CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP009332	Bacillus thuringiensis strain HD1011 plasmid 3, complete sequence	0 crisprs	NA	0	5
NZ_CP009335	Bacillus thuringiensis strain HD1011 chromosome, complete genome	3 crisprs	cas3,c2c9_V-U4,csa3,DEDDh,WYL,cas14k,DinG,cas14j	0	6
NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	0 crisprs	cas14j,csa3,Cas14u_CAS-V	0	1
NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	1 crisprs	NA	2	1
NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	0 crisprs	csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 27413

Bacillus_phage(76.92%)

terminase,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000166789.1\|599_1601_-	hypothetical protein	A0A1B1P7E4	Bacillus_phage	9.4e-57	39.3
WP_001169145.1\|1652_2579_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	5.8e-45	35.4
WP_000981366.1\|2565_4104_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	5.6e-93	39.5
WP_042996038.1\|4103_5420_-\|terminase	PBSX family phage terminase large subunit	A0A0S2MVC1	Bacillus_phage	2.7e-176	69.7
WP_000810412.1\|5391_6192_-	hypothetical protein	D2XPX8	Bacillus_virus	2.7e-54	64.3
WP_000428144.1\|6565_6745_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.5e-10	55.9
WP_000600449.1\|7211_7796_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	6.3e-21	36.6
WP_000356958.1\|8276_8639_-	hypothetical protein	NA	NA	NA	NA
WP_000449880.1\|8861_9122_-	hypothetical protein	NA	NA	NA	NA
WP_000441079.1\|10073_10445_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	1.8e-21	48.8
WP_000522788.1\|10583_11213_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.7e-48	60.4
WP_000424230.1\|12796_13075_-	hypothetical protein	NA	NA	NA	NA
WP_000776945.1\|13936_14383_-	dUTP diphosphatase	A0A0U3SLD3	Bacillus_phage	3.3e-62	81.1
WP_001005203.1\|14650_14779_-	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	5.0e-08	73.0
WP_000414708.1\|14787_15186_-	hypothetical protein	B5LPM7	Bacillus_virus	3.2e-24	68.7
WP_000811971.1\|15196_15460_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	4.4e-22	58.6
WP_050427553.1\|15456_15669_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	4.6e-22	75.6
WP_000337751.1\|15625_15889_-	hypothetical protein	A0A1B1P8D7	Bacillus_phage	1.3e-18	70.7
WP_042996037.1\|15901_16660_-	ATP-binding protein	U5PWH5	Bacillus_phage	1.5e-38	40.8
WP_000190245.1\|16643_17381_-	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	3.6e-74	71.6
WP_000472845.1\|17381_17603_-	hypothetical protein	NA	NA	NA	NA
WP_000206165.1\|17808_18426_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	5.4e-31	38.6
WP_000572107.1\|18621_18822_-	hypothetical protein	NA	NA	NA	NA
WP_000024520.1\|19602_19866_-	hypothetical protein	NA	NA	NA	NA
WP_001072753.1\|19879_20728_-	ORF6N domain-containing protein	A0A288WFS9	Bacillus_phage	7.7e-52	51.3
WP_001096410.1\|20793_20997_-	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	9.2e-12	54.7
WP_080545786.1\|21173_21524_+	helix-turn-helix transcriptional regulator	A0A0A7AR52	Bacillus_phage	9.6e-25	51.3
WP_003298867.1\|21568_21688_-	hypothetical protein	NA	NA	NA	NA
WP_001174511.1\|21986_23144_-	hypothetical protein	NA	NA	NA	NA
WP_000853779.1\|23640_23985_+	helix-turn-helix transcriptional regulator	S5MUA5	Brevibacillus_phage	9.8e-06	29.4
WP_000448834.1\|24189_24846_+	DUF4352 domain-containing protein	A0A1B1P898	Bacillus_phage	4.5e-60	92.8
WP_000831282.1\|24865_25210_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	2.6e-43	80.7
WP_000451519.1\|25345_25909_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	6.1e-37	48.7
WP_000185538.1\|26243_27413_+	FRG domain-containing protein	Q9AZ51	Lactococcus_phage	2.6e-10	39.0

DBSCAN-SWA_2

31043 : 34556

Geobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080545817.1\|31043_31286_+	hypothetical protein	A6M971	Geobacillus_virus	4.2e-11	43.8
WP_000466761.1\|32363_34556_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	5.4e-41	27.2

DBSCAN-SWA_3

39512 : 40400

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000503948.1\|39512_40400_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-20	30.8

DBSCAN-SWA_4

45405 : 50611

Bacillus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001231501.1\|45405_47613_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	3.4e-51	30.0
WP_043325353.1\|47776_47986_+	hypothetical protein	NA	NA	NA	NA
WP_000182927.1\|48191_48893_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000517023.1\|49117_50611_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	7.1e-85	41.9

DBSCAN-SWA_5

60349 : 81811

Bacillus_phage(38.46%)

tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000335379.1\|60349_61177_+	AAA family ATPase	F0PIG8	Enterococcus_phage	5.2e-53	41.1
WP_000368262.1\|61169_61529_+	hypothetical protein	NA	NA	NA	NA
WP_000428557.1\|61628_61919_+	hypothetical protein	NA	NA	NA	NA
WP_000359173.1\|61945_62203_+	hypothetical protein	NA	NA	NA	NA
WP_000599688.1\|62322_62625_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000504248.1\|62702_63146_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000128996.1\|63217_63805_-	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	2.3e-10	36.3
WP_000472089.1\|64024_64237_-	DNA-binding protein	A0A1Z1LZP5	Bacillus_phage	3.4e-17	62.9
WP_000720260.1\|64978_65659_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000272602.1\|66074_67340_+	Y-family DNA polymerase	O64031	Bacillus_phage	1.0e-108	48.8
WP_001057808.1\|67336_67678_+	YolD-like family protein	NA	NA	NA	NA
WP_000249946.1\|67809_68727_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	2.2e-20	37.6
WP_000069084.1\|68749_69250_+	hypothetical protein	NA	NA	NA	NA
WP_000406619.1\|69340_70042_-	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	9.9e-130	95.7
WP_000373907.1\|70041_70467_-\|holin	phage holin family protein	D2XPZ9	Bacillus_virus	2.7e-69	96.5
WP_001152007.1\|70563_71232_-	hypothetical protein	A0A2H4J9X9	uncultured_Caudovirales_phage	9.4e-53	74.0
WP_000331441.1\|73089_73359_-	hypothetical protein	NA	NA	NA	NA
WP_000289462.1\|73368_75216_-	hypothetical protein	A0A2P1JTV8	Anoxybacillus_phage	2.5e-127	44.2
WP_000383066.1\|75227_76109_-\|tail	phage tail family protein	A0A2P1JTW0	Anoxybacillus_phage	2.6e-74	47.9
WP_000235298.1\|76108_78835_-	hypothetical protein	B5LPS3	Bacillus_virus	9.4e-75	46.4
WP_000424144.1\|78850_79111_-	hypothetical protein	NA	NA	NA	NA
WP_001210040.1\|79188_79605_-	hypothetical protein	NA	NA	NA	NA
WP_000852367.1\|79670_80135_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_000273214.1\|80149_80551_-	hypothetical protein	NA	NA	NA	NA
WP_000168166.1\|80553_81045_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	5.6e-39	50.3
WP_000058075.1\|81029_81422_-	DUF3599 family protein	NA	NA	NA	NA
WP_001128457.1\|81421_81811_-	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	9.4e-21	40.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009335

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009335_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009335_1

2350902-2351010

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009335_1

>merge|NZ_CP009335|1|2350902-2351010|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>NZ_CP009335|1|1|2350902-2351010|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009335.1\|WP_001079102.1\|2349311_2350205_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP009335.1\|WP_001087866.1\|2359010_2359700_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP009335.1\|WP_000872722.1\|2351782_2352523_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP009335.1\|WP_000427734.1\|2353900_2354836_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP009335.1\|WP_001180009.1\|2347439_2347811_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009335.1\|WP_000799201.1\|2339972_2341517_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP009335.1\|WP_001081482.1\|2347841_2348480_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP009335.1\|WP_000360640.1\|2345242_2346136_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP009335.1\|WP_000673188.1\|2348498_2349296_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP009335.1\|WP_000003394.1\|2342893_2344720_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009335.1\|WP_000612273.1\|2341598_2342843_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP009335.1\|WP_000428855.1\|2355737_2356583_-\|O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP009335.1\|WP_000932921.1\|2357758_2358859_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP009335.1\|WP_000043381.1\|2346135_2346534_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP009335.1\|WP_000654694.1\|2352597_2353758_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP009335.1\|WP_000651510.1\|2360395_2361076_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009335.1\|WP_001004743.1\|2354842_2355601_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009335.1\|WP_000069725.1\|2356705_2357593_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP009335.1\|WP_001271203.1\|2359696_2360383_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009335.1\|WP_000191105.1\|2346714_2347293_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627

Protein	Function_ID	Function_description	E-value
NZ_CP009335.1\|WP_001079102.1\|2349311_2350205_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	4.87507e-101
NZ_CP009335.1\|WP_001087866.1\|2359010_2359700_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.33577e-17
NZ_CP009335.1\|WP_000872722.1\|2351782_2352523_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP009335.1\|WP_000427734.1\|2353900_2354836_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.94506e-22
NZ_CP009335.1\|WP_000799201.1\|2339972_2341517_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP009335.1\|WP_001081482.1\|2347841_2348480_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP009335.1\|WP_000360640.1\|2345242_2346136_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	6.08384e-93
NZ_CP009335.1\|WP_000673188.1\|2348498_2349296_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP009335.1\|WP_000003394.1\|2342893_2344720_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009335.1\|WP_000612273.1\|2341598_2342843_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.92237e-59
NZ_CP009335.1\|WP_000428855.1\|2355737_2356583_-\|O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.13671e-149
NZ_CP009335.1\|WP_000932921.1\|2357758_2358859_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.01776e-55
NZ_CP009335.1\|WP_000043381.1\|2346135_2346534_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NZ_CP009335.1\|WP_000654694.1\|2352597_2353758_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.52707e-99
NZ_CP009335.1\|WP_000651510.1\|2360395_2361076_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	6.29242e-108
NZ_CP009335.1\|WP_001004743.1\|2354842_2355601_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.00939e-20
NZ_CP009335.1\|WP_000069725.1\|2356705_2357593_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	3.30703e-18
NZ_CP009335.1\|WP_001271203.1\|2359696_2360383_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.87129e-112
NZ_CP009335.1\|WP_000191105.1\|2346714_2347293_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83

>NZ_CP009335.1|WP_001079102.1|2349311_2350205_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQAGEEIRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFAAMIPSDMQEVLRQT
>NZ_CP009335.1|WP_000673188.1|2348498_2349296_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYDRLAETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPAAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP009335.1|WP_001081482.1|2347841_2348480_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP009335.1|WP_001180009.1|2347439_2347811_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP009335.1|WP_000191105.1|2346714_2347293_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP009335.1|WP_000043381.1|2346135_2346534_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP009335.1|WP_000360640.1|2345242_2346136_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPSLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEEDLV
>NZ_CP009335.1|WP_000003394.1|2342893_2344720_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIVHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP009335.1|WP_000612273.1|2341598_2342843_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP009335.1|WP_000799201.1|2339972_2341517_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLFDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP009335.1|WP_000872722.1|2351782_2352523_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP009335.1|WP_000654694.1|2352597_2353758_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLCILFAIGTVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGVIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFVTAVTLTYIFFTHTKFFKTHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIAIFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP009335.1|WP_000427734.1|2353900_2354836_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQDIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP009335.1|WP_001004743.1|2354842_2355601_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP009335.1|WP_000428855.1|2355737_2356583_-|O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP009335.1|WP_000069725.1|2356705_2357593_-|hypothetical-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGDTGATGPTGPTGATGLTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP009335.1|WP_000932921.1|2357758_2358859_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQDAVAAGEELSPRDLFYYANECMDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGLWEKAVESCVKSFRYAIPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSIFDQQKKSL
>NZ_CP009335.1|WP_001087866.1|2359010_2359700_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMEMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSSL
>NZ_CP009335.1|WP_001271203.1|2359696_2360383_+|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLAVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMASQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP009335.1|WP_000651510.1|2360395_2361076_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTFLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009335_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009335_2

3941459-3941633

Orphan

Consensus_repeat	Method
ATTTCGGAATGAATGTTCATTCCTCTC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP009335_2

>merge|NZ_CP009335|2|3941459-3941633|PILER-CR
ATTTTGAAAACACCTTTTCGGAATGAACGTTCATTCCTCTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGATTTTGGAATGAATATTCATTCCTTTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCTCATCGGAATGAATGTTCATTCCTGTC

>NZ_CP009335|2|1|3941459-3941633|PILER-CR
ATTTTGAAAACACCTTTTCGGAATGAACGTTCATTCCTCTC	GTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGG
ATTTTGGAATGAATATTCATTCCTTTAATTGTACAGATTGA	TCATCTCCTACTTTTCTTTTTCACACCCTCATCGGAATGAATGTTCA
TTCCTGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009335.1\|WP_001106984.1\|3929636_3929897_-\|lipoprotein	unknown	unknown	gnl\|CDD\|236766
NZ_CP009335.1\|WP_002036551.1\|3950814_3954327_-\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|238697
NZ_CP009335.1\|WP_001107293.1\|3941650_3942217_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP009335.1\|WP_000346924.1\|3931870_3932542_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP009335.1\|WP_000633862.1\|3935091_3936717_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP009335.1\|WP_000923439.1\|3928587_3929271_-\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|132880
NZ_CP009335.1\|WP_000637710.1\|3931097_3931760_+\|DUF3841-domain-containing-protein	unknown	unknown	gnl\|CDD\|378997
NZ_CP009335.1\|WP_001197260.1\|3946330_3947431_-\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP009335.1\|WP_001100949.1\|3942486_3943644_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_CP009335.1\|WP_001093214.1\|3937094_3937943_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
NZ_CP009335.1\|WP_000040240.1\|3938280_3941397_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP009335.1\|WP_000646309.1\|3927869_3928571_-\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393
NZ_CP009335.1\|WP_000997708.1\|3954477_3954915_+\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP009335.1\|WP_000709765.1\|3955063_3955594_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP009335.1\|WP_000808762.1\|3932601_3934575_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP009335.1\|WP_000551420.1\|3930114_3930942_+\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP009335.1\|WP_001269434.1\|3947449_3948622_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP009335.1\|WP_001273582.1\|3948906_3949983_-\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614
NZ_CP009335.1\|WP_001228119.1\|3945237_3946338_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP009335.1\|WP_000664621.1\|3943931_3945221_-\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037

Protein	Function_ID	Function_description	E-value
NZ_CP009335.1\|WP_001106984.1\|3929636_3929897_-\|lipoprotein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.000712004
NZ_CP009335.1\|WP_002036551.1\|3950814_3954327_-\|DUF4020-domain-containing-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	5.8202e-56
NZ_CP009335.1\|WP_001107293.1\|3941650_3942217_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.12259e-71
NZ_CP009335.1\|WP_000346924.1\|3931870_3932542_+\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	1.98691e-73
NZ_CP009335.1\|WP_000633862.1\|3935091_3936717_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP009335.1\|WP_000923439.1\|3928587_3929271_-\|DNA-alkylation-repair-protein	gnl\|CDD\|132880	cd06561, AlkD_like, A new structural DNA glycosylase. This domain represents a new and uncharacterized structural superfamily of DNA glycosylases that form an alpha-alpha superhelix fold that are not belong to the identified five structural DNA glycosylase superfamilies (UDG, AAG/MNPG, MutM/Fpg and helix-hairpin-helix). DNA glycosylases removing alkylated base residues have been identified in all organisms investigated and may be universally present in nature. DNA glycosylases catalyze the first step in Base Excision Repair (BER) pathway by cleaving damaged DNA bases within double strand DNA to produce an abasic site. The resulting abasic site is further processed by AP endonuclease, phosphodiesterase, DNA polymerases, and DNA ligase functions to restore the DNA to an undamaged state. All glycosylase examined to date utilize a similar strategy for binding DNA and base flipping despite their structural diversity.	1.52684e-27
NZ_CP009335.1\|WP_000637710.1\|3931097_3931760_+\|DUF3841-domain-containing-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	2.53199e-30
NZ_CP009335.1\|WP_001197260.1\|3946330_3947431_-\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP009335.1\|WP_001100949.1\|3942486_3943644_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	4.66704e-71
NZ_CP009335.1\|WP_001093214.1\|3937094_3937943_-\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	6.53543e-151
NZ_CP009335.1\|WP_000040240.1\|3938280_3941397_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	3.18041e-77
NZ_CP009335.1\|WP_000646309.1\|3927869_3928571_-\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	2.05551e-10
NZ_CP009335.1\|WP_000997708.1\|3954477_3954915_+\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	3.67802e-44
NZ_CP009335.1\|WP_000709765.1\|3955063_3955594_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.19855e-68
NZ_CP009335.1\|WP_000808762.1\|3932601_3934575_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP009335.1\|WP_000551420.1\|3930114_3930942_+\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.37912e-85
NZ_CP009335.1\|WP_001269434.1\|3947449_3948622_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP009335.1\|WP_001273582.1\|3948906_3949983_-\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP009335.1\|WP_001228119.1\|3945237_3946338_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	5.06467e-160
NZ_CP009335.1\|WP_000664621.1\|3943931_3945221_-\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0

>NZ_CP009335.1|WP_000040240.1|3938280_3941397_-|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKDLEKQLVSKDNTTILTQISIDKKQGEISKVSNNLHNKVKTKGVKTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFDFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFVALIIVFVISIPFVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTEKILKVKGVSEVYAPTRPTGERIKELYINKQAGELNTGLGDANGGIKEINDGLTTAKDKMGSKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIESGLTSVNENISVLSNATSQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQTKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQLLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPIIQEINKTIDGTLKGTELNNAKKAIGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLILACFASLGISEQISTHLLNVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGDPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLTLIQVASVVGVALFLLAIIVMPILLPALIGLTSKMKDYAKKLSVRK
>NZ_CP009335.1|WP_001093214.1|3937094_3937943_-|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAQLINDILSQNKIEVELFLEGNLNHPADYDSVSCFNKFEFDRLLSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELPFDKNVELIADKWQDFAEIALEDDKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLFYVEQDDLEFSFRKALKERNPEWSTGMVDYYTNQGYGKEHNHSGVEGAIKVLEARRNLELEIFDMLKMKKEKINNTKYEIDSYRSMLKDKLTIQMVK
>NZ_CP009335.1|WP_000633862.1|3935091_3936717_-|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_CP009335.1|WP_000808762.1|3932601_3934575_-|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
>NZ_CP009335.1|WP_000346924.1|3931870_3932542_+|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLIVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFIKWAFIIIIIAGVVFFGKAKQKATDGSI
>NZ_CP009335.1|WP_000637710.1|3931097_3931760_+|DUF3841-domain-containing-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDSDDIYSYDWMVRVAKTKLPHYEGNYPIWVWEANNYPNRNHKAWGRKNSKMVILTLDVPKEWVLWSDISYWCCAMGDSSMYFHQADKPALEEWYTYMDKEYGIIFDFVYLLSHPDWYLDKEDSLEKQGVIGKIPLSFVKKVRRFRAKEDTSIHTIRSDNWDNRKENRIKKMNRKLRKRNEKQKRVQKRLIRN
>NZ_CP009335.1|WP_000551420.1|3930114_3930942_+|polysaccharide-deacetylase
MHNGIRMTTLMKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWTYNKMPVDAASAKIVQNVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM
>NZ_CP009335.1|WP_001106984.1|3929636_3929897_-|lipoprotein
MNYKKMLSIFMTSIFTVGLLIGCNPAPKDEKEPDPTEEPSEQRQEEKNEKQDPAKEQNNELNKKDEQEPDPTEEPSEEQKKKKENE
>NZ_CP009335.1|WP_000923439.1|3928587_3929271_-|DNA-alkylation-repair-protein
MLLEEVMQQLEEYGTEQNRKTYKNHGAKEPLFGVSFANLKLLKKKIKKDHDLAISLWETKNMDAMTLATMILDPKKVTTELLNKWVQEVDYYCLMDVLMTAICTSPIAIERMEEWTKSDDEWIGRAGWSLLANIAIKNKTLQDDFFSPYLEEIKENIHNEKNRKREAMNSALIAIGIRNEDLEQTAIEIAREIGKVQVDHGATSCKTPDAESYIKKARERAEKKKMK
>NZ_CP009335.1|WP_000646309.1|3927869_3928571_-|nucleotidyltransferase-domain-containing-protein
MKAMEAAQSIITSHFPDCDVALLGGSVARGEATKTSDLDIVIVDQSLTSCYRESFYSNGWPVEVFVHNFETYKTFFKMDCDRGRPSLPQLVSEGIVLKGENEIVEKLKREASDLLNKGPAKWTEEMMKQKRYFITDTLDDFIGASKREEELFIANLLADLLHEYVLRVNGKWLGNSKWFIRVLRKYDEQYADQFVAAFDHFYTTGEKSKLITFVEKTLEQYGGRMFEGFSIGK
>NZ_CP009335.1|WP_001107293.1|3941650_3942217_-|TetR-family-transcriptional-regulator
MAKNKQEDIFDAAIQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFTKSVLQLSELIKTDFPVNANIREQFSHTYNRLFEFARQNADAFLFTNSHCDSYFLDEHSNEIFEDFMGFFMDLIEDGIEKGFLRPLPPIALIIIVYQPIEKLIKVMETGQLEYTEELVKELEESCWNAIRII
>NZ_CP009335.1|WP_001100949.1|3942486_3943644_-|GNAT-family-N-acetyltransferase
MNVIRLKEDKFREALRLSEYAFQYKVDEDRLQQQITKMKESHEVYGIMEGENLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTISMLHPFAVSFYRKYGWELCANLLVCHMTKSDLVMKKQVNGTVKRFNKESHPEEVEKLYETFAERFSGMLVRNEKWWLQAVYDDLTLAIYYDENQTAAGYMLYKIENYKMTVEEFVPLHNEARNGLWNFICQHDSMIKDLEMTVSENEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVILHITDSFAPWNNVSVRLANYEITIIEEPMDKGIKLDINALSTILFGYRRPLELNELELISGSEEEIRAFENVVPVRKPFIYDFF
>NZ_CP009335.1|WP_000664621.1|3943931_3945221_-|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGTTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDASIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLENVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>NZ_CP009335.1|WP_001228119.1|3945237_3946338_-|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEKYQTYETI
>NZ_CP009335.1|WP_001197260.1|3946330_3947431_-|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWVDHALYPDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTVKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>NZ_CP009335.1|WP_001269434.1|3947449_3948622_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEHGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>NZ_CP009335.1|WP_001273582.1|3948906_3949983_-|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMEELKGFKNKLS
>NZ_CP009335.1|WP_002036551.1|3950814_3954327_-|DUF4020-domain-containing-protein
MTFLGKGESSVWITSEVEIPDELIDHLEKGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKTKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAMKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKLSPLLWRTICSYLNETKMKMDPLLFARWTLLLLETAEKDSKSIATISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSTFSFVEQIWNEKMKPHISYYAVPIMMMGIEKMRMLSLRQAALKKRDKENVEKEFQQNDLAFLIQIVKECLAYFCENNEKKANYYITEMIEANSVLQNRIAIDAMNKNVFVSADEKMKWLLQEGILLDVTYKHEVFQLIKNHFALSLEKTKEEVIRIVLKDLAEERAFDVCFVLDLLFTCDSNSPSTAKGYELMKQKHPHFHSERYSVQKKEAAEQSITCNVTADGLLQLKDEEIMKQVQQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGMTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLAKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMIARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAKEQQKFWAAWLSIFLRERPKMGGITAREYVMLLRIILFMDEIVERGLLIICKSFSDVGGKGNQTELKQLFHEILEKTESIKMYKELYANVFFTLLQTLQEANLLKTEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVLENLQEEM
>NZ_CP009335.1|WP_000997708.1|3954477_3954915_+|YndM-family-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSSSRTRHHNDNIHINRRFAYGTEFAEEQNILDKDKKK
>NZ_CP009335.1|WP_000709765.1|3955063_3955594_-|cysteine-hydrolase
MKKALLVIDVQAGMYTAGMPVHNGEKFLETLQELIGECRSNDIPVIYVQHNGPKDHPLEKGTDGWKIHAAIAPLEGECVVEKTTPDSFHKTNLKEVLQDKGIDHVIISGMQTQYCVDTTTRRACSEGYKITLVSDAHSTFDTEVLRAEDIVKHHNVVFGAFADVVTLKDLKVTASK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009335_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009335_3

4507062-4507164

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP009335_3

>merge|NZ_CP009335|3|4507062-4507164|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NZ_CP009335|3|2|4507062-4507164|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009335.1\|WP_000646401.1\|4511513_4512512_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP009335.1\|WP_000164884.1\|4514011_4515478_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP009335.1\|WP_000915215.1\|4500331_4501465_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP009335.1\|WP_000129210.1\|4497600_4498392_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225073
NZ_CP009335.1\|WP_000933354.1\|4508561_4508735_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009335.1\|WP_000473535.1\|4495843_4497385_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_CP009335.1\|WP_000351706.1\|4503380_4504232_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP009335.1\|WP_000236542.1\|4504827_4505505_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP009335.1\|WP_144405368.1\|4512912_4513818_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP009335.1\|WP_000823210.1\|4515708_4516023_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009335.1\|WP_000239256.1\|4512622_4512943_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225511
NZ_CP009335.1\|WP_003298041.1\|4502062_4503295_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP009335.1\|WP_000571881.1\|4511150_4511495_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009335.1\|WP_000544596.1\|4504224_4504734_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP009335.1\|WP_000798800.1\|4501721_4501952_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009335.1\|WP_001094317.1\|4516227_4517325_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP009335.1\|WP_001226322.1\|4505554_4506499_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP009335.1\|WP_000137568.1\|4498508_4500296_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009335.1\|WP_000417237.1\|4507803_4508457_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009335.1\|WP_000445382.1\|4509063_4510683_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675

Protein	Function_ID	Function_description	E-value
NZ_CP009335.1\|WP_000646401.1\|4511513_4512512_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	6.65718e-152
NZ_CP009335.1\|WP_000164884.1\|4514011_4515478_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP009335.1\|WP_000915215.1\|4500331_4501465_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.16238e-58
NZ_CP009335.1\|WP_000129210.1\|4497600_4498392_+\|arylamine-N-acetyltransferase	gnl\|CDD\|225073	COG2162, NhoA, Arylamine N-acetyltransferase [Secondary metabolites biosynthesis, transport, and catabolism].	8.38034e-49
NZ_CP009335.1\|WP_000473535.1\|4495843_4497385_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_CP009335.1\|WP_000351706.1\|4503380_4504232_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50852e-87
NZ_CP009335.1\|WP_000236542.1\|4504827_4505505_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	9.53285e-19
NZ_CP009335.1\|WP_144405368.1\|4512912_4513818_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.70667e-53
NZ_CP009335.1\|WP_000239256.1\|4512622_4512943_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.98116e-09
NZ_CP009335.1\|WP_003298041.1\|4502062_4503295_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.12528e-94
NZ_CP009335.1\|WP_000571881.1\|4511150_4511495_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.46799e-14
NZ_CP009335.1\|WP_000544596.1\|4504224_4504734_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	1.96654e-76
NZ_CP009335.1\|WP_001094317.1\|4516227_4517325_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	1.21426e-06
NZ_CP009335.1\|WP_001226322.1\|4505554_4506499_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	3.4898e-148
NZ_CP009335.1\|WP_000137568.1\|4498508_4500296_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009335.1\|WP_000445382.1\|4509063_4510683_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	4.46068e-106

>NZ_CP009335.1|WP_001226322.1|4505554_4506499_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLKKIHSMNENIPLVQLLWYYPNENNEIVEWSSITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGDLIINESYMKMARQNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHTVLKEK
>NZ_CP009335.1|WP_000236542.1|4504827_4505505_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDVIFVFGDSHPGNWQAPLEAYRQGLGNQIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMEHGVPKDAIMFETNSLHSIANVMEAKKIFDFTKVNRLLFVCKSLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPEKEVHGLEEYVSYYYNLA
>NZ_CP009335.1|WP_000544596.1|4504224_4504734_+|DUF3916-domain-containing-protein
MHEKKIRGMKRKTNAMIKRIEEHTKMFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIKPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISICPTPQMLRFQEVIYDEDTIDEKEIWFIGELS
>NZ_CP009335.1|WP_000351706.1|4503380_4504232_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHDVSFNPLPNSFNKVPTTFITRNDIFRSAALQKFMEVTHNA
>NZ_CP009335.1|WP_003298041.1|4502062_4503295_-|MFS-transporter
MEEDGGIIVLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFIGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVQEEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRVALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMSIHTITSGVLYSVSALLGLFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYMYAWLCIVLLLSISAVSLYSKNKK
>NZ_CP009335.1|WP_000798800.1|4501721_4501952_+|hypothetical-protein
MKNTDKRNRLDDMMFHYRVTKNNIVLIEYYGKQIMILKGTAAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNEHQ
>NZ_CP009335.1|WP_000915215.1|4500331_4501465_-|serine-hydrolase
MLKKWLIVFFIFAVFSGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANVKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKRTFVILFSNVQNGMNDAFNQEFRKMANDLIEAKGA
>NZ_CP009335.1|WP_000137568.1|4498508_4500296_+|oligoendopeptidase-F
MTELKDRLQVADKEKWNLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSVDENTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTSNDGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIETTKKNIQSLHTYNKLRKEKLNVDELRQYDLSVDLVQGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NZ_CP009335.1|WP_000129210.1|4497600_4498392_+|arylamine-N-acetyltransferase
MTDFQKQFFARLNIEEKQKVSFEDLPNIMYAMAQTVPFENLNVLEKNFKEISKENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATILKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKANAAQKIIVEHDGSPFNKVPLIVKLTEDGHASLTKDSLTIAKNGKKTKEKVTDVQYKKLLHSKFGITL
>NZ_CP009335.1|WP_000473535.1|4495843_4497385_-|alpha-amylase
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDGNHWNRLRTDAENLARKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNIEVSGDYEINAWTGFNFPGRGDTYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHADVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
>NZ_CP009335.1|WP_000417237.1|4507803_4508457_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFLLYILTNYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>NZ_CP009335.1|WP_000933354.1|4508561_4508735_+|hypothetical-protein
MLNLIPSVTILAPIETPKPIQAPATVPIGPPKTVPTAAPSLAPAKALTAVVPTPIAA
>NZ_CP009335.1|WP_000445382.1|4509063_4510683_-|FAD-dependent-monooxygenase
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHLSTAIHPKAGGITFRTMELFRELGLEQKIRSAGKALENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARTLGGELSFYHELVSYEQNEQGVIATIRNRETEKESVIHCDYVIAADGAKSKIREQLGISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFTMILHPEVLGALIPVDNERRWIYHVSYDPLKGERPKDFTIERCKQIIKTAIGSTNVESEIVSVLPWEATESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIEGKAQPKLLETYHEERYPVAKLTTDYASSLLFHAANREEGSLNNMDGLAVTVGYQYCSEVIIDDSVTPHRMDSVELNGRPGTRAPHFFGTYDGKEISILDLLGDDFVLLTIAENRTWAECVQNVSSTLGINIKFYSVGLRGDFIAQEDIFSKLYGIENGGAVLIRPDGFIGWRSEKEVVNLDVVLEEVMGNLLCDF
>NZ_CP009335.1|WP_000571881.1|4511150_4511495_+|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>NZ_CP009335.1|WP_000646401.1|4511513_4512512_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVITKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMHLQKGQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFGKEFGSGFFKTFLFSLASKKLTALKKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>NZ_CP009335.1|WP_000239256.1|4512622_4512943_+|helix-turn-helix-domain-containing-protein
MVKKGTTFNTYSNEIKLSAVQSYLNGEGSYDMIAKKYQIRSSTQLKNWVKKYKERGEITDTRGENNKTKGIPNPLKGKRIHFKTVEEERDYYKAQVEYLKKQYPNL
>NZ_CP009335.1|WP_144405368.1|4512912_4513818_+|IS3-family-transposase
MFKKAVSKSVNGGVLKYKERYHIIELLKRKYPVIWLTNFAGVHRSSYYKWVHTKSMNNIRLESDKRLKKVIQSIHLKHKEYGYPRMKIALEEEGYFINHKKVYRLMSELNIQSIIRKKRRFFKGNYSNTFPNVLNREFKDRQQNEALVTDITYLRFQEGFRYLSVVQDIYNNEVVSWKISKRNDNELVLDTIEMLAQKRDVRGTILHSNQGFQYTSHAYNKRLFDLGIIGSHSRKGNCHDNACIESFFSHFKSEMLYLNHFKTEADLIQAIEEYIYFYNYKRFQKRLNHRAPIEYRISMAA
>NZ_CP009335.1|WP_000164884.1|4514011_4515478_+|YdiU-family-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYENNWFLGMKKKLGLFSNEEQDHSLIEQLLKMMEKYKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGNYSVMEKLLEALANPYAYSTDQEEYCVPPVPTNRPYRTFCGT
>NZ_CP009335.1|WP_000823210.1|4515708_4516023_+|hypothetical-protein
MKRKIGTTILGLSVLSFGFLNVNIGDGGVVKADHGRPPVSKQDSHADLPAPKQDSHADFPAPKQEGHADFPAPKQEGHADFPAPKQEGHADLPIPKFEDHGEHI
>NZ_CP009335.1|WP_001094317.1|4516227_4517325_+|tetratricopeptide-repeat-protein
MNTLLTGSTYATKHLEAWYHAILIQNVTEAQTCYHAATQEHKEILVKEDSLNSSYHLFFNLLKFRYAVFTDGLSITKGSFDAIDAITIPADLQLSYLYNYYKAIYFTALNKFEKAEDYFEKAKSSLASLSTVEQADFYYRYAVYHFQMQQPSQAIVYATKALEIFQTLNECERNITSCLSVLGGSYVAVGHYEKAEELYYTAIDILQKNNEESLLLHVRNNLGTLYANKNLSEQAIRQLSEVIEKMPKHYKALFLLAQENGKLGNIELANKYIKTGKEIVLQLNNEEYKHHFNILEAIINKFELEQLERVIQEGIDYFNEESLFSYTSDYCEKIATLYHKKELFEKASQYFYSSIEAKKKNERRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

655008 : 696796

Prochlorococcus_phage(12.5%)

coat,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000379269.1\|655008_655686_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003298570.1\|655783_656578_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000248599.1\|656630_656939_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|657145_657382_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_001125503.1\|657700_657916_+	hypothetical protein	NA	NA	NA	NA
WP_000581265.1\|657986_658988_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_000655323.1\|659108_659600_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.2e-41	54.4
WP_000351169.1\|659620_660100_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000683408.1\|660712_661294_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_000289900.1\|661327_661858_-	hypothetical protein	NA	NA	NA	NA
WP_000276467.1\|661973_662738_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_000503330.1\|662847_663480_-	transcriptional regulator	NA	NA	NA	NA
WP_000274012.1\|663551_663992_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000439090.1\|664139_665111_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_000392606.1\|665128_665395_+	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_001174599.1\|665767_666265_+	hypothetical protein	NA	NA	NA	NA
WP_000435941.1\|666310_666613_-	YutD family protein	NA	NA	NA	NA
WP_000744046.1\|666731_667307_+	lipoprotein	NA	NA	NA	NA
WP_001240995.1\|667344_668076_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002003767.1\|668161_668977_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_000264796.1\|668999_669473_-	hypothetical protein	NA	NA	NA	NA
WP_000721026.1\|669576_670131_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_000272731.1\|670205_670685_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000166375.1\|670705_671602_-	lipoyl synthase	NA	NA	NA	NA
WP_000944673.1\|671791_672775_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_042996026.1\|672811_673543_-	sporulation protein YunB	NA	NA	NA	NA
WP_000248463.1\|673597_673900_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_078384002.1\|673965_675357_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_001118827.1\|676198_677596_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_000009523.1\|677644_678076_-	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001020769.1\|678065_679286_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	5.2e-118	47.6
WP_000152181.1\|679285_680578_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_000929160.1\|680593_681379_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.3e-08	25.8
WP_000757009.1\|681618_682425_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000735109.1\|682446_683259_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000359553.1\|683282_683948_-	ABC transporter permease	NA	NA	NA	NA
WP_000601752.1\|683940_684966_-	methionine ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_000781216.1\|685497_685842_-	hypothetical protein	NA	NA	NA	NA
WP_000568167.1\|685996_686296_-	thioredoxin family protein	NA	NA	NA	NA
WP_000640869.1\|686308_686653_-	DNA primase	NA	NA	NA	NA
WP_000026899.1\|687146_687530_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000218967.1\|687571_687937_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.7e-21	48.6
WP_000494859.1\|688467_688707_-	DUF3937 family protein	NA	NA	NA	NA
WP_000920740.1\|689208_689598_-	hypothetical protein	NA	NA	NA	NA
WP_000171578.1\|689921_690113_-	hypothetical protein	NA	NA	NA	NA
WP_000525951.1\|690128_690359_-	hypothetical protein	NA	NA	NA	NA
WP_000826893.1\|690414_690942_-	hypothetical protein	NA	NA	NA	NA
WP_080775383.1\|691189_692743_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D5GVD8	Campylobacter_virus	1.0e-09	27.2
WP_131371309.1\|692720_693182_-\|transposase	IS607 family transposase	F9VHY9	Thermus_phage	5.7e-17	36.8
WP_157447971.1\|693130_693376_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000713756.1\|693613_694261_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000666170.1\|694316_695330_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_001002987.1\|696547_696796_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_2

1444701 : 1452650

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|1444701_1444986_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029999.1\|1445024_1446659_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000743900.1\|1447066_1448605_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.6e-21	31.2
WP_000833093.1\|1448989_1450315_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_000929883.1\|1450459_1451161_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_000719243.1\|1451144_1452650_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.2e-32	30.8

DBSCAN-SWA_3

1497665 : 1506042

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625683.1\|1497665_1498973_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
WP_001170542.1\|1499061_1499781_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278820.1\|1499773_1500028_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|1500024_1500708_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055577.1\|1500691_1502911_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000879029.1\|1502895_1504311_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_001262436.1\|1504417_1505458_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000088592.1\|1505454_1506042_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1

DBSCAN-SWA_4

2913047 : 2956918

Bacillus_phage(86.79%)

portal,integrase,protease,tail,terminase,head,holin,capsid

attL 2901706:2901721|attR 2962793:2962808

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2901706:2901721	attL	NA	NA	NA	NA
WP_000675866.1\|2913047_2914154_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	1.5e-143	79.1
WP_001091279.1\|2914744_2915089_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	1.5e-17	38.4
WP_000787655.1\|2915536_2916682_+	hypothetical protein	H0UST6	Bacillus_phage	5.3e-56	32.4
WP_000713534.1\|2916683_2916818_+	hypothetical protein	NA	NA	NA	NA
WP_000943157.1\|2916960_2917143_+	hypothetical protein	NA	NA	NA	NA
WP_001021263.1\|2917139_2917496_-	helix-turn-helix transcriptional regulator	A0A0P0IZG9	Lactobacillus_phage	4.5e-14	40.6
WP_000935435.1\|2917662_2917857_+	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	2.1e-05	43.5
WP_000522019.1\|2917974_2918241_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	7.0e-36	90.6
WP_000550146.1\|2918434_2918611_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	1.5e-23	87.9
WP_000190239.1\|2918615_2919407_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	1.6e-104	91.3
WP_042995975.1\|2919375_2920179_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	1.3e-144	98.5
WP_000337983.1\|2920193_2920388_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.3e-26	87.5
WP_000805172.1\|2920412_2920586_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	3.6e-25	96.5
WP_000811871.1\|2920600_2920855_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	5.5e-38	91.7
WP_000885282.1\|2920866_2921286_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	9.1e-14	40.7
WP_000866998.1\|2921301_2921784_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	2.0e-20	49.5
WP_000360007.1\|2921822_2922059_+	hypothetical protein	NA	NA	NA	NA
WP_000028140.1\|2922209_2922995_-	sulfotransferase family 2 domain-containing protein	A0A288WG17	Bacillus_phage	1.3e-141	92.0
WP_000137371.1\|2923142_2923385_+	hypothetical protein	A0A1B1P7A3	Bacillus_phage	4.9e-44	100.0
WP_000805073.1\|2923387_2923819_+	hypothetical protein	A0A1B1P7B4	Bacillus_phage	5.1e-76	94.3
WP_003297246.1\|2924670_2924931_+	DUF3947 family protein	NA	NA	NA	NA
WP_001199273.1\|2925214_2925784_-	cupin domain-containing protein	Q2I8C5	Bacillus_phage	1.1e-86	86.9
WP_001058285.1\|2926499_2927015_+	hypothetical protein	A0A1C8E9A7	Bacillus_phage	2.9e-30	45.8
WP_000572581.1\|2927029_2927314_+	hypothetical protein	NA	NA	NA	NA
WP_000645585.1\|2927930_2928053_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000166192.1\|2928368_2928851_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.9e-71	83.1
WP_001012162.1\|2928850_2929393_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	92.2
WP_003297254.1\|2929689_2930223_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003297255.1\|2930532_2930751_+	hypothetical protein	H0USV5	Bacillus_phage	2.0e-20	66.2
WP_001283620.1\|2931160_2931379_+	hypothetical protein	A0A1B1P7C1	Bacillus_phage	3.3e-07	38.5
WP_000389425.1\|2931419_2931773_+	hypothetical protein	NA	NA	NA	NA
WP_001097006.1\|2931765_2932020_+	hypothetical protein	A0A0S2MVC8	Bacillus_phage	8.0e-05	39.5
WP_000778961.1\|2932043_2932256_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	5.1e-29	95.7
WP_000376883.1\|2932391_2932583_+	hypothetical protein	Q3HKW9	Bacillus_phage	4.3e-19	76.2
WP_001198487.1\|2932602_2932857_+	hypothetical protein	H0USW0	Bacillus_phage	6.5e-39	89.3
WP_142286273.1\|2932877_2933246_+	hypothetical protein	Q2I8B8	Bacillus_phage	1.0e-29	76.2
WP_001139464.1\|2933251_2933629_+	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	2.6e-68	98.4
WP_000242929.1\|2933758_2934262_+\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	2.3e-88	100.0
WP_000621128.1\|2934263_2935958_+\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	0.0e+00	99.8
WP_000577482.1\|2936146_2937400_+\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	1.7e-236	97.4
WP_001259168.1\|2937386_2938097_+\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	7.0e-123	94.9
WP_000361131.1\|2938134_2939307_+\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	3.1e-200	91.3
WP_000244593.1\|2939327_2939615_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	2.9e-43	96.8
WP_001068020.1\|2939601_2939925_+\|head	phage head closure protein	A0A2H4J374	uncultured_Caudovirales_phage	1.8e-54	95.3
WP_000763225.1\|2939917_2940355_+	HK97 gp10 family phage protein	A0A288WGM7	Bacillus_phage	6.1e-77	99.3
WP_000609198.1\|2940351_2940711_+	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	1.6e-59	95.8
WP_000896772.1\|2940711_2941320_+\|tail	tail protein	A0A288WG55	Bacillus_phage	4.8e-104	99.0
WP_000779158.1\|2941368_2941686_+	hypothetical protein	A0A288WFU2	Bacillus_phage	3.2e-51	95.2
WP_000344052.1\|2941715_2941892_+	hypothetical protein	A0A288WFY6	Bacillus_phage	3.4e-15	100.0
WP_001262729.1\|2941906_2945758_+\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	94.8
WP_000517350.1\|2945772_2947263_+	hypothetical protein	Q2LIB8	Bacillus_phage	4.8e-291	98.4
WP_001260167.1\|2947259_2951330_+	hypothetical protein	A0A288WFW2	Bacillus_phage	0.0e+00	81.9
WP_000822835.1\|2951434_2952394_+\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	2.0e-173	95.3
WP_000373873.1\|2952409_2952835_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	4.8e-71	97.9
WP_000509866.1\|2952834_2953632_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	8.7e-114	72.1
WP_000277083.1\|2953688_2954180_-	hypothetical protein	Q3HL01	Bacillus_phage	1.2e-76	99.4
WP_001237238.1\|2954172_2954385_-	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	2.7e-30	100.0
WP_001267628.1\|2954568_2954871_+	hypothetical protein	Q2I8E3	Bacillus_phage	9.7e-50	97.0
WP_000170772.1\|2954873_2955056_+	hypothetical protein	A0A288WGN6	Bacillus_phage	1.4e-22	91.7
WP_000891436.1\|2955171_2956353_+	cell division protein FtsK	H0USY1	Bacillus_phage	4.6e-188	82.2
WP_001166987.1\|2956294_2956918_+	hypothetical protein	H0USY2	Bacillus_phage	5.6e-100	84.4
2962793:2962808	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3044205 : 3052931

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755551.1\|3044205_3045462_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.6e-11	31.5
WP_001194296.1\|3045560_3046325_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453764.1\|3046565_3048326_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-266	95.5
WP_002036191.1\|3048405_3049092_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-118	93.4
WP_001231491.1\|3049088_3050162_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	7.2e-172	88.8
WP_000823560.1\|3050186_3050774_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|3050969_3051689_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_002036196.1\|3051804_3051918_+	hypothetical protein	W8CYT3	Bacillus_phage	2.1e-05	91.7
WP_001258549.1\|3052058_3052931_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	6.0e-68	46.6

DBSCAN-SWA_6

4546532 : 4560570

Bacillus_phage(61.54%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000966324.1\|4546532_4547090_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	4.4e-40	50.7
WP_000570190.1\|4548436_4548676_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	2.2e-25	73.4
WP_000348873.1\|4548675_4548912_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	3.1e-11	80.8
WP_000185568.1\|4548990_4549287_-	hypothetical protein	NA	NA	NA	NA
WP_001051363.1\|4549670_4550633_-	M23 family metallopeptidase	A0A2D0WXW0	Clostridium_phage	4.4e-11	39.3
WP_000716766.1\|4552061_4553114_-	glycoside hydrolase family 25	A7KV11	Bacillus_phage	2.3e-66	47.9
WP_043326495.1\|4553246_4554131_-	M23 family metallopeptidase	A0A1D8EVX2	Mycobacterium_phage	2.1e-12	27.2
WP_043326498.1\|4554396_4555413_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	6.9e-31	37.4
WP_000460739.1\|4555651_4556038_-	hypothetical protein	A0A288WG73	Bacillus_phage	3.4e-47	69.8
WP_000510876.1\|4556138_4557071_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	5.6e-72	61.1
WP_000527104.1\|4557157_4557394_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	2.4e-11	56.9
WP_000579786.1\|4557531_4557960_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	2.1e-29	50.7
WP_000673786.1\|4557982_4558411_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.6e-34	55.1
WP_043326502.1\|4559374_4559695_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_144405369.1\|4559664_4560570_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.0e-26	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP009336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20839 : 82926

Bacillus_phage(33.33%)

integrase,transposase

attL 43866:43890|attR 69795:69819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000105000.1\|20839_21724_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_144405372.1\|22999_23482_+	hypothetical protein	NA	NA	NA	NA
WP_000873059.1\|23478_25356_+	hypothetical protein	NA	NA	NA	NA
WP_000757359.1\|25932_26796_-	hypothetical protein	NA	NA	NA	NA
WP_000071050.1\|27827_28571_+	hypothetical protein	NA	NA	NA	NA
WP_001003634.1\|30144_30384_+	hypothetical protein	NA	NA	NA	NA
WP_001125176.1\|30664_31165_-	hypothetical protein	NA	NA	NA	NA
WP_000466637.1\|31632_33837_-	hypothetical protein	NA	NA	NA	NA
WP_000428009.1\|34146_34566_-	hypothetical protein	NA	NA	NA	NA
WP_000754470.1\|34992_35382_+	(deoxy)nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_000775817.1\|36054_38631_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	8.4e-33	42.5
WP_001044034.1\|38623_39841_+	hypothetical protein	NA	NA	NA	NA
WP_000516683.1\|40263_40716_+	hypothetical protein	A0A1B2LRS6	Wolbachia_phage	6.0e-11	44.6
WP_000751721.1\|41338_41698_-	helix-turn-helix transcriptional regulator	A0A0A8WFJ2	Clostridium_phage	5.4e-15	50.6
WP_001079435.1\|41804_42377_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000651404.1\|42761_43571_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
43866:43890	attL	NA	NA	NA	NA
WP_001190858.1\|44562_44706_+	hypothetical protein	NA	NA	NA	NA
WP_000823827.1\|44843_45563_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000356910.1\|46846_47065_-	hypothetical protein	NA	NA	NA	NA
WP_080545802.1\|47321_47921_+	hypothetical protein	NA	NA	NA	NA
WP_000206852.1\|48082_48310_+	hypothetical protein	NA	NA	NA	NA
WP_003299460.1\|48398_48548_+	hypothetical protein	NA	NA	NA	NA
WP_000513570.1\|48804_50151_+	VWA domain-containing protein	NA	NA	NA	NA
WP_000520153.1\|50541_53838_+	VaFE repeat-containing surface-anchored protein	NA	NA	NA	NA
WP_000527371.1\|55155_56259_-	endospore germination permease	NA	NA	NA	NA
WP_000055697.1\|56260_57754_-	spore germination protein	NA	NA	NA	NA
WP_000410157.1\|58002_58710_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	1.6e-42	43.0
WP_001037567.1\|59150_60134_+	glycerophosphoryl diester phosphodiesterase	NA	NA	NA	NA
WP_144405374.1\|61950_62226_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0P0I4A4	Acinetobacter_phage	1.3e-08	35.3
WP_144405373.1\|62182_62314_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_000520212.1\|63283_64993_-	hypothetical protein	NA	NA	NA	NA
WP_000368536.1\|65975_67652_+	hypothetical protein	NA	NA	NA	NA
WP_043327243.1\|68437_69409_+	hypothetical protein	NA	NA	NA	NA
WP_003299058.1\|70840_72001_+	hypothetical protein	NA	NA	NA	NA
69795:69819	attR	NA	NA	NA	NA
WP_003299056.1\|72120_73224_+	hypothetical protein	NA	NA	NA	NA
WP_003299054.1\|73249_74446_+	hypothetical protein	NA	NA	NA	NA
WP_000157816.1\|74497_75355_+	hypothetical protein	NA	NA	NA	NA
WP_000586196.1\|75431_76553_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.9e-167	79.4
WP_000893562.1\|77624_77999_-	helix-turn-helix domain-containing protein	A0A1B1P7A0	Bacillus_phage	2.8e-06	33.8
WP_000722288.1\|78183_79188_+	asparaginase	NA	NA	NA	NA
WP_000362584.1\|79616_81110_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.2e-79	40.0
WP_085962085.1\|81571_82926_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-127	84.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP009334

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009334_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009334_1

201751-201888

Orphan

Consensus_repeat	Method
CTTCTTGCTTTTGAACAGGTTTAG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009334_1

>merge|NZ_CP009334|1|201751-201888|CRISPRCasFinder
CTTCTTGCTTTTGAACAGGTTTAGGTTGAGACTTCGCTTGTTGTGTTTGAGCAACTTCTTGCTTTTGTACAGGTTTAGACTCTTCTTTAGGCTGTTCTGTTGGTTTAGGTGCTTCTACTTTCTTTTCAGTAGGTTGAG

>NZ_CP009334|1|1|201751-201888|CRISPRCasFinder
CTTCTTGCTTTTGAACAGGTTTAG	GTTGAGACTTCGCTTGTTGTGTTTGAGCAA
CTTCTTGCTTTTGTACAGGTTTAG	ACTCTTCTTTAGGCTGTTCTGTTGGTTTAGGTGCTT
CTACTTTCTTTTCAGTAGGTTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009334.1\|WP_003298828.1\|195781_196039_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000732164.1\|227738_229007_-\|L,D-transpeptidase-family-protein	unknown	unknown	gnl\|CDD\|226309
NZ_CP009334.1\|WP_003254758.1\|198285_199026_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000442156.1\|216710_217421_-\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP009334.1\|WP_001246921.1\|199133_199745_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000058018.1\|216109_216691_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000843774.1\|197849_198266_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000553982.1\|215613_216030_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000444162.1\|230640_231051_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000957118.1\|199822_200221_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000204760.1\|197085_197445_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_003254777.1\|229216_230404_-\|potassium-transporter-TrkH	unknown	unknown	gnl\|CDD\|214682
NZ_CP009334.1\|WP_003254767.1\|214302_215361_-\|DUF5011-domain-containing-protein	unknown	unknown	gnl\|CDD\|374521
NZ_CP009334.1\|WP_003299120.1\|219416_227099_-\|VaFE-repeat-containing-surface-anchored-protein	unknown	unknown	gnl\|CDD\|227268
NZ_CP009334.1\|WP_000258289.1\|217581_218994_-\|GW-domain-containing-glycosaminoglycan-binding-protein	unknown	unknown	gnl\|CDD\|227323
NZ_CP009334.1\|WP_001007096.1\|197463_197844_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000961607.1\|196363_197074_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000218244.1\|195437_195761_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009334.1\|WP_000924700.1\|200387_201236_-\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198393
NZ_CP009334.1\|WP_000810633.1\|203143_213724_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|275067

Protein	Function_ID	Function_description	E-value
NZ_CP009334.1\|WP_003254777.1\|229216_230404_-\|potassium-transporter-TrkH	gnl\|CDD\|214682	smart00475, 53EXOc, 5'-3' exonuclease.	3.79747e-21
NZ_CP009334.1\|WP_003254767.1\|214302_215361_-\|DUF5011-domain-containing-protein	gnl\|CDD\|374521	pfam16403, DUF5011, Domain of unknown function (DUF5011). This small family of proteins is functionally uncharacterized. This family is found in Bacteroides, Prevotella, and Parabateroides. Proteins in this family are around 230 amino acids in length.	1.91661e-09
NZ_CP009334.1\|WP_000442156.1\|216710_217421_-\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	6.7124e-55
NZ_CP009334.1\|WP_003299120.1\|219416_227099_-\|VaFE-repeat-containing-surface-anchored-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	4.64929e-59
NZ_CP009334.1\|WP_000258289.1\|217581_218994_-\|GW-domain-containing-glycosaminoglycan-binding-protein	gnl\|CDD\|227323	COG4990, COG4990, Uncharacterized protein conserved in bacteria [Function unknown].	8.3381e-42
NZ_CP009334.1\|WP_000732164.1\|227738_229007_-\|L,D-transpeptidase-family-protein	gnl\|CDD\|226309	COG3786, COG3786, Uncharacterized protein conserved in bacteria [Function unknown].	5.40714e-36
NZ_CP009334.1\|WP_000924700.1\|200387_201236_-\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198393	cd10446, GIY-YIG_unchar_1, GIY-YIG domain of uncharacterized hypothetical protein found in bacteria. The family includes a group of uncharacterized bacterial hypothetical proteins with a GIY-YIG domain that shows statistically significant similarity to the N-terminal catalytic domains of GIY-YIG family of intron-encoded homing endonuclease I-TevI and catalytic GIY-YIG domain of nucleotide excision repair endonuclease UvrC.	1.71269e-53
NZ_CP009334.1\|WP_000810633.1\|203143_213724_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|275067	TIGR04226, Fimbrial_subunit_type_2, fimbrial isopeptide formation D2 domain. The Streptococcus Pneumoniae pilus backbone protein, RrgB, has three tandem domains with Lys-to-Asn isopeptide bonds, but these three regions are extremely divergent in sequence. This model represents the homology domain family of the D2 domain. It occurs just once in many surface proteins but up to twenty times in some pilin subunit proteins. Three of every four members have the typical Gram-positive C-terminal motif, LPXTG, although in many cases this motif may be involved in pilin subunit cross-linking rather than cell wall attachment. Proteins with this domain include fimbrial proteins with lectin-like adhesion functions, and the majority of characterized members are involved in surface adhesion to host structures.	5.57425e-22

>NZ_CP009334.1|WP_000924700.1|200387_201236_-|GIY-YIG-nuclease-family-protein
MLLKDMLQVCGLDLTKRIKVARHVDKDIDVQELYEKDNFELYQSYQGKNSFNCDYIVSFLGLENSQAVFIGVYEVKNPTEVTGLPQSIDTTEELRKRLSKAKWQYTLEKVDGFETLENRVIVQWEGVATSWCRYLNTFDLEVLQMLPKGETRKFTGYLDFILKRWELESIVNNPLKYKSWHESLSIVAGVYLIVDTKTGKQYVGSAYNTEGIWGRWKTYVNNGHGGNKLLMEILKQDPDRVNDFTYTILQVLPNTYKDTEVFKVESLYKRKLGSRAFGLNSN
>NZ_CP009334.1|WP_000957118.1|199822_200221_-|hypothetical-protein
MLTNEYLDDLFEGIKIEGEDYFYYFYVYQIPKEGVLLVNGIIPVGDIEHIIVCFTNKRLLFLEITMMGKYTGNMKSIDLIEFEHIKVKRGMIRTSIVLTSKNGKGNTVIKANSFTFGLSNQKKNLIALEKLY
>NZ_CP009334.1|WP_001246921.1|199133_199745_-|hypothetical-protein
MRNYEKVSLETWVNQLNSLVEYEIKETQVHVEENNFEPFSRGNIGRSTVHDLEELEGILAGVVVEGDMLTIKLLDGKQSSYDLNYVTSIMRRTDSPCFYLYFGRVETHVEITIKVDRLGVPIKSTSSINKNISKDINIPVKEFINNKELVKSVNNGNNSEGYIVLKDVELRLPINALNGIRETEDGCLLSFHVAQTLDIKVDK
>NZ_CP009334.1|WP_003254758.1|198285_199026_-|hypothetical-protein
MEVVKMGEIKLAEDIKGEVISFKNFVSELKEKENKHIVVHKLIADLDKELYTDGELLHVKEGRGGSFTLIVDEEQAPSERTYFSFLVKEIRKNKTKYYMIFKQGYVLEFSFKKSGSPCIKREVKVATKPTSNKEASELRHTLNNLGFTETRSFKTFSNFLLKSKESGYTDILTINPKGKKVEGLLDSVTIIDGGILVHVYQLGKGLSAVKFLEQDTILVSEVKMEDLVYFMVYGKSIVSPVIVKTK
>NZ_CP009334.1|WP_000843774.1|197849_198266_-|hypothetical-protein
MKSVKVNSNCSVIIEQHLVESLLRKANLKEGEEVFTIQFNQDYKYILLGYIKQDLYIFLMTNKRMLLHKVNETTGHLMGGLITLDEKKVLIGNMETGVISLPFKEKKHQTFISYLVGVSEDYKSNLFRYRERFKWVKE
>NZ_CP009334.1|WP_001007096.1|197463_197844_-|hypothetical-protein
MNEWMREEVLKTVEDYVKGSGVQDYFFVSGKKFLHELLECGKYPYRLTALWEGYTYTGKVNEIVKEEEKGTITINLDVTEEGKEKSMVLEEIHTKHAIMQRTVDSVHFTLFYKDSLVPLHFVYLKK
>NZ_CP009334.1|WP_000204760.1|197085_197445_-|hypothetical-protein
MTSTLSTKRKQVLISNVGKSKVIPFNKLFYHMFKRIETGATISTFQDGLVVRGKFVSLTNLIHKNEIELILELPNSREVELYFKANDIEEVVHGFGSNYNSYTLFTSREVVPIIISNIE
>NZ_CP009334.1|WP_000961607.1|196363_197074_-|hypothetical-protein
MLVTEERTARGIKDLKGSKITFQELVAKLKSYEGCLVELTRVRDVGLHPVIVRSIETCQINQVDVQEDAWFKLHLENEQDHYYYFKSSIECILQNGTTYYIIQTNNTYFEFKVKEEVCHSKRLKNYIDGMRNSLGVFRFTDTLTYDDFLEFLDNFEDYNYTKVSVLDGNGNHVTGQIDEVITSRARVGFCIILDNGEHTTIDFERENIVSIVDIKNSRNKYFMIYELDSITPLILE
>NZ_CP009334.1|WP_003298828.1|195781_196039_-|hypothetical-protein
MYPMRNYQEAMAFINYKFQQYHANDVSMLINFLESQATSLQYQVNQLLTHYQPNYNLIERNRTYIDILGVDVDKLKQARAIINQY
>NZ_CP009334.1|WP_000218244.1|195437_195761_-|hypothetical-protein
MTVQYDYKAMIQANKDFDVSTLENARHYVQQLSQGRSYTSVKDLLAGIDWLHTQAHHNIARYDGEATPQQLEHMKDVKQLYYVQKQKLSEVFKTYKNYGFDPSQVLF
>NZ_CP009334.1|WP_000810633.1|203143_213724_-|isopeptide-forming-domain-containing-fimbrial-protein
MKQKKYLSAVMATVIAFTTFMQPVVAGAETITGDKAKSEVKVEQEKAVQEPTVSPDVQTSEMDKKEVTNDKTPKSTTEEQERNKGQPVDEKKTVVEPKVSTTNANPTGVALTDEQKKEQAQLASTDEVKLSQNYVETDDNGDPLRLIEAGKDYTYEVNLDVSGNVTLLSDYVVKVEVEKKYLRDWGEPLHISKPELASEVTYADEGDKKVAYIKFPQLAGGTTLSFPVQLIVEAGLTPDMYEMKPMASLMDSKLNLVKKANEISYKVTYKKPGSQKYVNGQKENGSMVWAGIDDGKGVIKEGTEVPVEFSFSTDLEFLDNYRYFKAIEVVDTLPQGAKFDPKANPDWKLSADGKSVSTTVSLNEEIGMSTNGTLANKLSKLKLSLTFPNGKVNGTYTNNVTKTYIPEKAESYEPKVESKASIDFVLDAKPVGFVFTKKRSEDATIKDSLHYKGLDYTYRIEFKNPNSMPLHNVVIDDYKRKDGTYALDKRMEFTKVQTLNGEGEKVIAYIEEDGKVTEKQITKDGKYYNFPKGTKGYRYEVAKLDGAKFFQFLAYVKISNPKDVKYDTKDASKNLFENEASFKGEIQNPTDGKVIYKAEGTDKDDIPLVEFKESISLRKEITNSRDKVLKGGELHNRLFIHGADSNLDAETVIKGGKIIDLLPKGMTVVKSSVSRQGEVIPNYKNSGQTAIVWTFEDMKAGDFAPYTSKEYPQVGFTAIANDLSEEGTNINQAYLVFDDMENMGIEYKKDAQDKFDFNENSKTDDKVVYSEDYYVYVPNKEVVLTKSVQNEELAKNKVWSTDGVFVKYGEKANYKLNIKNHLDVDVPQVTVYDVLPFKGDRAIVPNDGGEYLSRESMYSNTLTGAINAPQGFTVYYTTDKVLDNASDSMTKLNWSKTLTDYSKATGIKIVMDNGKVLKSKESVDFEFGAIVPKTGLKAEDKAYNSAAVSVNGGTSFVEGNKVYTQMDIPEYPTITKDVEGKEHHDVDKGRTYQYNVKVKIPKNIKGYETLTIKDKLDRRLTYKYATLYKGYDVYNDAKVKVDGQELQVNLTKQDIENLQGKELNLKINAYINYDAPYELIENKADLQLNNESAIESNIVTVKPNPRKAKVTIAKVSGEGLNSFESVTKKLFGTTVKEVTEGNMVINPLDVLKANEEPKLLSGATFEILDSSKNVIHTVSTDYTGTVDIRDLDMGDYFIRETVAPKGYVLDSTEYPFTVKDTGTPSLEFKYSFYNKVDPIEPKLEKNILEHMTDGTVNRVSHKDVFRGEKYKYEVGTTIENLEGYKTIKLSDSLDARLDVHSAKLVVNSKDIQDVKPTIKGQDVSIVLTKEQLESFGMNKDGKLRIDLVIESSVKEGTNNEVIPNKGTLSLNDKPAVESNEVTVKPKDVTAKLVVVKTSGEKEHTFGQLADGQEPGKDLVKLAGAKFEVSNADRSKVETVVSNDNGLVELDNLPLGKYFIKEVEAPKGYKLDTNEYPFELKELKGTFHPVYEFTFYDVVDPETPQIVKDVNGKTHLETEYDKAFDYNVTTTIPKDLSGYEKVVMADSLDKRLDIKGVKVLVDGQESSYKATVKGQDVTLTLDRTELNKLANKQVRLQIEASIKYGTPAEIIDNKATITVNDKPSVDSNNVTVVPFLPLDPTIKKDVKGVEHLRVERERTYNYNVKSKIVDDVRGYKSLTVSDKLDKRLDVVDAKILVDGVESSYKATKSGQNVEVTFTREQLETLKGKEVNLQIQFKVKESTLAEEVPNMATITRNGDFNLDSNVVTVVPVDPETPKVVKDVNDVAHIDVVKGDEFTYHVKTTIPEDLLSYKSLTLADTLDKRLTINGSDVKIGGKAVKGIETKVDGQNVKFVLDRKQLEDYKGQEVVISIRAKVKYDAPIEIVNNKATIQVNDKPSVDSNNVTVKPENRKATLYLYKLSGEQSNTFGPALVEKGARKTSTTNPLLDSLKETEKNSVVNPLSSLTQSKHQPVPLEGGVFQILDASKNVVGTITSDSIGTAYIENLDLGNYFIKEVQAPKGYQLDSKEHPFTIVENGSKQLAFEYIFHDVKDPETPVITKDVEGKKHLEVEKGKEYKYNVKTTIPENVEGYESLTITDTLDNRLDLVNAKVYVDGRISTHVANIKGQTVTLNLTRVQLDQIEGKEVKIQITSKIKEDVAIETIENKANIQVNNKPSVDSNVVTVVPPTPENPNIKKDVEGLDHIVVEEGDNYNYNVKTVIAKNVKGYKTLTIKDELDNRLEVVNAKVLVDGKVSTLKADFKGNKVKLELTRSQLDSLQGKEVNLQITSKIKEGTGIVLIPNKATIELNDNPSIESNEVTVIPPTPDEPNIVKDVNGEKHAVVEHEENFNYNVKSVIPKDTKGYKTLTLKDTLDNRLDIVSTKVLVDGKPSTFKAVVEGQEVKLIVERSQLKTIEGKTLNLQITAKIKEGTPIETINNKATVQLNDKPEVDSNVVTVVPPTPIDPNIKKDVEGKEELVVEHKNEYNYNVKTKVADSVAGYKSLTIADTLDDRLDFVKSTVYVDGKASSFKAKVTGQNVVLELTRKQLDGLEGKELNLQITSKIKEGTPIEKIPNKATIQLNDKPSIDSNVVNVVPPTPIQPNIEKDVEGLQHLIIDTEKEFDYNVKSVIPKSVAGYKHITISDTLDKRLDLVDAKVQVNGKDTDFKVVKEGQKVTVKVDRKDLNGLEGKELNLVITAKIKDGTPIELIDNKANIQLNDQPLVESNEVTVIPPTPVQPDIYKNVEGTDRLEIEKEKEYNYTVKSVVPFNVMGYKHLTIEDMLDNRLDIVGVKVLVDDKESKYEAKVEGQHISLKLDRKELDTLLGKEVQLVITSKIKDSAPIEVIDNKATVQLNDEPKIDSNTVTVVPPTPVVPNIHKDVEGQEHIQVELEKEYKYNVKSVIPSKIDGYKTLTIADTLDKRLDVVEVNVFVDGKASKLVAERKGQDVKLVLDRKQLDDLKGKEVNVQITSKIKDGTPVEKIPNGASIQMNNLDAIQSNVVTVVPPTPVDPNIVKDIEGKQHLEVERGKVFNYNVKTKIADKVDGYKTLTIADKLDKRLGVVSATVLVDGKVSDLKAVVKGQDVTLTLDRKQLDKLMGAEVNVQIKALVLGDTKAENVPNKATIKLNDKPSIDSNVVTVIPPNPITPNIVKDVEGKEHLEIEQGKDYNYNVKTKIADSVAEYKYLTISDTLDKRLDIVKTTVLVDGVASELEANVKGQTVTLKLGRKQLDELVGKEVNVQITAQIKEGTEVNLIDNKATIQLNDNDAIESNVVTVIPPMPPVNPKVTKDVEGMNHIVIETGKEYDYNVKTTVANKLEGYKSLTIKDILDSRLTVVGAKVLVDGKETNFKVNIDNQEVTVKLTREQLETIKGKEINLVITSKINKGVAIENIENKATIQLNNRDLVESNTVTVIPPKPEEPVTPIPPKPEPPVTPEPPVKPEPPVKPEPPVKPEPPVKPEPVKPEPPKPVKPVKPEPPKPNKVEKPVPPKKPDRYLPRTGNAGDFGYTSYILFGSVIAIIVAVVYFTRRRKA
>NZ_CP009334.1|WP_003254767.1|214302_215361_-|DUF5011-domain-containing-protein
MLNKKLGIALGITAVLGLGIFGYKVYAKAPEIKTNEITIDYGKKLGTDKIETSTDVVKKQYKSATDTNKLGKQTIKVEVENDKGVTTEKEITLNVVDKEKPVIKTTQDKFVTKKGHSINLKQFVTAKDNVDGDLTNKILIQRFDYSKVGDIKVSMGVADSSDNFAEKTVIVSVVDEMPEVLTVPESRIVRTGDAFKPIDGVEAKDYNGKDLTSKININGNVDTSKAGEYSLTYQVTDSQGIFHQKSGLVVVKDEVVEKALRDEQKYKEENSVGDFVRPDKPETAKLLEDIADAKRKEGKKSIKDRAYDTVDKEKAAQTEKEIKDKVNDTTDSIKKEYDEHVKEHRKELGIDE
>NZ_CP009334.1|WP_000553982.1|215613_216030_-|hypothetical-protein
MHQLDFENKLADISKGRIVIEDSQIEHRDKEEDNIYKANWKGFEIYAKMGKNDWVENSYSVSTNRNVFEDKTLYENYHKLMESLIRIMDSKLTLEEIDKLIAKGVDENESPNTYDFGYERYVGKDKGNQIRFTITDRK
>NZ_CP009334.1|WP_000058018.1|216109_216691_-|hypothetical-protein
MSLQERIKAYRIPIVGVLLLLVVWFIFFRGSGSSGILTQQEFEDKLKEMSNGKIVISDSKIKMYESEDGGVYSANWNGFMLSSRVDKDKKLDRTFSIITKQAGYMDEISIGQYHDLVVYLTRLSNEKMSVDEANVLVDTGLNFNQQITTGEQHETSKGDLYYRLSGGKKDINFFSFLIMDEDGHKRVINPNKK
>NZ_CP009334.1|WP_000442156.1|216710_217421_-|class-A-sortase
MERRLKIRYGLIAGIIALGVGGYYVVDSMLQTDMRGIELDKNTIDENKKAKADFDLDSIKPLSEQELLENSLKRSTGWGKDLHYGNQGVVGGIYVPSVDIKLPISKGIGNNSLSRGVGTGFEDREMGKGNYVLLGHNSPNKHVLFSPLEDMKTGDIIYVTDATWMYEYETTDKKRIHQSQGEVMDNTTEDIITLITCFGGLNTDKRTVVTGKLKHKYPVSGAEKEIKTALNIKEDN
>NZ_CP009334.1|WP_000258289.1|217581_218994_-|GW-domain-containing-glycosaminoglycan-binding-protein
MVTMKKLIKTGKSAIVGTVGVGVLLSTSHSISADTLKPVDEKVQESQLERLSQEEDKKLDVQVPDLNKEKQENEEGVEKPQTENQEVKDEKVVEDGNKEKKPEVKNEEKPVVNEEEKPKTDSLQVVDEEKKEEPQVEEEEIYVVYKKVNSTQIIEKSNNESIWSKPHMLKGAENLGSVDEYVGKEVQMSEMALANRKAWFKISVEGKELGWVSSSVMSVATDLESINKAVGTEGTDDKYSIYSLPKGMQNSQEVAKVNDYANQELKATKQTVYNGTMWYKVSQNGNEIGWLDSRSVSERTVLPHMNVPIESQLDAKDPSRNLETGCEITAVSMMLQFAGANVDKVLLAKEMPYHDYDPNKGYVGDPWSDGPINTVYPPALLDLVKKYAGSSVNLTGVSLDKIKEKLNQNHPVVAWVGDMHGFGIHAITLTGYTNDKVFYNDPWTGEKDASMSWDSFDSKWTPKKSRALSY
>NZ_CP009334.1|WP_003299120.1|219416_227099_-|VaFE-repeat-containing-surface-anchored-protein
MYMLDAFKRGKVSKVMFSVLSLLMLTISTLISPIFAHADDGEPNVVQRASGNWTQMWHEKYNNKGWVYDAGQKYSIETDVIRFGDNSIAYCLEMMLESPNGHSLEEKTRLSDEYYKIMNNGYPVKTPEQLGANSWQEAHYATQVAVWIVNQDVKYSNLTFKNANVKQVVDKILADANNSSDTQDLSFSITPDHIKAEMTPWSTEYRQAGPFTIKTNGNGTFKPEAINAPGKVTFVDSMGNPKTELNSWEPFFAQINSNTPTGSFNIKVTGDMTKTETVWYKSHSGGIQHTTALVTLHKTPTAQNASISWDSNGGFKIKKVDDAGNPLGGAKFDVINWGNQVVRSLTTDSNGMASTDGLWFEDYTVKETQAPDGYELDNTPQKVTVDSKDKTLTFVNRKSKGGFRIHKVDDSNKPLQGVVFTIYGNDGLKMFDRTTDANGIIQLGDLPYGEYHFKESKGLDGYEFDDDVKHITINADSQNKEYKVVNKLISGSIKITKTDEENRPLKGVQFLVYNQNGDVVGEAYTNEQGIATMGNLPYGTYAWLENKGLDGYEAEKKTGSFVVGKDQKDHAVTVINKRMKGGLEIYKIDDSHQPLQGVEFTIYKDGKEFKKVTTGKDGKIKLPDLEFGKYSVKETKGLEGYVTDFKEESFELSSQNRSKSMVVVNKKIKGSLEITKTDDASKPLAGVQFTIYKDGKEYEQITTDANGKIVLNDLPMGKYTFKETRGLEGYVVSTKEEAFEIKNLGDSKKFTVVNKAIKGSIEITKTDDASKPLKGVEFTVYKDGKEYTKVTTNDKGIAEVKDLPYGSYTFKETKGIEGYVPDSTTKGVDIKEDGKTHKYTVINKKIKGNLEITKTDDAKKPLKGVEFTVYDAKDKEVAKVVTDDKGKASVKDLPYGKYYFKETKGLEGYVFSKEKVEFEIKNLNETKSYNVVNKLIRSNIEITKVDNEGKLLEGVEFTIYDSNDKEVAKVVTDAQGKAKYENLPYGKYYFKETKNLEGYVKNGTKYDIDVKQDMQTLKYDVINKKIRGSVEVLKVDADKKEKPLQGVEFTLFDQNNKVVGKPKLTDKDGKVSFDKLAFGKYYIKETKTIKGYNINNEKFPVDIDTDGKVVKHTVTNKVIRGNVELLKVDTENKNVTLKGAEFELRGSNDEVLGKYKTDANGKLVIKDLVFGDYKLIETIAPTGFNLEQTPISFSISEEGKTIGLTKENLKIYGNMEVTKVDAEDNKKVLANAKFEVYNEKGDKVVEGTTDAKGKAKFEHLPYGKYTFKEVVAPEGYLVNPTVFNFDILENGKTVSHKVTDQIIKGDLEVKKVDMADKKGLSDAKFEVFNAEGKKVAEGKTNKDGYAKFEKLPYGKYTFKETVAPKGYFLNETVFNFEIKEDGKIIAQVVENEKVPSIKTTATEKHDGAKEMHTSKEVTITDKVEYKDLLIGKEYTVKGKLMDKETKKPLLVGGKEVTAEATFTPDKATGSINLDFTFDATGLEEKEVVVFEDLIKEGKTLTTHSDLEDKDQTVKFVKPSVSTTATDKADGTKELHAIKDVTIIDVVEYKNLVVGKNYTLKGKLMDKATKQPLVIDGKEVVAEKNFSPREKDGKVPLEFKIDASTLEGKQVVVFEDVVHNNFVIATHADIEDKGQTVDFVKPEVKTTATNKADKEKEIHAIKNITVQDKVDYKNLVVGKEYTVKGKLMVKETNKPLVIEGKEVTAEKTFKPTAKNGSVTLDFTFDASKLEGKELVVFEDVVFNKTTIATHSDIEDKDQTVRVVKPEVHTTATNKADEGKEIHAQEKVTIQDKVAYKDLVKGKEYTVKGKLMDKATNKPFKVDGKEVTAESKFTAKEKDGVVTVDFTFNAEKLQGKSLVVFEDLYYEKELIATHSDIKDEGQTVRIVKPEVKTTATNKADEGKEIHADQTVTIQDKVEYKDLIIGKEYTVKGKLMDKATNKPLLVNDKEVTAESKFKAEAKDGSIILDFTFDAKALQGKEVVVFEDLYNEKLLVATHSEIEDKDQTVKFVKPEVKTTATNKADELKEVHSNREITLKDVVEYKDLIVGKEYTVKGKLIDKGTEKPFLVNDKEVTSEAKFIAEAKDGSITLDFTFEAKDVEGKDIVVFEDLYQDSLLVATHSDIEDKGQTVNFVKPEVKTTATNKEDGLKNIHSNKTVTIQDKVEYKDLIVGKEYVVKGKLMDKATNEPFLVDGKEVTSETKFTAEDKNGSVILDFTFEAKGVEGKEVVVFEDLYNEDILIATHSDIEDKDQTVEFVKPEVGTKATNKADGGKELHTNKSVTIQDTVDYKGLIVDKEYVVKGKLMDKETNKPLLVNDKEVTAEAKFTAKKETGSVTLDFTFDATGLEGKEVVVFEDLYQDNVLVATHSDITDEGQTVKFVKPEVKTTATNKENGSKELDANKSVTVTDKVEYHDLIVGKEYVVKGKLMDKATNKPLIINGIEVTSETKFTAKEKNGSVNLDFTFDATELQGKELVVFEDLYQDNVLVATHSDINDVNQTVKVKVKPVQPKPEQPKPEQPKPQKKPVPQTGSDSNFGTTMSILMGIIALALGGVFVFTRKNKAE
>NZ_CP009334.1|WP_000732164.1|227738_229007_-|L,D-transpeptidase-family-protein
MKKLDVETLKKHKKKLIVAGIGVAVLTSAGFGGNYYVQAKETEKQEIQQKEAKKKEVAKQEAEKKKQDELKAKLAKEEADKKAEEERVKAEEQKKAEEEKAKAEEQAKQEAERVKQEEEKKVEEQKKAEEGKQEEQVNGNQEGKKQGNSQENKQSKTQGNEQTQGIKGVAKKAEEPQQGSQENPQAKQGGEQAKQQTNNQEQPKQVSQQPTNKGGNQQANVQQEQGTAMTRAVSNSSVGKRTDQIVAVVAQGSSAKVTYLEKHNGNWKEVFTTNGFVGSQGVGQANESVSRTPRGAHSLGFAFGTSNPGTNLPFRQITPKSYWISNVNDDQYNTWQERDSSSPQDEHLIKETVAYKYGIVINYNTSNPVKGGGSGFFLHVSNGRPTAGCVSVPQAKMVELMQKLHGGAYIVNVNSINEISNY
>NZ_CP009334.1|WP_003254777.1|229216_230404_-|potassium-transporter-TrkH
MKDEMLDLIGENADRRRVIIIDFNHLAWRYAFSNAKGLSINRLVNGVSTIIDTTVPSYAIKQIVRWSNFGVNPTIVCLDAPVKSRKAYFSNILNKDKKELIPSDYKGDRKTPNGDFIQQIEIAGALMQQGGIYVYRKENYEADDIIHACVQKAKKDFPYLPIDVITGDADMIPLVDEQVSVYMKSKVHTYANEYSPTIKGYVQYTPESYQTYVQELSKYKTSSTQILVPYNTLLLAKILRGDSSDGLKGKPDWKPRMYNQLIEQLIRYEEPIHEIFRYGTWTSEIIDRRTKEVVTDWSSWTPEERKHLFQNYKEPKELKMIEDVLSRHVDDEDIEFIRERYIGMLLNGAFLPNIHVPDEFKRRPYEIEDKKPFTGFDITKLQEAVNVLEIRLPMG
>NZ_CP009334.1|WP_000444162.1|230640_231051_-|hypothetical-protein
MESKLFKTEKTERGTRVFLKDPLLHNMLPKRVFFFLERPVWSIFSIPFTIPFLPVRVSFGLSTNEFSRVLDKYCENLEELSNIQVVDPKTSILPYPSLGVYKVNMVEGVMFDFKSDKDMKSLLCKMDKAVERFRRT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	267578-267607	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	162869-162898	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	71082-71111	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	289404-289433	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	56805-56834	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	289405-289434	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	201775-201804	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	289017-289046	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	267632-267667	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	162809-162844	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	71022-71057	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	289344-289379	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	56745-56780	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	289345-289380	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	201829-201864	0	1.0
NZ_CP009334_1	1.2\|201829\|36\|NZ_CP009334\|CRISPRCasFinder	201829-201864	36	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	288957-288992	0	1.0
NZ_CP009334_1	1.1\|201775\|30\|NZ_CP009334\|CRISPRCasFinder	201775-201804	30	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	39281-39310	5	0.833

1. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

2. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

3. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

4. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

5. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

6. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

7. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

8. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gttgagacttcgcttgttgtgtttgagcaa	CRISPR spacer
gttgagacttcgcttgttgtgtttgagcaa	Protospacer
******************************

9. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

10. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

11. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

12. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

13. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

14. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

15. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

16. spacer 1.2|201829|36|NZ_CP009334|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

actcttctttaggctgttctgttggtttaggtgctt	CRISPR spacer
actcttctttaggctgttctgttggtttaggtgctt	Protospacer
************************************

17. spacer 1.1|201775|30|NZ_CP009334|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 5, identity: 0.833

gttgagacttcgcttgttgtgttt-gagcaa	CRISPR spacer
tttgcgagttcgcttgttgtgtttcgtgca-	Protospacer
 *** ** **************** * ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14603 : 24404

Bacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001004734.1\|14603_14789_-	hypothetical protein	F8WPL1	Bacillus_phage	3.6e-15	60.3
WP_001135708.1\|14775_14982_-	hypothetical protein	NA	NA	NA	NA
WP_000404429.1\|14994_15510_-	hypothetical protein	NA	NA	NA	NA
WP_000033408.1\|15520_15709_-	hypothetical protein	NA	NA	NA	NA
WP_000834751.1\|15722_16022_-	hypothetical protein	NA	NA	NA	NA
WP_000257080.1\|16037_16382_-	hypothetical protein	NA	NA	NA	NA
WP_003298987.1\|16398_16878_-	hypothetical protein	NA	NA	NA	NA
WP_000085609.1\|17003_17567_-	hypothetical protein	A0A218KBS9	Bacillus_phage	2.0e-11	48.2
WP_000032377.1\|17573_17771_-	hypothetical protein	A0A218KBS9	Bacillus_phage	3.0e-07	40.7
WP_000442474.1\|17788_18187_-	hypothetical protein	U5J9G1	Bacillus_phage	2.4e-16	39.3
WP_003298982.1\|18430_18751_-	hypothetical protein	R4JDU4	Bacillus_phage	4.0e-09	40.0
WP_000727297.1\|18839_19925_-	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_000565922.1\|20112_20331_-	hypothetical protein	NA	NA	NA	NA
WP_001198496.1\|20682_21063_-	hypothetical protein	NA	NA	NA	NA
WP_003298979.1\|21110_24404_-	DNA polymerase I	S4U8J4	Listeria_phage	1.7e-25	23.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009332

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009335

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP009336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP009334

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection