239893	4	0.852
NZ_CP009300_1	1.11\|916171\|27\|NZ_CP009300\|CRT	916171-916197	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239867-239893	4	0.852
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	JN882284	Cronobacter phage vB_CsaM_GAP31, complete genome	100843-100869	4	0.852
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	AF246223	Mycoplasma virus P1, complete genome	8389-8415	4	0.852
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_002515	Mycoplasma phage P1, complete genome	8389-8415	4	0.852
NZ_CP009300_1	1.14\|916306\|27\|NZ_CP009300\|CRT	916306-916332	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239867-239893	4	0.852
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_AP018668	Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence	5902-5928	4	0.852
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP022605	Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence	947182-947208	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963443-963469	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963443-963469	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009300_2	2.6\|916849\|27\|NZ_CP009300\|CRT	916849-916875	27	NC_003390	Synechococcus phage P60, complete genome	39238-39264	4	0.852
NZ_CP009300_2	2.6\|916849\|27\|NZ_CP009300\|CRT	916849-916875	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81957-81983	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	4	0.852
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009300_2	2.10\|917020\|27\|NZ_CP009300\|CRT	917020-917046	27	NC_003390	Synechococcus phage P60, complete genome	39238-39264	4	0.852
NZ_CP009300_2	2.10\|917020\|27\|NZ_CP009300\|CRT	917020-917046	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81957-81983	4	0.852
NZ_CP009300_2	2.11\|917065\|27\|NZ_CP009300\|CRT	917065-917091	27	NC_003390	Synechococcus phage P60, complete genome	39238-39264	4	0.852
NZ_CP009300_2	2.11\|917065\|27\|NZ_CP009300\|CRT	917065-917091	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81957-81983	4	0.852
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	MG298964	Streptomyces phage Alsaber, complete genome	22209-22235	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP046165	Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence	75593-75619	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP046068	Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence	4937-4963	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP045358	Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence	58022-58048	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_LT222316	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4	34324-34350	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	425189-425215	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_LT963398	Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence	44840-44866	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP026563	Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence	37190-37216	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	MN629346	Aeromonas caviae strain 1507-17068 plasmid p717068-IMP, complete sequence	36267-36293	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_LT222313	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence	672-698	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	244920-244946	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	197624-197650	5	0.815
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	48762-48788	5	0.815
NZ_CP009300_1	1.7\|915991\|27\|NZ_CP009300\|CRT	915991-916017	27	MN694528	Marine virus AFVG_250M165, complete genome	1650-1676	5	0.815
NZ_CP009300_1	1.7\|915991\|27\|NZ_CP009300\|CRT	915991-916017	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243812-243838	5	0.815
NZ_CP009300_1	1.7\|915991\|27\|NZ_CP009300\|CRT	915991-916017	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80557-80583	5	0.815
NZ_CP009300_1	1.7\|915991\|27\|NZ_CP009300\|CRT	915991-916017	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54267-54293	5	0.815
NZ_CP009300_1	1.7\|915991\|27\|NZ_CP009300\|CRT	915991-916017	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134762-134788	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP046165	Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence	75593-75619	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP046068	Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence	4937-4963	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP045358	Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence	58022-58048	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_LT222316	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4	34324-34350	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	425189-425215	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_LT963398	Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence	44840-44866	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP026563	Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence	37190-37216	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	MN629346	Aeromonas caviae strain 1507-17068 plasmid p717068-IMP, complete sequence	36267-36293	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_LT222313	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence	672-698	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	244920-244946	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	197624-197650	5	0.815
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	48762-48788	5	0.815
NZ_CP009300_1	1.9\|916081\|27\|NZ_CP009300\|CRT	916081-916107	27	AP014693	Ralstonia phage RSL2 DNA, complete sequence	152486-152512	5	0.815
NZ_CP009300_1	1.9\|916081\|27\|NZ_CP009300\|CRT	916081-916107	27	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	709687-709713	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP046165	Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence	75593-75619	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP046068	Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence	4937-4963	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP045358	Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence	58022-58048	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_LT222316	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4	34324-34350	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	425189-425215	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_LT963398	Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence	44840-44866	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP026563	Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence	37190-37216	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	MN629346	Aeromonas caviae strain 1507-17068 plasmid p717068-IMP, complete sequence	36267-36293	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_LT222313	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence	672-698	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	244920-244946	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	197624-197650	5	0.815
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	48762-48788	5	0.815
NZ_CP009300_1	1.11\|916171\|27\|NZ_CP009300\|CRT	916171-916197	27	MN694528	Marine virus AFVG_250M165, complete genome	1650-1676	5	0.815
NZ_CP009300_1	1.11\|916171\|27\|NZ_CP009300\|CRT	916171-916197	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243812-243838	5	0.815
NZ_CP009300_1	1.11\|916171\|27\|NZ_CP009300\|CRT	916171-916197	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80557-80583	5	0.815
NZ_CP009300_1	1.11\|916171\|27\|NZ_CP009300\|CRT	916171-916197	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54267-54293	5	0.815
NZ_CP009300_1	1.11\|916171\|27\|NZ_CP009300\|CRT	916171-916197	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134762-134788	5	0.815
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3001-3027	5	0.815
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2966-2992	5	0.815
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	467-493	5	0.815
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	250-276	5	0.815
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_049431	Vibrio phage 1.097.O._10N.286.49.B3, partial genome	14058-14084	5	0.815
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	MK448703	Streptococcus phage Javan207, complete genome	37496-37522	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MH171096	Streptomyces phage Eddasa, complete genome	16823-16849	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MF541410	Streptomyces phage Ozzie, complete genome	16640-16666	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MF541407	Streptomyces phage Esperer, complete genome	16660-16686	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MF541403	Streptomyces phage BeardedLady, complete genome	16907-16933	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MN586009	Streptomyces phage Phettuccine, complete genome	16660-16686	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MN096381	Streptomyces phage Rusticus, complete genome	16823-16849	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MF541404	Streptomyces phage BryanRecycles, complete genome	16823-16849	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MN096375	Streptomyces phage Leviticus, complete genome	16660-16686	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MK433270	Streptomyces phage Bovely, complete genome	16666-16692	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_028892	Streptomyces phage Caliburn, complete genome	16640-16666	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_028976	Streptomyces phage Izzy, complete genome	16870-16896	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MF541408	Streptomyces phage Jash, complete genome	16823-16849	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MK433271	Streptomyces phage Indigo, complete genome	16660-16686	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MF541409	Streptomyces phage Oliynyk, complete genome	16823-16849	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	NC_042051	Streptomyces phage Aaronocolus, complete genome	16660-16686	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	MK433278	Streptomyces phage Nerdos, complete genome	16660-16686	5	0.815
NZ_CP009300_1	1.13\|916261\|27\|NZ_CP009300\|CRT	916261-916287	27	KT124229	Streptomyces phage Hydra, complete genome	17188-17214	5	0.815
NZ_CP009300_1	1.14\|916306\|27\|NZ_CP009300\|CRT	916306-916332	27	MN694528	Marine virus AFVG_250M165, complete genome	1650-1676	5	0.815
NZ_CP009300_1	1.14\|916306\|27\|NZ_CP009300\|CRT	916306-916332	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80557-80583	5	0.815
NZ_CP009300_1	1.14\|916306\|27\|NZ_CP009300\|CRT	916306-916332	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54267-54293	5	0.815
NZ_CP009300_1	1.14\|916306\|27\|NZ_CP009300\|CRT	916306-916332	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243812-243838	5	0.815
NZ_CP009300_1	1.14\|916306\|27\|NZ_CP009300\|CRT	916306-916332	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134762-134788	5	0.815
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	244920-244946	5	0.815
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP014581	Burkholderia sp. OLGA172 plasmid pOLGA2, complete sequence	129526-129552	5	0.815
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	48762-48788	5	0.815
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	KU761558	Mycobacterium phage Loser, complete genome	4956-4982	5	0.815
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009300_2	2.8\|916939\|27\|NZ_CP009300\|CRT	916939-916965	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	572907-572933	5	0.815
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239028-239054	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241609-241635	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313111-313137	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313827-313853	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324633-324659	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346414-346440	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268115-268141	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305390-305416	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305293-305319	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326167-326193	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331201-331227	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293862-293888	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301465-301491	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313361-313387	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238043-238069	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324346-324372	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305312-305338	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293862-293888	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306590-306616	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308077-308103	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326167-326193	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302181-302207	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310640-310666	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305296-305322	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311840-311866	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305312-305338	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366763-366789	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300747-300773	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305298-305324	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309874-309900	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	MT104465	Pseudomonas phage MR1, complete genome	14854-14880	6	0.778
NZ_CP009300_1	1.1\|915721\|27\|NZ_CP009300\|CRT	915721-915747	27	MN204498	Streptomyces phage Saftant, complete genome	22421-22447	6	0.778
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2966-2992	6	0.778
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3001-3027	6	0.778
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	467-493	6	0.778
NZ_CP009300_1	1.2\|915766\|27\|NZ_CP009300\|CRT	915766-915792	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	250-276	6	0.778
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2966-2992	6	0.778
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3001-3027	6	0.778
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	467-493	6	0.778
NZ_CP009300_1	1.3\|915811\|27\|NZ_CP009300\|CRT	915811-915837	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	250-276	6	0.778
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NC_019408	Caulobacter phage CcrRogue, complete genome	170282-170308	6	0.778
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	MH588544	Caulobacter phage CcrBL10, complete genome	169125-169151	6	0.778
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NC_019408	Caulobacter phage CcrRogue, complete genome	170282-170308	6	0.778
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	MH588544	Caulobacter phage CcrBL10, complete genome	169125-169151	6	0.778
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NC_019408	Caulobacter phage CcrRogue, complete genome	170282-170308	6	0.778
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	MH588544	Caulobacter phage CcrBL10, complete genome	169125-169151	6	0.778
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3109-3135	6	0.778
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2858-2884	6	0.778
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	359-385	6	0.778
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	142-168	6	0.778
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2966-2992	6	0.778
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3001-3027	6	0.778
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	467-493	6	0.778
NZ_CP009300_1	1.17\|916432\|27\|NZ_CP009300\|CRT	916432-916458	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	250-276	6	0.778
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380847-380873	6	0.778
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	MH622939	Siphoviridae sp. isolate ctbf_3, complete genome	34256-34282	6	0.778
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	NC_019408	Caulobacter phage CcrRogue, complete genome	170282-170308	6	0.778
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	MH588544	Caulobacter phage CcrBL10, complete genome	169125-169151	6	0.778
NZ_CP009300_1	1.18\|916477\|27\|NZ_CP009300\|CRT	916477-916503	27	KU761559	Mycobacterium phage ArcherNM, complete genome	4962-4988	6	0.778
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	197630-197656	6	0.778
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	197630-197656	6	0.778
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	MT774376	CrAssphage cr55_1, complete genome	95782-95808	7	0.741
NZ_CP009300_1	1.12\|916216\|27\|NZ_CP009300\|CRT	916216-916242	27	MT774380	CrAssphage cr1_1, complete genome	88-114	7	0.741
NZ_CP009300_1	1.6\|915946\|27\|NZ_CP009300\|CRT	915946-915972	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	322708-322734	8	0.704
NZ_CP009300_1	1.8\|916036\|27\|NZ_CP009300\|CRT	916036-916062	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	322708-322734	8	0.704
NZ_CP009300_1	1.10\|916126\|27\|NZ_CP009300\|CRT	916126-916152	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	322708-322734	8	0.704
NZ_CP009300_2	2.2\|916687\|27\|NZ_CP009300\|CRT	916687-916713	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	322714-322740	8	0.704
NZ_CP009300_2	2.4\|916768\|27\|NZ_CP009300\|CRT	916768-916794	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	322714-322740	8	0.704

1. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaacaccttgagg	CRISPR spacer
accttgtggtccttgaacaccttgagg	Protospacer
****  *********************

2. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaacaccttgagg	CRISPR spacer
accttgtggtccttgaacaccttgagg	Protospacer
****  *********************

3. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** ***********************

4. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** ***********************

5. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** ***********************

6. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** ***********************

7. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 2, identity: 0.926

acctgctggtccttgaataccttgagg	CRISPR spacer
tccggctggtccttgaataccttgagg	Protospacer
 ** ***********************

8. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 2, identity: 0.926

gcctgctggtccttgaacaccttgagg	CRISPR spacer
gcctgctggtccttgaagtccttgagg	Protospacer
*****************  ********

9. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

10. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

11. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

12. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

13. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

14. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

15. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

16. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

17. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

18. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

19. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

20. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

21. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
gcctgctggtccttgaagtccttgagg	Protospacer
.****************  ********

22. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

23. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

24. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

25. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

26. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

27. spacer 1.2|915766|27|NZ_CP009300|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 *** .*********************

28. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

29. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

30. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

31. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

32. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

33. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

34. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

35. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

36. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

37. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

38. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

39. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

40. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

41. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

42. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

43. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

44. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

45. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

46. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

47. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

48. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

49. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

50. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

51. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

52. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

53. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

54. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

55. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

56. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

57. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

58. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

59. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

60. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

61. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

62. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

63. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

64. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

65. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

66. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccggctggtccttgaataccttgagg	Protospacer
 ** *************.*********

67. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

68. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

69. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 *** .*********************

70. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

71. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

72. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

73. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

74. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

75. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

76. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

77. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

78. spacer 1.2|915766|27|NZ_CP009300|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

79. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

80. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

81. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

82. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

83. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

84. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

85. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

86. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

87. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

88. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

89. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

90. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

91. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
gcctgctggtccttgaagtccttgagg	Protospacer
.****************  ********

92. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

93. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

94. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

95. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

96. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

97. spacer 1.3|915811|27|NZ_CP009300|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 *** .*********************

98. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

99. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

100. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

101. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

102. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

103. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

104. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

105. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

106. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

107. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

108. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

109. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

110. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

111. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

112. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

113. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

114. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

115. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

116. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

117. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

118. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

119. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

120. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

121. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

122. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

123. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

124. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

125. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

126. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

127. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

128. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

129. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

130. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

131. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

132. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

133. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

134. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

135. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

136. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tccggctggtccttgaataccttgagg	Protospacer
 ** *************.*********

137. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

138. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

139. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 *** .*********************

140. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

141. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

142. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

143. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

144. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

145. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

146. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

147. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

148. spacer 1.3|915811|27|NZ_CP009300|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

149. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaataccttgagg	CRISPR spacer
gcctgctggtccttgaagtccttgagg	Protospacer
.****************  ********

150. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaataccttgagg	CRISPR spacer
gccttctggtccttgaataccttgtgg	Protospacer
.*** ******************* **

151. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaataccttgagg	CRISPR spacer
ccctacaggtccttgaataccttgagg	Protospacer
 ***.* ********************

152. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 3, identity: 0.889

acctgctggtccttgaataccttgagg	CRISPR spacer
ccctacaggtccttgaataccttgagg	Protospacer
 ***.* ********************

153. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 3, identity: 0.889

acccgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

154. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 3, identity: 0.889

acccgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

155. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 3, identity: 0.889

acccgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

156. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 3, identity: 0.889

acccgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

157. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 3, identity: 0.889

acccgctggtccttgaacaccttgagg	CRISPR spacer
tccggctggtccttgaataccttgagg	Protospacer
 ** *************.*********

158. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 3, identity: 0.889

acccgctggtccttgaacaccttgagg	CRISPR spacer
accttgtggtccttgaacaccttgagg	Protospacer
***.  *********************

159. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

160. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

161. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

162. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tccagctggtccttgaataccttgagg	Protospacer
 ** *************.*********

163. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

164. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

165. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

166. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

167. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

168. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

169. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

170. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

171. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

172. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

173. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

174. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

175. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

176. spacer 1.17|916432|27|NZ_CP009300|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 *** .*********************

177. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

178. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

179. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

180. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

181. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

182. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

183. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

184. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

185. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

186. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

187. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

188. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

189. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

190. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

191. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

192. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

193. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

194. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

195. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

196. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

197. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
accttgtggtccttgaacaccttgagg	Protospacer
.***  *********************

198. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

199. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

200. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

201. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

202. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

203. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

204. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

205. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

206. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

207. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

208. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

209. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

210. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

211. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

212. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

213. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

214. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

215. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

216. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tccggctggtccttgaataccttgagg	Protospacer
 ** *************.*********

217. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

218. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

219. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 *** .*********************

220. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

221. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

222. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

223. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

224. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

225. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

226. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

227. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

228. spacer 1.17|916432|27|NZ_CP009300|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 3, identity: 0.889

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgctggtccttcaactccttgagg	Protospacer
 ************* *** ********

229. spacer 2.6|916849|27|NZ_CP009300|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

agtagcacctgtgttaccttgagcacc	CRISPR spacer
ggtaggacctgtgttaccttgaggacc	Protospacer
.**** ***************** ***

230. spacer 2.10|917020|27|NZ_CP009300|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

agtagcacctgtgttaccttgagcacc	CRISPR spacer
ggtaggacctgtgttaccttgaggacc	Protospacer
.**** ***************** ***

231. spacer 2.11|917065|27|NZ_CP009300|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

agtagcacctgtgttaccttgagcacc	CRISPR spacer
ggtaggacctgtgttaccttgaggacc	Protospacer
.**** ***************** ***

232. spacer 1.7|915991|27|NZ_CP009300|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acccgtgttaccttgaacgccttgagg	CRISPR spacer
accgcggttaccttgaacgccttgaag	Protospacer
***   *******************.*

233. spacer 1.11|916171|27|NZ_CP009300|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acccgtgttaccttgaacgccttgagg	CRISPR spacer
accgcggttaccttgaacgccttgaag	Protospacer
***   *******************.*

234. spacer 1.12|916216|27|NZ_CP009300|CRT matches to JN882284 (Cronobacter phage vB_CsaM_GAP31, complete genome) position: , mismatch: 4, identity: 0.852

acctgctggtccttgaataccttgagg	CRISPR spacer
accgattggtccctgaataccttgagg	Protospacer
*** ..******.**************

235. spacer 1.13|916261|27|NZ_CP009300|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 4, identity: 0.852

acccgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 **. .*********************

236. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 4, identity: 0.852

acccgctggtccttgaacaccttgagg	CRISPR spacer
cccttttggtccttgaacaccttgagg	Protospacer
 **. .*********************

237. spacer 1.14|916306|27|NZ_CP009300|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acctgtgttaccttgaacgccttgagg	CRISPR spacer
accgcggttaccttgaacgccttgaag	Protospacer
***   *******************.*

238. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NZ_AP018668 (Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence) position: , mismatch: 4, identity: 0.852

acctgctggtccttgagcgccttgagg	CRISPR spacer
agctgctggaccttgcgcgccttgagc	Protospacer
* ******* ***** **********

239. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NZ_CP022605 (Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctactggtccttgagggccttccgg	Protospacer
****.************ *****  **

240. spacer 2.2|916687|27|NZ_CP009300|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agctgcaccggcaggtccttgagcgcc	Protospacer
**. ***** ** **************

241. spacer 2.2|916687|27|NZ_CP009300|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

242. spacer 2.2|916687|27|NZ_CP009300|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

243. spacer 2.2|916687|27|NZ_CP009300|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

244. spacer 2.2|916687|27|NZ_CP009300|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

245. spacer 2.2|916687|27|NZ_CP009300|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

246. spacer 2.2|916687|27|NZ_CP009300|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

247. spacer 2.4|916768|27|NZ_CP009300|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agctgcaccggcaggtccttgagcgcc	Protospacer
**. ***** ** **************

248. spacer 2.4|916768|27|NZ_CP009300|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

249. spacer 2.4|916768|27|NZ_CP009300|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

250. spacer 2.4|916768|27|NZ_CP009300|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

251. spacer 2.4|916768|27|NZ_CP009300|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

252. spacer 2.4|916768|27|NZ_CP009300|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

253. spacer 2.4|916768|27|NZ_CP009300|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgagcgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *****.*************  **

254. spacer 2.6|916849|27|NZ_CP009300|CRT matches to NC_003390 (Synechococcus phage P60, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgagcacc	CRISPR spacer
atcagcacctgggttaccttgaggacc	Protospacer
* .******** *********** ***

255. spacer 2.6|916849|27|NZ_CP009300|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgagcacc	CRISPR spacer
agtagcaccagtgttaccctgagggcc	Protospacer
********* ********.**** .**

256. spacer 2.8|916939|27|NZ_CP009300|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

257. spacer 2.8|916939|27|NZ_CP009300|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

258. spacer 2.8|916939|27|NZ_CP009300|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

259. spacer 2.8|916939|27|NZ_CP009300|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

260. spacer 2.8|916939|27|NZ_CP009300|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

261. spacer 2.8|916939|27|NZ_CP009300|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
* .****** ************** **

262. spacer 2.8|916939|27|NZ_CP009300|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

263. spacer 2.10|917020|27|NZ_CP009300|CRT matches to NC_003390 (Synechococcus phage P60, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgagcacc	CRISPR spacer
atcagcacctgggttaccttgaggacc	Protospacer
* .******** *********** ***

264. spacer 2.10|917020|27|NZ_CP009300|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgagcacc	CRISPR spacer
agtagcaccagtgttaccctgagggcc	Protospacer
********* ********.**** .**

265. spacer 2.11|917065|27|NZ_CP009300|CRT matches to NC_003390 (Synechococcus phage P60, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgagcacc	CRISPR spacer
atcagcacctgggttaccttgaggacc	Protospacer
* .******** *********** ***

266. spacer 2.11|917065|27|NZ_CP009300|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgagcacc	CRISPR spacer
agtagcaccagtgttaccctgagggcc	Protospacer
********* ********.**** .**

267. spacer 1.1|915721|27|NZ_CP009300|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 5, identity: 0.815

acctgctggtccttgagcaccttgagg	CRISPR spacer
gcctgctggtcctggagcaccgtgatc	Protospacer
.************ ******* ***

268. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP046165 (Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

269. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP046068 (Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

270. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP045358 (Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

271. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_LT222316 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

272. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
tcccgctgggcctcgagcgccttgcgc	Protospacer
 ******** ***.********** *

273. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_LT963398 (Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

274. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP026563 (Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

275. spacer 1.6|915946|27|NZ_CP009300|CRT matches to MN629346 (Aeromonas caviae strain 1507-17068 plasmid p717068-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
attcgctggtgcttgagcgccatgagc	Protospacer
*..******* ********** ****

276. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_LT222313 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

277. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
cgcagctgctccttgatcgccttgagg	Protospacer
  * **** ******* **********

278. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
aaccgctggttcttgagcgctttgaaa	Protospacer
* ********.*********.****..

279. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
tcgggctggtgcttgagcgccttgaag	Protospacer
 *  ****** **************.*

280. spacer 1.7|915991|27|NZ_CP009300|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
accagtattaccttgaacgccttggtc	Protospacer
*** **.*****************.

281. spacer 1.7|915991|27|NZ_CP009300|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

282. spacer 1.7|915991|27|NZ_CP009300|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

283. spacer 1.7|915991|27|NZ_CP009300|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

284. spacer 1.7|915991|27|NZ_CP009300|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

285. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP046165 (Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

286. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP046068 (Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

287. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP045358 (Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

288. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_LT222316 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

289. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
tcccgctgggcctcgagcgccttgcgc	Protospacer
 ******** ***.********** *

290. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_LT963398 (Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

291. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP026563 (Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

292. spacer 1.8|916036|27|NZ_CP009300|CRT matches to MN629346 (Aeromonas caviae strain 1507-17068 plasmid p717068-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
attcgctggtgcttgagcgccatgagc	Protospacer
*..******* ********** ****

293. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_LT222313 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

294. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
cgcagctgctccttgatcgccttgagg	Protospacer
  * **** ******* **********

295. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
aaccgctggttcttgagcgctttgaaa	Protospacer
* ********.*********.****..

296. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
tcgggctggtgcttgagcgccttgaag	Protospacer
 *  ****** **************.*

297. spacer 1.9|916081|27|NZ_CP009300|CRT matches to AP014693 (Ralstonia phage RSL2 DNA, complete sequence) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacaccttgagg	CRISPR spacer
gccagtgttaccttggacaccttgaat	Protospacer
.** ***********.*********.

298. spacer 1.9|916081|27|NZ_CP009300|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacaccttgagg	CRISPR spacer
gcctgggtttccttgaacaccttgtcg	Protospacer
.**** *** **************  *

299. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP046165 (Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

300. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP046068 (Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

301. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP045358 (Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
actcgctggttcttgagcgccttggct	Protospacer
**.*******.*************.

302. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_LT222316 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

303. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
tcccgctgggcctcgagcgccttgcgc	Protospacer
 ******** ***.********** *

304. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_LT963398 (Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

305. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP026563 (Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

306. spacer 1.10|916126|27|NZ_CP009300|CRT matches to MN629346 (Aeromonas caviae strain 1507-17068 plasmid p717068-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
attcgctggtgcttgagcgccatgagc	Protospacer
*..******* ********** ****

307. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_LT222313 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
atgcgctggtccttgaccgctttgagc	Protospacer
*. ************* ***.*****

308. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
cgcagctgctccttgatcgccttgagg	Protospacer
  * **** ******* **********

309. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
aaccgctggttcttgagcgctttgaaa	Protospacer
* ********.*********.****..

310. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 5, identity: 0.815

acccgctggtccttgagcgccttgagg	CRISPR spacer
tcgggctggtgcttgagcgccttgaag	Protospacer
 *  ****** **************.*

311. spacer 1.11|916171|27|NZ_CP009300|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
accagtattaccttgaacgccttggtc	Protospacer
*** **.*****************.

312. spacer 1.11|916171|27|NZ_CP009300|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

313. spacer 1.11|916171|27|NZ_CP009300|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

314. spacer 1.11|916171|27|NZ_CP009300|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

315. spacer 1.11|916171|27|NZ_CP009300|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 5, identity: 0.815

acccgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

316. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.******************.

317. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.******************.

318. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.******************.

319. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.******************.

320. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_049431 (Vibrio phage 1.097.O._10N.286.49.B3, partial genome) position: , mismatch: 5, identity: 0.815

acctgctggtccttgaataccttgagg	CRISPR spacer
gcctgttggaccttgaataccttgatc	Protospacer
.****.*** ***************

321. spacer 1.12|916216|27|NZ_CP009300|CRT matches to MK448703 (Streptococcus phage Javan207, complete genome) position: , mismatch: 5, identity: 0.815

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctttaggtccttgaataccttgagc	Protospacer
 *** . *******************

322. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MH171096 (Streptomyces phage Eddasa, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

323. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MF541410 (Streptomyces phage Ozzie, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

324. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MF541407 (Streptomyces phage Esperer, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

325. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MF541403 (Streptomyces phage BeardedLady, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

326. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MN586009 (Streptomyces phage Phettuccine, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

327. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MN096381 (Streptomyces phage Rusticus, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

328. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MF541404 (Streptomyces phage BryanRecycles, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

329. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MN096375 (Streptomyces phage Leviticus, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

330. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MK433270 (Streptomyces phage Bovely, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

331. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_028892 (Streptomyces phage Caliburn, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

332. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_028976 (Streptomyces phage Izzy, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

333. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MF541408 (Streptomyces phage Jash, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

334. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MK433271 (Streptomyces phage Indigo, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

335. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MF541409 (Streptomyces phage Oliynyk, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

336. spacer 1.13|916261|27|NZ_CP009300|CRT matches to NC_042051 (Streptomyces phage Aaronocolus, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

337. spacer 1.13|916261|27|NZ_CP009300|CRT matches to MK433278 (Streptomyces phage Nerdos, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

338. spacer 1.13|916261|27|NZ_CP009300|CRT matches to KT124229 (Streptomyces phage Hydra, complete genome) position: , mismatch: 5, identity: 0.815

acccgctggtccttgaacaccttgagg	CRISPR spacer
ttccgctggtccttgaagacctcgatg	Protospacer
 .*************** ****.** *

339. spacer 1.14|916306|27|NZ_CP009300|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacgccttgagg	CRISPR spacer
accagtattaccttgaacgccttggtc	Protospacer
*** **.*****************.

340. spacer 1.14|916306|27|NZ_CP009300|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

341. spacer 1.14|916306|27|NZ_CP009300|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

342. spacer 1.14|916306|27|NZ_CP009300|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

343. spacer 1.14|916306|27|NZ_CP009300|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 5, identity: 0.815

acctgtgttaccttgaacgccttgagg	CRISPR spacer
actgcggttaccttgaacgccttgaag	Protospacer
**.   *******************.*

344. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgagcgccttgagg	CRISPR spacer
cgcagctgctccttgatcgccttgagg	Protospacer
  * **** ******* **********

345. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NZ_CP014581 (Burkholderia sp. OLGA172 plasmid pOLGA2, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgagcgccttgagg	CRISPR spacer
gcctgcaggtcctcgagcgccttgccg	Protospacer
.***** ******.**********  *

346. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 5, identity: 0.815

acctgctggtccttgagcgccttgagg	CRISPR spacer
tcgggctggtgcttgagcgccttgaag	Protospacer
 *  ****** **************.*

347. spacer 1.18|916477|27|NZ_CP009300|CRT matches to KU761558 (Mycobacterium phage Loser, complete genome) position: , mismatch: 5, identity: 0.815

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctgctggtccttgtgcgccggcagc	Protospacer
*************** *****   **

348. spacer 2.2|916687|27|NZ_CP009300|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacccgctggtccttgagcgcc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  *****.** **************

349. spacer 2.4|916768|27|NZ_CP009300|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacccgctggtccttgagcgcc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  *****.** **************

350. spacer 2.8|916939|27|NZ_CP009300|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgaacacc	CRISPR spacer
tggcgcacctgcgggtcctcgaacacc	Protospacer
 *  ******** ******.*******

351. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

352. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

353. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

354. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

355. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

356. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

357. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

358. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

359. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

360. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

361. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

362. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

363. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

364. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

365. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

366. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

367. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

368. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

369. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

370. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

371. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

372. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

373. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

374. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

375. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

376. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

377. spacer 1.1|915721|27|NZ_CP009300|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

378. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

379. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

380. spacer 1.1|915721|27|NZ_CP009300|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ggattgtggtccttgagcaccttgaag	Protospacer
.  *  *******************.*

381. spacer 1.1|915721|27|NZ_CP009300|CRT matches to MT104465 (Pseudomonas phage MR1, complete genome) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
gtgagctggtccgtgagcaccttgaag	Protospacer
..  ******** ************.*

382. spacer 1.1|915721|27|NZ_CP009300|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcaccttgagg	CRISPR spacer
ttctgctggtcctggagcaccgtgatc	Protospacer
 .*********** ******* ***

383. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

384. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

385. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

386. spacer 1.2|915766|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

387. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

388. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

389. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

390. spacer 1.3|915811|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

391. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 6, identity: 0.778

acccgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

392. spacer 1.6|915946|27|NZ_CP009300|CRT matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 6, identity: 0.778

acccgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

393. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 6, identity: 0.778

acccgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

394. spacer 1.8|916036|27|NZ_CP009300|CRT matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 6, identity: 0.778

acccgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

395. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 6, identity: 0.778

acccgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

396. spacer 1.10|916126|27|NZ_CP009300|CRT matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 6, identity: 0.778

acccgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

397. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccctgaataccttggtt	Protospacer
 ** ********.***********.

398. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccctgaataccttggtt	Protospacer
 ** ********.***********.

399. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccctgaataccttggtt	Protospacer
 ** ********.***********.

400. spacer 1.12|916216|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgaataccttgagg	CRISPR spacer
tccagctggtccctgaataccttggtt	Protospacer
 ** ********.***********.

401. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

402. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

403. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

404. spacer 1.17|916432|27|NZ_CP009300|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

gcctgctggtccttgaacaccttgagg	CRISPR spacer
tcctgttggtccttgaataccttggtt	Protospacer
 ****.***********.******.

405. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcgccttgagg	CRISPR spacer
acctgcaggtccttgagcgccatcttt	Protospacer
****** ************** *

406. spacer 1.18|916477|27|NZ_CP009300|CRT matches to MH622939 (Siphoviridae sp. isolate ctbf_3, complete genome) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcgccttgagg	CRISPR spacer
gcctgctcgtccttgagtgccttggca	Protospacer
.****** *********.******. .

407. spacer 1.18|916477|27|NZ_CP009300|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

408. spacer 1.18|916477|27|NZ_CP009300|CRT matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcgccttgagg	CRISPR spacer
tagagcaggtccttgagcgctttgagg	Protospacer
    ** *************.******

409. spacer 1.18|916477|27|NZ_CP009300|CRT matches to KU761559 (Mycobacterium phage ArcherNM, complete genome) position: , mismatch: 6, identity: 0.778

acctgctggtccttgagcgccttgagg	CRISPR spacer
tcctgctggaccttgagcgcctgcggc	Protospacer
 ******** ************  .*

410. spacer 2.2|916687|27|NZ_CP009300|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 6, identity: 0.778

agtagcacccgctggtccttgagcgcc	CRISPR spacer
ttaagcaaccgctggttcttgagcgct	Protospacer
   **** ********.*********.

411. spacer 2.4|916768|27|NZ_CP009300|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 6, identity: 0.778

agtagcacccgctggtccttgagcgcc	CRISPR spacer
ttaagcaaccgctggttcttgagcgct	Protospacer
   **** ********.*********.

412. spacer 1.12|916216|27|NZ_CP009300|CRT matches to MT774376 (CrAssphage cr55_1, complete genome) position: , mismatch: 7, identity: 0.741

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctgctggtccttgaatactaccaac	Protospacer
 *******************. . *.

413. spacer 1.12|916216|27|NZ_CP009300|CRT matches to MT774380 (CrAssphage cr1_1, complete genome) position: , mismatch: 7, identity: 0.741

acctgctggtccttgaataccttgagg	CRISPR spacer
tcctgctggtccttgaatactaccaac	Protospacer
 *******************. . *.

414. spacer 1.6|915946|27|NZ_CP009300|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

acccgctggtccttgagcgccttgagg	CRISPR spacer
ggccgctggtccttgagcgccacttcc	Protospacer
. ******************* .

415. spacer 1.8|916036|27|NZ_CP009300|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

acccgctggtccttgagcgccttgagg	CRISPR spacer
ggccgctggtccttgagcgccacttcc	Protospacer
. ******************* .

416. spacer 1.10|916126|27|NZ_CP009300|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

acccgctggtccttgagcgccttgagg	CRISPR spacer
ggccgctggtccttgagcgccacttcc	Protospacer
. ******************* .

417. spacer 2.2|916687|27|NZ_CP009300|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

agtagcacccgctggtccttgagcgcc	CRISPR spacer
gcctcgggccgctggtccttgagcgcc	Protospacer
. .   . *******************

418. spacer 2.4|916768|27|NZ_CP009300|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

agtagcacccgctggtccttgagcgcc	CRISPR spacer
gcctcgggccgctggtccttgagcgcc	Protospacer
. .   . *******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

641640 : 715680

Bacillus_phage(72.92%)

capsid,tRNA,head,portal,tail,integrase,protease,terminase

attL 645201:645216|attR 656764:656779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512226.1\|641640_642771_-\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	2.1e-65	39.1
WP_042512227.1\|643109_643919_+	hypothetical protein	NA	NA	NA	NA
WP_042512228.1\|643919_644783_+	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_042512229.1\|644871_645216_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	7.2e-17	38.4
645201:645216	attL	NA	NA	NA	NA
WP_042512230.1\|645653_646751_+	hypothetical protein	NA	NA	NA	NA
WP_000153814.1\|647175_647544_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
WP_000516834.1\|647762_647990_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000284333.1\|648041_648242_+	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_042512233.1\|648675_649551_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	5.7e-50	98.1
WP_042512234.1\|649519_650317_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	8.1e-144	98.9
WP_042512235.1\|650338_650533_+	hypothetical protein	A0A1B1P7U7	Bacillus_phage	6.5e-31	98.4
WP_000805174.1\|650558_650732_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_000811866.1\|650746_651001_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	6.5e-39	94.0
WP_042512236.1\|651013_651439_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	3.8e-15	41.6
WP_042512237.1\|651950_652361_+	hypothetical protein	Q2LI92	Bacillus_phage	1.6e-50	68.4
WP_042512238.1\|652589_653309_+	hypothetical protein	D2XR55	Bacillus_phage	9.3e-115	82.4
WP_042512239.1\|653347_653722_+	hypothetical protein	NA	NA	NA	NA
WP_042512240.1\|653838_654210_+	hypothetical protein	NA	NA	NA	NA
WP_042512241.1\|654236_654566_+	hypothetical protein	NA	NA	NA	NA
WP_000803282.1\|654774_654897_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_042512243.1\|655211_655694_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.9e-71	82.5
WP_042512244.1\|655693_656236_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.5e-88	91.1
WP_042512245.1\|656811_657561_+	site-specific DNA-methyltransferase	A0A0H3UZL7	Geobacillus_virus	2.2e-79	58.9
656764:656779	attR	NA	NA	NA	NA
WP_000778977.1\|657709_657922_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	3.5e-30	100.0
WP_000376884.1\|658055_658247_+	hypothetical protein	Q3HKW9	Bacillus_phage	7.3e-19	76.2
WP_042512246.1\|658266_658521_+	hypothetical protein	A0A2H4J3B1	uncultured_Caudovirales_phage	7.4e-43	95.2
WP_042512247.1\|658510_658888_+	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	6.8e-69	98.4
WP_042512248.1\|659026_659527_+\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	8.0e-65	74.7
WP_042512249.1\|659523_661218_+\|terminase	terminase large subunit	A6M948	Geobacillus_virus	8.1e-210	64.2
WP_042512250.1\|661406_662660_+\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	9.8e-237	97.4
WP_001259166.1\|662646_663357_+\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	2.2e-124	95.3
WP_042512251.1\|663394_664567_+\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	3.4e-199	93.3
WP_000244596.1\|664587_664866_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	5.8e-41	94.6
WP_029440521.1\|664862_665186_+\|head	phage head closure protein	H0USW8	Bacillus_phage	7.0e-54	92.5
WP_000763222.1\|665178_665616_+	HK97 gp10 family phage protein	A0A288WGM7	Bacillus_phage	4.6e-77	100.0
WP_042512252.1\|665612_665972_+	DUF3168 domain-containing protein	A0A288WFU0	Bacillus_phage	3.5e-62	100.0
WP_001982989.1\|665972_666581_+\|tail	tail protein	Q2I8F2	Bacillus_phage	1.4e-108	100.0
WP_042512253.1\|666630_666948_+	hypothetical protein	A0A288WFU2	Bacillus_phage	7.5e-53	99.0
WP_000344052.1\|666977_667154_+	hypothetical protein	A0A288WFY6	Bacillus_phage	3.4e-15	100.0
WP_042512254.1\|667168_671020_+\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	98.6
WP_042512255.1\|671034_672525_+\|tail	phage tail protein	Q2LIB8	Bacillus_phage	2.2e-291	98.6
WP_042512256.1\|672521_676451_+	peptidase S74	A0A288WFW2	Bacillus_phage	0.0e+00	83.7
WP_042512257.1\|676572_676797_+	hypothetical protein	A0A1B1P780	Bacillus_phage	1.6e-25	85.1
WP_029440514.1\|676861_677098_+	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	97.4
WP_042512258.1\|677097_677337_+	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	5.0e-33	97.5
WP_042512259.1\|677333_678389_+	N-acetylmuramoyl-L-alanine amidase	A0A288WFQ3	Bacillus_phage	1.6e-192	93.2
WP_042512260.1\|678427_678970_-	hypothetical protein	NA	NA	NA	NA
WP_042512262.1\|679353_680202_+	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	1.0e-19	37.9
WP_042512263.1\|680631_680829_-	helix-turn-helix domain-containing protein	A0A1B1P7S8	Bacillus_phage	3.5e-16	68.8
WP_042512264.1\|680990_681293_+	hypothetical protein	Q2I8E3	Bacillus_phage	2.4e-48	93.0
WP_042512265.1\|681295_681478_+	hypothetical protein	Q2I8E2	Bacillus_phage	2.7e-23	95.0
WP_042512266.1\|681595_682777_+	cell division protein FtsK	A0A288WFS1	Bacillus_phage	4.2e-197	85.0
WP_042512267.1\|682718_683336_+	phage protein	Q2LIA9	Bacillus_phage	2.1e-99	88.1
WP_000872145.1\|683620_684121_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_001984764.1\|684182_684356_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_000246476.1\|684485_684992_+	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	3.0e-11	34.7
WP_000506702.1\|685026_685500_-	N-acetyltransferase	NA	NA	NA	NA
WP_001995047.1\|685874_686762_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_001995077.1\|686841_688458_+	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000481786.1\|688827_689760_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_000067081.1\|689775_690138_+	cell division protein FtsL	NA	NA	NA	NA
WP_000600098.1\|690210_692310_+	penicillin-binding protein	NA	NA	NA	NA
WP_001266229.1\|692391_694308_+	stage V sporulation protein D	NA	NA	NA	NA
WP_001995054.1\|694516_695992_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_000893058.1\|696014_696989_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_042512268.1\|696989_698342_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000753510.1\|698432_699524_+	stage V sporulation protein E	NA	NA	NA	NA
WP_001995057.1\|699629_700724_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_001995034.1\|700785_701691_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_000798225.1\|701789_702560_+	cell division protein DivIB	NA	NA	NA	NA
WP_001087551.1\|702960_704268_+	cell division protein FtsA	NA	NA	NA	NA
WP_042512269.1\|704307_705462_+	cell division protein FtsZ	NA	NA	NA	NA
WP_000261988.1\|705774_706692_+	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000976948.1\|706711_707431_+	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000197753.1\|707588_708368_+	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_000619397.1\|708542_708821_+	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_001209022.1\|708938_709757_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_000218170.1\|709753_710428_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_000119136.1\|710447_710918_+	cell division protein SepF	NA	NA	NA	NA
WP_000450918.1\|710924_711188_+	YggT family protein	NA	NA	NA	NA
WP_000029721.1\|711203_711971_+	RNA-binding protein	NA	NA	NA	NA
WP_001131611.1\|712060_712567_+	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000455931.1\|712914_715680_+\|tRNA	isoleucine--tRNA ligase	A0A2P1ELB8	Moumouvirus	2.7e-85	27.1

DBSCAN-SWA_2

2054853 : 2087340

Bacillus_phage(73.91%)

holin,portal,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512714.1\|2054853_2056317_-	recombinase family protein	Q2XVV3	Bacillus_phage	2.4e-141	54.1
WP_042512715.1\|2056662_2056881_-	hypothetical protein	A0A0U3TKC9	Bacillus_phage	1.1e-07	50.8
WP_042512717.1\|2057120_2057744_-	phage protein	H0USY2	Bacillus_phage	1.9e-92	78.2
WP_042512718.1\|2057685_2058876_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	7.8e-143	64.4
WP_042512719.1\|2058991_2059174_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.5e-21	88.3
WP_042512720.1\|2059170_2059473_-	hypothetical protein	A0A288WG38	Bacillus_phage	5.2e-27	56.1
WP_042512721.1\|2059472_2059739_-	hypothetical protein	NA	NA	NA	NA
WP_042512722.1\|2059924_2060125_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	8.2e-13	54.5
WP_139303532.1\|2060769_2060892_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	1.3e-08	62.2
WP_042512723.1\|2060879_2061242_-	hypothetical protein	NA	NA	NA	NA
WP_033694537.1\|2061421_2061661_+	helix-turn-helix transcriptional regulator	A0A288WFZ7	Bacillus_phage	2.0e-21	67.1
WP_042512724.1\|2061737_2062070_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	4.8e-18	47.2
WP_042512725.1\|2062093_2062291_+	hypothetical protein	NA	NA	NA	NA
WP_042512726.1\|2062292_2063639_+	hypothetical protein	NA	NA	NA	NA
WP_042512727.1\|2064604_2064835_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.2e-23	73.3
WP_042512728.1\|2064849_2065134_-	hypothetical protein	NA	NA	NA	NA
WP_042512729.1\|2065227_2065503_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	1.4e-31	72.9
WP_080334514.1\|2065522_2067901_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	6.9e-183	35.2
WP_042512730.1\|2067897_2069409_-\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	5.1e-163	58.6
WP_042513567.1\|2069421_2073210_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	9.4e-41	40.3
WP_042512731.1\|2073246_2073501_-	hypothetical protein	NA	NA	NA	NA
WP_042512732.1\|2073590_2073968_-	hypothetical protein	NA	NA	NA	NA
WP_042512733.1\|2074020_2074536_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_042512734.1\|2074549_2074957_-	hypothetical protein	NA	NA	NA	NA
WP_042512735.1\|2074963_2075326_-	hypothetical protein	NA	NA	NA	NA
WP_042512736.1\|2075325_2075700_-	hypothetical protein	NA	NA	NA	NA
WP_042512737.1\|2075703_2076510_-	hypothetical protein	NA	NA	NA	NA
WP_042512738.1\|2076514_2076856_-	hypothetical protein	NA	NA	NA	NA
WP_042512739.1\|2076885_2077110_-	hypothetical protein	NA	NA	NA	NA
WP_042512740.1\|2077160_2077568_-	hypothetical protein	NA	NA	NA	NA
WP_042512741.1\|2077666_2078791_-	DUF5309 family protein	NA	NA	NA	NA
WP_042512742.1\|2078853_2079636_-	scaffolding protein	Q4ZC70	Staphylococcus_virus	4.4e-09	40.9
WP_042512743.1\|2079694_2081212_-\|portal	phage portal protein	A0A142F1L7	Bacillus_phage	1.6e-68	30.4
WP_042512744.1\|2081228_2082944_-\|terminase	phage terminase large subunit	A0A142F1L6	Bacillus_phage	5.0e-151	52.9
WP_042512745.1\|2082960_2083389_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	2.6e-32	50.4
WP_042512746.1\|2084158_2084548_-	hypothetical protein	NA	NA	NA	NA
WP_042512747.1\|2084808_2085135_-	hypothetical protein	NA	NA	NA	NA
WP_042512748.1\|2085124_2085307_-	hypothetical protein	A0A1B1P7M4	Bacillus_phage	4.4e-05	48.0
WP_042512749.1\|2085469_2086669_+	protein kinase	J2YXI2	Acanthamoeba_polyphaga_lentillevirus	1.3e-07	28.0
WP_042512750.1\|2086665_2086863_-	hypothetical protein	NA	NA	NA	NA
WP_042512751.1\|2086859_2087057_-	hypothetical protein	A0A1L2JY50	Aeribacillus_phage	8.6e-07	47.4
WP_042512752.1\|2087061_2087340_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.0e-13	62.3

DBSCAN-SWA_3

2543811 : 2553129

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512871.1\|2543811_2544684_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	7.9e-68	45.1
WP_042512872.1\|2544818_2545490_-	O-methyltransferase	W8CYT3	Bacillus_phage	6.5e-62	86.9
WP_000818985.1\|2545639_2546359_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000823559.1\|2546554_2547142_+	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_042512873.1\|2547166_2548240_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	2.7e-171	88.2
WP_000254054.1\|2548236_2548923_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-118	93.9
WP_042512874.1\|2549002_2550763_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.7e-267	95.7
WP_001194301.1\|2551003_2551768_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755546.1\|2551866_2553129_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	6.8e-12	32.0

DBSCAN-SWA_4

2919542 : 2928887

Bacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080334529.1\|2919542_2920997_-	recombinase family protein	Q3HKZ2	Bacillus_phage	3.1e-274	98.1
WP_042512998.1\|2921063_2921927_-	helix-turn-helix domain-containing protein	A0A288WFX4	Bacillus_phage	4.5e-156	99.7
WP_142337077.1\|2921942_2922062_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	4.7e-08	74.4
WP_042512999.1\|2922225_2922462_+	helix-turn-helix domain-containing protein	A0A288WFZ7	Bacillus_phage	1.2e-34	100.0
WP_042513000.1\|2922494_2923112_-	phage protein	Q2LIA9	Bacillus_phage	1.2e-110	98.5
WP_042513001.1\|2923053_2924235_-	cell division protein FtsK	Q3HKZ7	Bacillus_phage	1.7e-227	99.7
WP_001982935.1\|2924352_2924535_-	hypothetical protein	Q2I8E2	Bacillus_phage	4.2e-24	100.0
WP_042513002.1\|2924531_2924840_-	hypothetical protein	Q2I8E3	Bacillus_phage	6.6e-46	90.2
WP_042513003.1\|2924999_2925197_+	helix-turn-helix domain-containing protein	A0A288WG80	Bacillus_phage	8.3e-26	95.4
WP_042513004.1\|2925201_2925786_+	type IV secretory system conjugative DNA transfer family protein	A0A288WFT6	Bacillus_phage	6.8e-108	99.0
WP_042513005.1\|2925853_2926183_+	hypothetical protein	A0A288WGP7	Bacillus_phage	1.0e-52	96.3
WP_042513006.1\|2926304_2927303_+	hypothetical protein	NA	NA	NA	NA
WP_042513007.1\|2927359_2928415_-	N-acetylmuramoyl-L-alanine amidase	D3WK93	Bacillus_phage	3.6e-200	97.7
WP_016716828.1\|2928411_2928651_-	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	1.7e-33	98.7
WP_029440514.1\|2928650_2928887_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	97.4

DBSCAN-SWA_5

2932787 : 2996834

Bacillus_phage(92.31%)

capsid,head,portal,tail,protease,transposase,coat,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042513008.1\|2932787_2934278_-\|tail	phage tail protein	A0A288WFS2	Bacillus_phage	2.3e-293	99.4
WP_042513009.1\|2934292_2938144_-\|tail	phage tail tape measure protein	A0A288WG36	Bacillus_phage	0.0e+00	96.1
WP_042513010.1\|2938366_2938684_-	hypothetical protein	A0A288WFU6	Bacillus_phage	4.4e-53	100.0
WP_001982989.1\|2938733_2939342_-\|tail	tail protein	Q2I8F2	Bacillus_phage	1.4e-108	100.0
WP_001983061.1\|2939342_2939702_-	DUF3168 domain-containing protein	Q2I8F3	Bacillus_phage	5.9e-62	100.0
WP_001983159.1\|2939698_2940139_-	phage protein, HK97 gp10 family	Q2I8F4	Bacillus_phage	4.2e-78	100.0
WP_001983098.1\|2940131_2940455_-\|head	phage head closure protein	Q2I8F5	Bacillus_phage	6.7e-57	100.0
WP_042513011.1\|2940451_2940742_-\|head,tail	phage gp6-like head-tail connector protein	A0A288WFX0	Bacillus_phage	1.1e-47	100.0
WP_042513012.1\|2940759_2941938_-\|capsid	phage major capsid protein	Q2I8F7	Bacillus_phage	1.9e-213	99.7
WP_001982892.1\|2941976_2942597_-\|head,protease	HK97 family phage prohead protease	Q2I8F8	Bacillus_phage	4.8e-112	100.0
WP_001983089.1\|2942559_2943858_-\|portal	phage portal protein	Q2LIC9	Bacillus_phage	4.1e-246	100.0
WP_042513013.1\|2943873_2945571_-\|terminase	terminase large subunit	A0A288WFW5	Bacillus_phage	0.0e+00	99.8
WP_042513014.1\|2945567_2946053_-\|terminase	phage terminase small subunit P27 family	A0A288WFZ9	Bacillus_phage	7.7e-81	100.0
WP_042513015.1\|2946153_2946537_-	HNH endonuclease	Q2I8B2	Bacillus_phage	2.0e-68	97.6
WP_080334540.1\|2946605_2946968_-	hypothetical protein	A0A288WG64	Bacillus_phage	2.4e-39	74.8
WP_042513016.1\|2947210_2947465_-	hypothetical protein	A0A288WG25	Bacillus_phage	3.7e-42	97.6
WP_042513592.1\|2947484_2947676_-	hypothetical protein	A0A288WFV5	Bacillus_phage	9.5e-27	100.0
WP_042513017.1\|2947704_2947947_-	hypothetical protein	A0A288WG15	Bacillus_phage	1.5e-40	100.0
WP_042513018.1\|2947951_2948173_-	hypothetical protein	A0A288WG47	Bacillus_phage	1.0e-32	98.6
WP_042513019.1\|2948179_2948404_-	hypothetical protein	Q3HKX2	Bacillus_phage	2.5e-26	82.4
WP_052494330.1\|2948436_2949183_-	site-specific DNA-methyltransferase	A0A0H3UZL7	Geobacillus_virus	1.1e-78	60.1
WP_001982886.1\|2949376_2949772_-	sigma-70 family RNA polymerase sigma factor	A0A288WFT8	Bacillus_phage	2.0e-66	100.0
WP_144402435.1\|2949945_2950068_-	DUF3983 domain-containing protein	A0A288WG42	Bacillus_phage	6.9e-15	97.5
WP_042513020.1\|2950220_2950409_-	hypothetical protein	A0A288WG27	Bacillus_phage	8.2e-23	90.3
WP_042513021.1\|2950444_2950987_-	hypothetical protein	A0A288WG53	Bacillus_phage	7.5e-101	100.0
WP_042513022.1\|2951044_2951521_-	hypothetical protein	A0A288WFT9	Bacillus_phage	7.0e-95	99.4
WP_042513023.1\|2951517_2952264_-	sigma-70 family RNA polymerase sigma factor	A0A288WFV7	Bacillus_phage	1.3e-135	100.0
WP_001982974.1\|2952256_2952490_-	hypothetical protein	Q3HKY5	Bacillus_phage	8.9e-35	100.0
WP_042513024.1\|2952508_2953420_-	ATP-binding protein	Q2I8C8	Bacillus_phage	2.2e-169	99.0
WP_042513025.1\|2953435_2954371_-	chromosomal replication initiator protein DnaA	A0A288WFS8	Bacillus_phage	1.5e-141	95.0
WP_042513026.1\|2954499_2955150_-	hypothetical protein	A0A288WGQ2	Bacillus_phage	1.7e-120	98.1
WP_042513027.1\|2955560_2956307_-	antirepressor	A0A288WG93	Bacillus_phage	3.6e-138	99.6
WP_042513028.1\|2956749_2956977_-	helix-turn-helix transcriptional regulator	A0A288WG39	Bacillus_phage	2.3e-35	100.0
WP_015980883.1\|2957136_2957493_+	helix-turn-helix transcriptional regulator	Q2I8D5	Bacillus_phage	3.9e-58	100.0
WP_052494350.1\|2957833_2959168_-	hypothetical protein	A0A288WGA2	Bacillus_phage	1.7e-247	99.3
WP_001228046.1\|2969370_2969511_-	FbpB family small basic protein	NA	NA	NA	NA
WP_000757056.1\|2969695_2970562_-	5'-3' exonuclease	F8WQ40	Bacillus_phage	4.2e-21	33.6
WP_042513029.1\|2970692_2971418_-	magnesium transporter	NA	NA	NA	NA
WP_000606864.1\|2972110_2972497_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_000084951.1\|2972493_2973729_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	5.3e-09	23.3
WP_000169023.1\|2973732_2974044_-	hypothetical protein	NA	NA	NA	NA
WP_001235536.1\|2974127_2974595_+	hypothetical protein	NA	NA	NA	NA
WP_042513030.1\|2974859_2976215_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1L2BWW3	Bacteriophage	1.5e-44	32.5
WP_000637547.1\|2977245_2978085_-	sulfurtransferase	NA	NA	NA	NA
WP_000451813.1\|2978087_2978360_-	YpbS family protein	NA	NA	NA	NA
WP_000117682.1\|2978381_2978849_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000369736.1\|2978921_2979176_+	DUF3931 domain-containing protein	NA	NA	NA	NA
WP_042513031.1\|2979179_2982839_-	GTPase	NA	NA	NA	NA
WP_000193104.1\|2983388_2984552_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_000809214.1\|2984624_2985947_-	xanthine permease	NA	NA	NA	NA
WP_000866488.1\|2985950_2986544_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_000628422.1\|2986869_2987616_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_001091345.1\|2988150_2989047_+	macrolide 2'-phosphotransferase MphL	NA	NA	NA	NA
WP_000386777.1\|2989101_2989575_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042513032.1\|2989619_2991137_-	carboxypeptidase	NA	NA	NA	NA
WP_000493715.1\|2991241_2993179_-	ATP-dependent DNA helicase	NA	NA	NA	NA
WP_000376886.1\|2993316_2993499_-	DUF3921 domain-containing protein	NA	NA	NA	NA
WP_000521234.1\|2993560_2994700_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_000622430.1\|2995358_2995697_-	cell division regulator GpsB	NA	NA	NA	NA
WP_042513033.1\|2995794_2996349_-	DUF1273 domain-containing protein	A0A1P8CWY2	Bacillus_phage	4.8e-10	27.0
WP_000546294.1\|2996405_2996834_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_6

4203075 : 4211452

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088592.1\|4203075_4203663_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1
WP_001262436.1\|4203659_4204700_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000879029.1\|4204806_4206222_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_000055577.1\|4206206_4208426_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000666792.1\|4208409_4209093_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278823.1\|4209089_4209344_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170540.1\|4209336_4210056_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
WP_000625683.1\|4210144_4211452_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3

DBSCAN-SWA_7

5040616 : 5127097

uncultured_Caudovirales_phage(31.58%)

capsid,tRNA,head,portal,tail,bacteriocin,protease,integrase,coat,terminase

attL 5059315:5059334|attR 5132481:5132500

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002003767.1\|5040616_5041432_-\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_001241000.1\|5041517_5042249_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000744208.1\|5042286_5042862_-	hypothetical protein	NA	NA	NA	NA
WP_000435948.1\|5042980_5043289_+	YutD family protein	NA	NA	NA	NA
WP_042513424.1\|5043334_5043832_-	hypothetical protein	NA	NA	NA	NA
WP_000392606.1\|5044204_5044471_-	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_000439090.1\|5044488_5045460_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_000274012.1\|5045607_5046048_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_042513425.1\|5046119_5046752_+	transcriptional regulator	NA	NA	NA	NA
WP_000276472.1\|5046861_5047626_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_042513426.1\|5047850_5048432_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_001021173.1\|5048633_5049422_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-34	40.0
WP_042513427.1\|5049405_5051979_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_000351173.1\|5052481_5052961_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000665104.1\|5052981_5053473_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	7.9e-41	53.1
WP_042513428.1\|5053593_5054595_+\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_001125503.1\|5054656_5054872_-	hypothetical protein	NA	NA	NA	NA
WP_000431159.1\|5055188_5055425_-	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_000248594.1\|5055631_5055940_+	YuzD family protein	NA	NA	NA	NA
WP_000494420.1\|5055908_5056787_+	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000379272.1\|5056885_5057563_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_042513429.1\|5057893_5058688_+	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_000212737.1\|5058923_5059265_+	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
5059315:5059334	attL	NA	NA	NA	NA
WP_042513430.1\|5059445_5060243_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_000470281.1\|5060226_5060886_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-23	34.4
WP_000994518.1\|5060940_5061114_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_000682073.1\|5061344_5062415_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000595027.1\|5062766_5063006_+	YuzB family protein	NA	NA	NA	NA
WP_000077386.1\|5063249_5064116_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_000573825.1\|5064157_5064511_+	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	3.7e-16	43.3
WP_042513431.1\|5064738_5065092_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	5.0e-13	38.7
WP_042513432.1\|5065179_5066241_-\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	9.2e-196	97.2
WP_042513433.1\|5066320_5066953_-	helix-turn-helix domain-containing protein	A0A1B2APZ3	Phage_Wrath	1.1e-116	99.0
WP_042513434.1\|5067111_5067339_+	helix-turn-helix transcriptional regulator	A0A1B2APZ4	Phage_Wrath	1.2e-33	93.3
WP_042513435.1\|5067480_5067669_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	2.6e-21	85.5
WP_042513436.1\|5067854_5068082_+	hypothetical protein	NA	NA	NA	NA
WP_042513437.1\|5068082_5068433_+	hypothetical protein	A0A1B2AQ59	Phage_Wrath	3.2e-44	75.9
WP_042513438.1\|5068699_5068915_+	hypothetical protein	A0A2H4JCV1	uncultured_Caudovirales_phage	1.4e-29	93.0
WP_042513439.1\|5068899_5069103_+	hypothetical protein	A0A2H4J979	uncultured_Caudovirales_phage	4.7e-24	83.6
WP_042513440.1\|5069102_5069384_+	hypothetical protein	A0A1B2AQ09	Phage_Wrath	2.5e-23	58.7
WP_042513441.1\|5069361_5069910_+	hypothetical protein	A0A1B2AQ11	Phage_Wrath	1.1e-91	95.6
WP_042513442.1\|5069917_5070586_+	hypothetical protein	A0A2H4JB05	uncultured_Caudovirales_phage	3.0e-67	60.8
WP_042513443.1\|5070591_5071284_+	AAA family ATPase	A0A2H4J9A0	uncultured_Caudovirales_phage	1.6e-116	94.1
WP_042513444.1\|5071283_5071757_+	DUF669 domain-containing protein	A0A2H4J986	uncultured_Caudovirales_phage	6.6e-85	100.0
WP_042513445.1\|5071864_5072071_+	hypothetical protein	O64170	Bacillus_phage	1.7e-21	70.3
WP_042513446.1\|5072104_5074459_+	DNA primase	A0A1B2AQ05	Phage_Wrath	0.0e+00	86.7
WP_042513447.1\|5074724_5075153_+	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	3.9e-76	95.1
WP_042513448.1\|5075155_5075539_+	hypothetical protein	A0A0A7RWK2	Clostridium_phage	6.0e-12	39.1
WP_042513449.1\|5075535_5076075_+	nuclease	A0A0S2SXQ1	Bacillus_phage	3.9e-49	53.7
WP_042513450.1\|5076076_5076361_+	hypothetical protein	A0A0H3V0M3	Geobacillus_virus	3.0e-16	51.1
WP_042513451.1\|5076442_5076787_+	hypothetical protein	A0A1B1P7N6	Bacillus_phage	5.0e-26	58.5
WP_042513452.1\|5076846_5077383_+	dUTPase	A0A2H4J4W9	uncultured_Caudovirales_phage	1.1e-72	73.6
WP_042513453.1\|5077417_5077717_+	hypothetical protein	Q3HKX6	Bacillus_phage	4.3e-34	70.7
WP_042513621.1\|5078152_5078275_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_042513454.1\|5078312_5078699_+	phage protein	A0A2H4JFW6	uncultured_Caudovirales_phage	1.1e-48	76.8
WP_042513456.1\|5079120_5079441_+	phage protein	A0A1B0T6C6	Bacillus_phage	1.2e-42	84.9
WP_042513457.1\|5079437_5079803_+	HNH endonuclease	A0A2H4JA38	uncultured_Caudovirales_phage	2.4e-42	66.1
WP_042513458.1\|5079923_5080358_+	hypothetical protein	A0A1B2APW6	Phage_Wrath	2.0e-64	89.6
WP_042513459.1\|5080354_5082079_+\|terminase	terminase large subunit	A0A1B2AQ28	Phage_Wrath	0.0e+00	97.9
WP_042513460.1\|5082183_5083389_+\|portal	phage portal protein	A0A1B2APW5	Phage_Wrath	2.0e-218	95.5
WP_001140505.1\|5083357_5083936_+\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	4.2e-86	82.5
WP_042513461.1\|5083937_5085287_+\|capsid	phage major capsid protein	A0A2H4JFZ3	uncultured_Caudovirales_phage	2.8e-128	69.9
WP_042513462.1\|5085288_5085549_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J865	uncultured_Caudovirales_phage	5.4e-41	95.3
WP_042513463.1\|5085529_5085859_+	hypothetical protein	A0A2H4J9Y9	uncultured_Caudovirales_phage	3.0e-52	95.4
WP_042513464.1\|5085848_5086178_+	hypothetical protein	A0A1C8E981	Bacillus_phage	2.2e-55	96.3
WP_042513465.1\|5086177_5086555_+	hypothetical protein	A0A1B2APW9	Phage_Wrath	9.6e-63	97.6
WP_042513466.1\|5086566_5087196_+\|tail	phi13 family phage major tail protein	A0A2H4JEZ7	uncultured_Caudovirales_phage	4.9e-104	88.5
WP_042513467.1\|5087206_5087593_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	3.5e-60	90.6
WP_078386944.1\|5087836_5091118_+\|tail	phage tail tape measure protein	A0A1B2APW4	Phage_Wrath	3.5e-217	74.1
WP_052494354.1\|5091121_5091835_+	hypothetical protein	A0A1B2APY0	Phage_Wrath	1.4e-110	80.6
WP_042513469.1\|5091835_5093371_+	lysin	A0A1B2APX2	Phage_Wrath	4.3e-178	62.9
WP_042513470.1\|5093363_5095223_+	hypothetical protein	Q0E5W5	Pseudomonas_phage	1.7e-11	62.7
WP_052494338.1\|5095219_5095519_+	hypothetical protein	NA	NA	NA	NA
WP_158319614.1\|5095531_5095672_+	hypothetical protein	NA	NA	NA	NA
WP_042513471.1\|5096008_5096272_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	2.4e-20	59.8
WP_042513472.1\|5096268_5097315_+	SH3 domain-containing protein	A0A2H4JEZ1	uncultured_Caudovirales_phage	1.2e-179	89.4
WP_042513473.1\|5097358_5097856_-	hypothetical protein	A0A1B2APY6	Phage_Wrath	5.8e-76	87.9
WP_042513474.1\|5097889_5098222_-	hypothetical protein	A0A2H4J846	uncultured_Caudovirales_phage	1.0e-47	96.4
WP_158319615.1\|5098281_5098452_-	hypothetical protein	A0A2H4JCU3	uncultured_Caudovirales_phage	2.2e-19	78.6
WP_042513475.1\|5098479_5099310_-	cytosolic protein	A0A1B2APY5	Phage_Wrath	3.2e-111	95.7
WP_001982685.1\|5099633_5100095_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_042513476.1\|5100173_5101061_+	decarboxylase	NA	NA	NA	NA
WP_000391912.1\|5101071_5102319_-	MFS transporter	NA	NA	NA	NA
WP_001994481.1\|5102494_5102971_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_042513477.1\|5103416_5114153_+	DUF11 domain-containing protein	NA	NA	NA	NA
WP_000829779.1\|5114271_5115261_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	3.0e-31	52.4
WP_000856618.1\|5115723_5116932_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_042513478.1\|5117055_5117562_+	NUDIX hydrolase	NA	NA	NA	NA
WP_000027007.1\|5117558_5117876_+	hypothetical protein	NA	NA	NA	NA
WP_042513479.1\|5117962_5118589_+	3D domain-containing protein	A0A0H3UZG2	Geobacillus_virus	2.3e-13	42.1
WP_000487987.1\|5118734_5120219_+	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.3e-57	36.6
WP_001158741.1\|5120301_5120907_-	hypothetical protein	NA	NA	NA	NA
WP_001104191.1\|5121050_5122775_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	5.2e-180	54.4
WP_000832654.1\|5122883_5123771_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	7.7e-79	53.1
WP_001252159.1\|5123816_5124410_-	biotin transporter BioY	NA	NA	NA	NA
WP_000810351.1\|5124460_5125204_-	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_001140609.1\|5125299_5125683_+	hotdog fold thioesterase	NA	NA	NA	NA
WP_000287154.1\|5125720_5127097_-\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	3.4e-49	28.1
5132481:5132500	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009299

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009300

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection