CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP009692	Bacillus mycoides strain ATCC 6462 chromosome, complete genome	3 crisprs	cas3,DEDDh,csa3,cas14j,c2c9_V-U4,WYL,cas14k,DinG	4	10	3
NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	0 crisprs	cas14j,DEDDh,csa3,RT	0	0	3
NZ_CP009689	Bacillus mycoides strain ATCC 6462 plasmid pBMX_3, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009690	Bacillus mycoides strain ATCC 6462 plasmid pBMX_2, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009692_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009692_1

704635-704790

Orphan

Consensus_repeat	Method
TCTCAAAAAGAAGAAAAGTCAACAAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009692_1

>merge|NZ_CP009692|1|704635-704790|CRISPRCasFinder
TCTCAAAAAGAAGAAAAGTCAACAAGCACGAAACCAGAAAGTAAAACAGAAGATAAGTCTCAAAAAGAAGAGAAGTCAACAAGCGGCTCGAAGAGTGATAAAGAGACGAATGGCAAACAAGATGAGAAATCTCAAAAAGAAGAAAAATCAACGAAT

>NZ_CP009692|1|1|704635-704790|CRISPRCasFinder
TCTCAAAAAGAAGAAAAGTCAACAAGC	ACGAAACCAGAAAGTAAAACAGAAGATAAG
TCTCAAAAAGAAGAGAAGTCAACAAGC	GGCTCGAAGAGTGATAAAGAGACGAATGGCAAACAAGATGAGAAA
TCTCAAAAAGAAGAAAAATCAACGAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009692.1\|WP_002068497.1\|697898_699203_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP009692.1\|WP_002016211.1\|704973_705108_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_087944739.1\|695130_696651_+\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP009692.1\|WP_002184544.1\|699614_700634_+\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP009692.1\|WP_002184553.1\|707201_707597_+\|glycerol-3-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|173922
NZ_CP009692.1\|WP_002184551.1\|705851_706853_+\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP009692.1\|WP_002089714.1\|705417_705690_+\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP009692.1\|WP_003192551.1\|708900_711405_+\|CDP-glycerol-glycerophosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|367953
NZ_CP009692.1\|WP_002184540.1\|691767_693630_+\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP009692.1\|WP_016127625.1\|693626_695129_+\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP009692.1\|WP_016127628.1\|697154_697859_+\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP009692.1\|WP_139211977.1\|707602_708769_+\|CDP-glycerol-glycerophosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|367953
NZ_CP009692.1\|WP_002184556.1\|711529_712537_+\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP009692.1\|WP_033734334.1\|713785_714589_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_CP009692.1\|WP_002184559.1\|714604_716278_+\|teichoic-acids-export-ABC-transporter-ATP-binding-subunit-TagH	unknown	unknown	gnl\|CDD\|184130
NZ_CP009692.1\|WP_016127627.1\|696866_697103_+\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP009692.1\|WP_016127629.1\|703040_703748_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP009692.1\|WP_002184548.1\|702198_703041_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009692.1\|WP_002184547.1\|701011_702019_+\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009692.1\|WP_002184557.1\|712583_713780_+\|CDP-glycerol-glycerophosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|367953

Protein	Function_ID	Function_description	E-value
NZ_CP009692.1\|WP_002068497.1\|697898_699203_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP009692.1\|WP_087944739.1\|695130_696651_+\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	3.57479e-151
NZ_CP009692.1\|WP_002184544.1\|699614_700634_+\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	5.58685e-135
NZ_CP009692.1\|WP_002184553.1\|707201_707597_+\|glycerol-3-phosphate-cytidylyltransferase	gnl\|CDD\|173922	cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase,(CDP-glycerol pyrophosphorylase). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most, but not all, species encoding proteins in this family are Gram-positive bacteria. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase.	2.104e-69
NZ_CP009692.1\|WP_002184551.1\|705851_706853_+\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP009692.1\|WP_002089714.1\|705417_705690_+\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	2.23618e-39
NZ_CP009692.1\|WP_003192551.1\|708900_711405_+\|CDP-glycerol-glycerophosphotransferase-family-protein	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	8.16513e-78
NZ_CP009692.1\|WP_002184540.1\|691767_693630_+\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP009692.1\|WP_016127625.1\|693626_695129_+\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	8.13975e-180
NZ_CP009692.1\|WP_016127628.1\|697154_697859_+\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	6.30607e-32
NZ_CP009692.1\|WP_139211977.1\|707602_708769_+\|CDP-glycerol-glycerophosphotransferase-family-protein	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	1.42616e-70
NZ_CP009692.1\|WP_002184556.1\|711529_712537_+\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	0
NZ_CP009692.1\|WP_033734334.1\|713785_714589_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.90953e-50
NZ_CP009692.1\|WP_002184559.1\|714604_716278_+\|teichoic-acids-export-ABC-transporter-ATP-binding-subunit-TagH	gnl\|CDD\|184130	PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional.	2.75752e-148
NZ_CP009692.1\|WP_016127627.1\|696866_697103_+\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	3.03933e-23
NZ_CP009692.1\|WP_016127629.1\|703040_703748_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	1.39212e-07
NZ_CP009692.1\|WP_002184548.1\|702198_703041_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.96151e-89
NZ_CP009692.1\|WP_002184547.1\|701011_702019_+\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	6.45122e-31
NZ_CP009692.1\|WP_002184557.1\|712583_713780_+\|CDP-glycerol-glycerophosphotransferase-family-protein	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	1.10092e-137

>NZ_CP009692.1|WP_016127629.1|703040_703748_+|ABC-transporter-permease
MTFSMRRFSAIFRKEVQDFKTNSQTLIMLVMPLVFSVLFSRSDNMREVGASTLTAMALVMVGGFVQAMLIAEEKEKNTLRVLMLSPASSIEVLIGKSSLTGMITVATCFINLLILGKLEGNIALLLLIFVLGMLIFNLIGTCIGLLAQNVPQTSTIGLPILMTFLFGDLIGMFVKNEVVTKIVDYLPTRHIGLAVSSVIKGGGFSAITSNLLNITIWLVAVLVITLFIYRKKQMD
>NZ_CP009692.1|WP_002184548.1|702198_703041_+|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFDGKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYDRLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTQVKKLSKGMKQRVILARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNKEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIQVVLTDKKKEIVKKDELGAKRISEWMKKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP009692.1|WP_002184547.1|701011_702019_+|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MALLELKQLGKTNQLPAIELEVEKGQCVVLQCNNHTAKVLHRIIIGEEEASLGSVLFEGESIGKKMYSRIGFCFLKDEAYDRLKVKEYFKFLLGLYESHMSIEEVVQYVGLLDKLNAKIEKLSFSEKRRLHIGRIMIHNPDLVILEEPEQNVDTESTIIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKIEIEQEEVEEVDEEKVVQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELETRLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP009692.1|WP_002184544.1|699614_700634_+|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEEAASKTPPAIESIPAPGKVDTAVQVAVYRDQQKKVETLPMEEYVAGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKEELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQKFTVSDFQKRLGVKVLANGKVGNIKDLTEGKRVKDVEFQGKTLTGKQVREKLDLRSSDFTWKQEGDNITVTTKGFGHGVGMSQYGANGMAVEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP009692.1|WP_002068497.1|697898_699203_+|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLSGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVKVGNGFVEAHVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTVLENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVEKLYGANHPIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLHADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPSSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP009692.1|WP_016127628.1|697154_697859_+|YwmB-family-TATA-box-binding-protein
MKFKAILIVIVSVVLFLVGYKEMKPISDEQKMESMIAALEKNDAKVERWSWLARETKTISNIHTFQKLLNDVKEEANIESWELEQSPDGYKATSYKKSSSHEERIVVTWSKENTKENTFIIFEVSGAKWDPKYVQNIDEILSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQIEERAFVSVSAYNKKWNDALSTNREKINVQIAIRSTNNKDTIVVGTPIITSEY
>NZ_CP009692.1|WP_016127627.1|696866_697103_+|DUF1146-domain-containing-protein
MAHLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITITIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP009692.1|WP_087944739.1|695130_696651_+|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVAISAIAAVLLAIVSLISLYSEPAGDILNGSFVLDGFSKGFKTLLLGGAALVLCMAMSDDKKEPIQDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKRNRASNEAAMKYVINGGIGTAITLFGMSYLYGITGSTNIVEMQKAFTQELAGGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGAATPVAAFLGTISKISGFLLITRLFLMVFAGVAIQGDAQSLYGRMSIYIAVLASITMIVGNVVALKQYNVKRLFAYSGIAHAGYLLVPLVALSQFTMDSMWFYMLAYMLMNIGAFAIIHGLILQNDKENMTIFTGLYKRSPFTAIVMTVFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVISFVYYFRILQQMFFRTGETEEKLRLPLNIKIVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP009692.1|WP_016127625.1|693626_695129_+|NADH-quinone-oxidoreductase-subunit-M
MNGLLLTFFIFSPLLGILLLLLTPKRESRTVQALGLFGTALPFGIAIVLACTYASGKSLSIFDEKVKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMLLTALLAMLAAIAAFSIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFMFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSVLFAKTGTTNIAELKEILTSVGAGGGMAVSSNLQFGLFLSIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIVRFGKGLFPEYFREFATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLAALNAPGTQGALFQVVSHGLIAALLFFLLGIIEERFGTSDITELGGLAKSVPVLSGFFLAGGMASLGMPGMSGFISEFLAFLGLFQGKPVIAAAGVLGIILTAVYVLRAILQVTFGKKEWEAKSDIHGWEYVPVIVLIICIIAIGVMPELLGDPLQTTLKTLGVK
>NZ_CP009692.1|WP_002184540.1|691767_693630_+|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIVFGKKIREGSSVLGIFFTFLSFISAVVVLIERFSSEAVKHKWVWLRVGDIDISFGFEVTALGALMLFIVTLVSFLVHVYSKGYMKGDTRLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFTGMILIFWHAGSFEYDAIFKAIHTGDLSPSMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASAVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGALFLIGTLAISGVPLLSGFFSKDEILAAAWMNGNYFLFVLAVIAAFLTAFYMFRLYFLVFTGETKTKEEVHESPRTMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDIGFQVKEVHGPVWIMVVATLVSFAGIALAYFIYGKKSISRDWAGGEGTSLYNLLKEKYYVDELYNATVLPITKGIAHVLRLFEVYVVEGIAVLIAGLVKGMSGLGSRLQNGNVQVYGTVTAVSLAVLLIILLYTGGDLR
>NZ_CP009692.1|WP_002016211.1|704973_705108_+|hypothetical-protein
MSFLSVLSIAIILLFVLFALYYYIAGKKEVPHHQLLEEEYEREE
>NZ_CP009692.1|WP_002089714.1|705417_705690_+|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDTENPVRQ
>NZ_CP009692.1|WP_002184551.1|705851_706853_+|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVSAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYVKRKYKLLIGERTSENIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAIIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKLPVLIAENPMQCVAVGTGIMLENIDKLPRRALR
>NZ_CP009692.1|WP_002184553.1|707201_707597_+|glycerol-3-phosphate-cytidylyltransferase
MKKVITYGTFDLLHWGHINLLKRAKDLGDYLIVAVSSDEFNKLKNKKSYHSYENRKMILEAVRYVDEVIPEHNWEQKVKDVVNHDVDTFVMGDDWEGEFDELSEYCEVVYLTRTAGISTTKIKKELVQVAR
>NZ_CP009692.1|WP_139211977.1|707602_708769_+|CDP-glycerol-glycerophosphotransferase-family-protein
MIREIMVEIYLILVAILHSMMKVFPIKKKVTFIMSYGENLFFIYEEMQRQGINCEVVFLYKSTCKYEVDNYSNVKSYKFETRNIFHTIKSVYHLSTSQYVIVDNYFGSLAKIKFKKGVECIQIWHAAGAFKKFGLLAPSLKKRSLRAQNRFMDVYKNFHKIVVGSEALADIYKKAFALSDNNILKTGIPRTDLFFDEQRQKKVKDNIFIVNPKLKDKKVILYAPTFRDKELVDFDLHLDIDEMYRQLKGEYILIIKLHPAIRNICNYEEKYAGFLYDYSLYPNINDLFLVTDILVTDYSSIPFEFCLLNKPMIFFAYDLKKYMKKRGTIGDYISDVPGPVVYTTEEVVQVITDGKFKIDSINNFTLKWNEYSIGDSSKHFVNMLFKGK
>NZ_CP009692.1|WP_003192551.1|708900_711405_+|CDP-glycerol-glycerophosphotransferase-family-protein
MKNRINFLSGPLKKYSNDQGFKRTVKYTDFYVKLDLDEKVILYESFHGKGMTDSPYAIFKKIIDNPEYKDYTHVWALNDGNNFYAKRYENKKNVKFVKVHSEEYLKYLTTAKYLINNTTFPPYFQKKEGQIYVNTWHGTPIKTLGKDMKGEIGQHKNIQRNFMHCDYILNPNKFTADTIVNSHDLEGLYNGYVVDEGYPRIDLTLQVNPEEVQEYLKEFVEIDETKKIILYAPTWRGGVNQVSNIKDEINNIVKKMYSEIPSDYQLLLKVHTLTYKFIKDDESLREICIPDWVDSNELMSIVDVLVTDYSSIFFDYMVTEKPIIFLTYDKEAYEEQRGLYVQLEDMPGPICYTVDEVVRSIEKIESVKNDYSFKYQEILKEYCYHDDGNATARAIEIIFRGKHTENVYKVTNENKKNILMYCGGFLNNGITTSVINLLNSIDYSKYNVAVIDKGKYDQISRDNFNQINSNVKRFYRVGSLNTTLKESYQNNYVMKMGLKNERAQKALPKQLYKREISRLFGNAEFDIAIDFSGYVPFWTLLFAFGDFKKRNIYQHNDMWAEYSKKIKGKFKHRANLNIIFPLYKEFDKIVAVAEHTRNLNRKNLKDYITLKQGVYVHNAIDPNKVLKQIEEGDIYKYDGKEYLLKENIHGNGKLEIRGIEMPQKENINFVNMGRLSPEKDQKKLIHAFAKVTELYDNIRLYIIGDGVLKEELENLVREKNLEDKVIFTGQMSNPFLLINQCDCFVLSSNHEGQPMVLLEALILGKPIIATDIAGSRSILEKGYGDLVENNITGLVIGMQKFILSKTSFKEFDFQKYNGHALEMFYDEICTLKEK
>NZ_CP009692.1|WP_002184556.1|711529_712537_+|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase
MKKITVVGAGSWGTALSMVLADNGHEVRIWGNKAEQIHEINEKHTNETYLPGIQLSKTIKGYESLAEAMDGIDTILLVVPTKSIRSVMQQLKDIVKQPITIIHASKGIEPGSFKRISEMIEEEMPKELIESVVVLSGPSHAEEVSLRHPTTVTAASYHLQAAEKTQKLFMNTNFRVYTNRDVIGVELGGALKNIIALGAGISDGLGYGDNAKAALISRGLTEVTRLGCEMGANPLTFAGLTGVGDLIVTCTSVHSRNWRAGNLLGKGHNLEEVLENMGMVVEGVRTAEAAYHLAEKMNIEMPITNAIYNVLFNGKNAKEEVDTLMGRTGKGEVSR
>NZ_CP009692.1|WP_002184557.1|712583_713780_+|CDP-glycerol-glycerophosphotransferase-family-protein
MSFIRRIKNHRIVKKLCKAVFLFCSCLPPKKKLILFESYSGKQYSCNPRAIYEYMLQNNMDFEMIWSVNKNHTVQFDKENIPYVKRFSIRWFILLVRSKYWVTNSRMPLWLPKPKHTVYIQTWHGTPLKKLAGDMKEVHMPGTTTEKYKHNFHLEAQNWDYLLSPNTYSTDIFRRAFQFQKEVVEVGYPRNDFLYQSNNSSVIESLKKNNNLPIDKKIILYAPTWRDDQFYSKGRYKLDLQLDLDLLQSKLGSDYVILLRMHYLVAEKFDLVKYKGFVYDFSKHVDINELYVISDLLITDYSSVFFDYANLKRPIIFYTYDIDSYRDKLRGFYFDLEEEAPGPIVKNTRVVLEEIVKCEVNGLGEFAEKYDSFYNKYCYLEDGGASKRAVRKIFFGEA
>NZ_CP009692.1|WP_033734334.1|713785_714589_+|ABC-transporter-permease
MNSMIMVLKEQISSLYLIKRLSIYQVKSTNNNNYLGLFWELLNPLIQMSIYWFVFGLGIRGGQGVNGVPFVYWLSAGLVVWFFINPAMMQASKSIYTRLNMVSKMSFPMSVIPSFVIMSNFYSHVILVGVITILFLVTGQGISIHYIQLVYYMFATLMLVCSLSLITSTLATIVRDTQMIVQSIMRMLFYLTPIVWTPERLPSIFQKIMQFNPFCYIVDGYRASLLGTNWFFQDINYALYFWGFVFITFLIGSALHVKFRKHFADYL
>NZ_CP009692.1|WP_002184559.1|714604_716278_+|teichoic-acids-export-ABC-transporter-ATP-binding-subunit-TagH
MNESVRFHNVTKKYKMHSKNSDKLKDIIYPGGFGEDFYALRNLEFVAQKGDVIGIVGVNGSGKSTMSNLIAGITPPTKGKIDIKGKVTLIAIAAGLNNQLSGRENIELKCLMMGLSKEKIEKLTPEIIEFADIGKFIDMPVKKYSSGMKSRLGFAISVSINPDVLVIDEALSVGDQTFTDKCLKRMNEFKEQGKTIFFVSHSLGQVKKFCTKALWLEYGEIKDYGPIQEIMPKYENFLKEYRAMSREEQQKFKKESMEKQAGKNLINNEDTKKEGTAQVVDHLSLLGKQSPHHTKKKKGRKFLSAIIGVMLLMILVGVTYWQKDSILYSLQAKEQKKEPVSKVERTKKEENPLASLDVRYVNSAKGRVRGTPTLDGQVVGTISFGTPFVVKEQQKEMGSDINWLKFTLGNGEEGWISESIVKSIPYNQTIPYEEFLDKLKQLDGITPNLEEYLTFLGKSKEEIINIVGNSKNEKQLAVGTLVQYEDIDIVYNNQLIVQKINIKNMKILKENLFGKLGEAQLKAEDNSLFIYRSNKFDFDFSLIGSIINEISISDISK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009692_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009692_2

3721084-3721692

Orphan

Consensus_repeat	Method
ACCTCCNGGNCCTACTGGACCTACCGG	CRT

11 spacers

The CRISPR arrays of NZ_CP009692_2

>merge|NZ_CP009692|2|3721084-3721692|CRT
AATAACTGGAGTAACTGGACCTTCTGGTGGACCTCCGGGGCCTACTGGACCTACCGGCATAACCGGAGCAACTGGACCTTCTGGACCTCCAGGAATAACTGGAGCAACCGGGCCTTCTAGTGGACCTCCAGGACCTACTGGACCTACCGGAGCAACTGGACCTTCTGGCGGACCTCCAGGGCCTACTGGACCTACCGGATTTCCAGGAACTGGTGGACCTCCAGGGCCTACTGGGCCTACCGGCATAACCGGAGTAACTGGACCTTCTGGTGGACCTCCAGGGCCTACTGGACCTACCGGATTTCCAGGAACTGGTGGACCTCCGGGGCCTACTGGGCCTACCGGCATAACCGGAGCAACCGGGCCTTCTGGTGGACCTCCGGGGCCTACTGGGCCTACCGGCATAACCGGAGCAACCGGGCCTTCTGGTGGACCTCCGGGGCCTTCTGGACCTACCGGAATAACAGGAGCAACCGGACCTTCTGGTGGACCTCCAGGACCTACTGGACCTACCGGAGCAACTGGACCTTCTGGTGGACCTCCGGGGCCTACCGGACCTACCGGATTGCCAGGAACTGCTGGAGCTACTGGGCCTACCGGACTTACAGT

>NZ_CP009692|2|1|3721084-3721692|CRT
AATAACTGGAGTAACTGGACCTTCTGG	TGGACCTCCGGGGCCTACTGGACCTACCGGCATAACCGG
AGCAACTGGACCTTCTGGACCTCCAGG	AATAACTGGAGCAACCGGGCCTTCTAGTGG
ACCTCCAGGACCTACTGGACCTACCGG	AGCAACTGGACCTTCTGGCGG
ACCTCCAGGGCCTACTGGACCTACCGG	ATTTCCAGGAACTGGTGG
ACCTCCAGGGCCTACTGGGCCTACCGG	CATAACCGGAGTAACTGGACCTTCTGGTGG
ACCTCCAGGGCCTACTGGACCTACCGG	ATTTCCAGGAACTGGTGG
ACCTCCGGGGCCTACTGGGCCTACCGG	CATAACCGGAGCAACCGGGCCTTCTGGTGG
ACCTCCGGGGCCTACTGGGCCTACCGG	CATAACCGGAGCAACCGGGCCTTCTGGTGG
ACCTCCGGGGCCTTCTGGACCTACCGG	AATAACAGGAGCAACCGGACCTTCTGGTGG
ACCTCCAGGACCTACTGGACCTACCGG	AGCAACTGGACCTTCTGGTGG
ACCTCCGGGGCCTACCGGACCTACCGG	ATTGCCAGGAACTGCTGG
AGCTACTGGGCCTACCGGACTTACAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009692.1\|WP_003188862.1\|3729468_3730176_+\|iron-sulfur-cluster-repair-di-iron-protein	unknown	unknown	gnl\|CDD\|274701
NZ_CP009692.1\|WP_002031657.1\|3719792_3720074_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_000395676.1\|3728034_3728187_-\|exosporium-protein-ExsG	unknown	unknown	unknown
NZ_CP009692.1\|WP_033733916.1\|3725701_3727306_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224001
NZ_CP009692.1\|WP_002035358.1\|3724115_3724391_-\|stage-V-sporulation-protein-S	unknown	unknown	gnl\|CDD\|377254
NZ_CP009692.1\|WP_003188995.1\|3719472_3719793_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_041868012.1\|3728395_3729265_+\|excalibur-calcium-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377566
NZ_CP009692.1\|WP_033733937.1\|3715287_3715617_+\|WGxxGxxG-CTERM-domain-containing-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_002085943.1\|3727575_3727785_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_002168501.1\|3714426_3714942_-\|DUF3231-family-protein	unknown	unknown	gnl\|CDD\|371599
NZ_CP009692.1\|WP_003188992.1\|3718394_3718877_-\|ArpU-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273725
NZ_CP009692.1\|WP_001261484.1\|3716181_3717171_-\|iron-siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238566
NZ_CP009692.1\|WP_033733913.1\|3722577_3723030_+\|exosporium-leader-peptide-containing-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_002012544.1\|3724582_3724732_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380671
NZ_CP009692.1\|WP_002012557.1\|3712602_3713250_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224336
NZ_CP009692.1\|WP_003188990.1\|3717852_3718395_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP009692.1\|WP_080564367.1\|3723005_3723755_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP009692.1\|WP_002127124.1\|3724922_3725507_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP009692.1\|WP_003188983.1\|3713359_3714097_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370676
NZ_CP009692.1\|WP_116746659.1\|3719196_3719358_-\|DUF3983-domain-containing-protein	unknown	unknown	gnl\|CDD\|289882

Protein	Function_ID	Function_description	E-value
NZ_CP009692.1\|WP_003188862.1\|3729468_3730176_+\|iron-sulfur-cluster-repair-di-iron-protein	gnl\|CDD\|274701	TIGR03652, FeS_repair_RIC, iron-sulfur cluster repair di-iron protein. Members of this protein family, designated variously as YftE, NorA, DrnN, and NipC, are di-iron proteins involved in the repair of iron-sulfur clusters. Previously assigned names reflect pleiotropic effects of damage from NO or other oxidative stress when this protein is mutated. The suggested name now is RIC, for Repair of Iron Centers. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	3.40131e-111
NZ_CP009692.1\|WP_033733916.1\|3725701_3727306_-\|hypothetical-protein	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	2.83423e-12
NZ_CP009692.1\|WP_041868012.1\|3728395_3729265_+\|excalibur-calcium-binding-domain-containing-protein	gnl\|CDD\|377566	pfam05901, Excalibur, Excalibur calcium-binding domain. Extracellular Ca2+-dependent nuclease YokF from Bacillus subtilis and several other surface-exposed proteins from diverse bacteria are encoded in the genomes in two paralogous forms that differ by a ~45 amino acid fragment, which comprises a novel conserved domain. Sequence analysis of this domain revealed a conserved DxDxDGxxCE motif, which is strikingly similar to the Ca2+-binding loop of the calmodulin-like EF-hand domains, suggesting an evolutionary relationship between them. Functions of many of the other proteins in which the novel domain, named Excalibur (extracellular calcium-binding region), is found, as well as a structural model of its conserved motif are consistent with the notion that the Excalibur domain binds calcium. This domain is but one more example of the diversity of structural contexts surrounding the EF-hand-like calcium-binding loop in bacteria. This loop is thus more widespread than hitherto recognized and the evolution of EF-hand-like domains is probably more complex than previously appreciated.	2.26083e-19
NZ_CP009692.1\|WP_003188983.1\|3713359_3714097_+\|hypothetical-protein	gnl\|CDD\|370676	pfam09770, PAT1, Topoisomerase II-associated protein PAT1. Members of this family are necessary for accurate chromosome transmission during cell division.	2.22662e-07
NZ_CP009692.1\|WP_002127124.1\|3724922_3725507_+\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.71909e-06
NZ_CP009692.1\|WP_003188992.1\|3718394_3718877_-\|ArpU-family-transcriptional-regulator	gnl\|CDD\|273725	TIGR01637, Putative_autolysin_regulatory_protein_ArpU, phage transcriptional regulator, ArpU family. This model represents a family of phage proteins, including ArpU, called a putative autolysin regulatory protein. ArpU was described as a regulator of cellular muramidase-2 of Enterococcus hirae but appears to have been cloned from a prophage. This family appears related to the RinA family of bacteriophage transcriptional activators and to some sporulation-specific sigma factors. We propose that this is a phage transcriptional activator family. [Mobile and extrachromosomal element functions, Prophage functions, Regulatory functions, DNA interactions].	1.14991e-15
NZ_CP009692.1\|WP_002168501.1\|3714426_3714942_-\|DUF3231-family-protein	gnl\|CDD\|371599	pfam11553, DUF3231, Protein of unknown function (DUF3231). This bacterial family of proteins has no known function.	5.01075e-48
NZ_CP009692.1\|WP_001261484.1\|3716181_3717171_-\|iron-siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	2.5979e-94
NZ_CP009692.1\|WP_002012544.1\|3724582_3724732_-\|hypothetical-protein	gnl\|CDD\|380671	cd18892, TET, oxygenase domain of ten-eleven translocation (TET)1, TET2, and TET3 methylcytosine dioxygenases and similar proteins. TET proteins are involved in DNA demethylation through iteratively oxidizing 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC), 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC). TET proteins contain a C-terminal catalytic domain which consists of a cysteine-rich region and a double-stranded beta-helix (DSBH) fold. Alterations in TET protein function have been linked to cancer, and TETs influence many cell differentiation processes. TET family genes have been implicated as tumor suppressors, for example mutations/deletions of the TET2 gene frequently occur in multiple spectra of myeloid malignancies. TET3 acts as a suppressor of ovarian cancer by demethylating the miR-30d precursor gene promoter to block TGF-beta1 induced epithelial-mesenchymal transition (EMT). TET3 (and TET2) promoters are silenced in melanoma cells by mechanisms triggered by TGF-beta and mediated by DNA methyltransferase 3 alpha (DNMT3A). TET genes are downregulated in endometriosis. TET proteins belong to the TET/JBP family of dioxygenases that require Fe2+ and alpha-ketoglutarate (also known as 2-oxoglutarate) for activity.	0.00769404
NZ_CP009692.1\|WP_002012557.1\|3712602_3713250_-\|HD-domain-containing-protein	gnl\|CDD\|224336	COG1418, COG1418, Predicted HD superfamily hydrolase [General function prediction only].	1.08454e-36
NZ_CP009692.1\|WP_002035358.1\|3724115_3724391_-\|stage-V-sporulation-protein-S	gnl\|CDD\|377254	pfam04232, SpoVS, Stage V sporulation protein S (SpoVS). In Bacillus subtilis this protein interferes with sporulation at an early stage and this inhibitory effect is overcome by SpoIIB and SpoVG. SpoVS seems to play a positive role in allowing progression beyond stage V of sporulation. Null mutations in the spoVS gene block sporulation at stage V, impairing the development of heat resistance and coat assembly.	2.65609e-42
NZ_CP009692.1\|WP_080564367.1\|3723005_3723755_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.97302e-52
NZ_CP009692.1\|WP_003188990.1\|3717852_3718395_-\|site-specific-integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	3.88748e-64
NZ_CP009692.1\|WP_116746659.1\|3719196_3719358_-\|DUF3983-domain-containing-protein	gnl\|CDD\|289882	pfam13137, DUF3983, Protein of unknown function (DUF3983). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are approximately 40 amino acids in length. There is a conserved AWRN sequence motif.	5.9065e-05

>NZ_CP009692.1|WP_002031657.1|3719792_3720074_-|hypothetical-protein
MDDPIKEIVGAWFVAVGTIIAAIGSTPLKRLNSELRKDLNVWGNVLQATGNGLEADGQGEISLELIGNEIQSIGNVTVLTGLIIEFEDETQKN
>NZ_CP009692.1|WP_003188995.1|3719472_3719793_-|hypothetical-protein
MIAGNWIQALGGVTSIGGEIEDSSNIDESYNIVGNVLQATGNSLQAIGGIDELKASRDKVEGISEGDEEDGQLIVITGSWVQAVGSVVSLIGQIREESQEIEESIS
>NZ_CP009692.1|WP_116746659.1|3719196_3719358_-|DUF3983-domain-containing-protein
MEMRDVCMKGMRRMANAKKKKIRRAIARRAIAVDKYQVNKAWRSIFVQAGIIK
>NZ_CP009692.1|WP_003188992.1|3718394_3718877_-|ArpU-family-transcriptional-regulator
MTKQLSFLPKIDRSATQEELEGVLESIRIHRQFGMMRKEMKVTPSYEMREHGPTHAVGKPLEDVAIANIQQSKREEWLERMSLRINQFLNRLGNGRAGIIQRDIIYKRYLEEEDVCDYMVYNEIGMSERTYRRWKSKAFYKLAFAFGLEVYETEETGGNE
>NZ_CP009692.1|WP_003188990.1|3717852_3718395_-|site-specific-integrase
MNFVQPIRDSEQIQYLKEYFKDKSDRNYILFIMGINTGLRISDILKLKVSDVKGSHISMREKKTGKQKRIQITAALKRELKWFIEEREDNEYLLQSRQGKNRPIGRSMAYKILIGAAAEFGLDEIGTHTLRKTYGYHMYMQTKNIALLMEIFNHSSEKVTLRYIGVNQDAMDKAMTRFKI
>NZ_CP009692.1|WP_001261484.1|3716181_3717171_-|iron-siderophore-ABC-transporter-substrate-binding-protein
MRTYLKTILSLLSALFLVFIAACGSNEVSKEKTESKSNKVQGYTVKHAMGETKITKTPKRVVVLTNEGTEAILSMGVKPVGAVKSWLGDPWYDHIKSDMKDVKVVGVEHEVNLEKIASLKPDLIIGNKVRQEKVYDKLSAIAPTVFSDTLGGDWKENFKLYAKALNREEEGNKVLSKFDAHLEGVKQKLGDKVNQEVSVVRFMAGTSRIYYTDSFSGVIFDQLGFKRVKQQKELFTANSKFGNLAIDVGKEMIPKMDGDVLFYFTYAPENDQKALDKAKEMTSDPLWKNLNAVKNGNAHEVSDAVWNTAGGVIAANKMLDELEKIMLSK
>NZ_CP009692.1|WP_033733937.1|3715287_3715617_+|WGxxGxxG-CTERM-domain-containing-protein
MKKKLSSILGALLLTITVFGTSVHAEYDGYNTNRVNNNNTTTRVNDYNTNRVNDYNMNRVNNDVRTRNVNTTNDLKDNRNKNNNWTWLGLLGLLGLFGLRKKDKDPETR
>NZ_CP009692.1|WP_002168501.1|3714426_3714942_-|DUF3231-family-protein
MGILSGNPQNEPMHYGEVFGIWSYLAAAQGAIAGYQVLINHTGDEDLKKFLENLVENDIQSEVEELKNILKLNGVALPPAPPERPVASIETIPPGARINDAEIAAKVSMDLAAGLVACSQAMGQSLREDVGMMFGQFHLKKAQAGAILLRLNKKKGWIIPPPLHVLQSDQA
>NZ_CP009692.1|WP_003188983.1|3713359_3714097_+|hypothetical-protein
MFYNNQPPYPQQPFSPQHQEQRYAEQYEEQETQHQEPQYEQNPYATPQTQGAEYQQNPYDTRPNYEYPQNPYAASPTQEQQYQQNPYTTQYTQEQQNPYVPQRTQEQQYQQNPYANQPQQPMYQPNSEQRVSPPAPPTIDPTQPQILPPGPTFDITQPQILPPGPITEPTQQQIQQVVGTHFLPLKKPVLDFVKPWVDYGLNEAKHTSHQHALTEVAAIMFLVGKGFTPTIAHYIVESWEKNEQF
>NZ_CP009692.1|WP_002012557.1|3712602_3713250_-|HD-domain-containing-protein
MIKQEKIQKTITFVKHILEKDASGHDWYHIERVHKLAISLSEQEGGNRFIIEMAALLHDVADEKLNESEEAGMKKVSDWLEELRVEEDESKHVLHIIANMSYKGGHGGTVESLEGRIVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPREVMTKDEYRKNNDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQI
>NZ_CP009692.1|WP_033733913.1|3722577_3723030_+|exosporium-leader-peptide-containing-protein
MDEFLSSTSINPNLVGPTLPPVPPFTLPTGPTGPTGPTGPTGSLSVAYGTFWQTEIITVPFESPFSFNQADPMVGGISLLNPTTINITQAGDYRISFISSINLTVALSFPYSPTISILLNNSLIPNFKATMLNLRKKDYQMVQSAISIAA
>NZ_CP009692.1|WP_080564367.1|3723005_3723755_+|site-specific-integrase
MSNIHRCLRCIFKHAVEWEIIHDNIMNKVKKPREEQGEMKTWSSEECNRFLQYLKEKNIKYHMFFLLAIYTGMRRGELLALTWKDIDFDNKRILVNKSLVKTEKGLFKAATKTKFSNRSVSISSFVIGKLQSYYSYKKKEFFRWGIHLNEEAFIFTGNTIHSPLHIDAPHRFLNDHYKKAGVPRIRIHDLRHTHATLMLQAGEHPKIVQDRLGHSSIQMTLDKYSHITQNMQQQAAENFESIIKSNENT
>NZ_CP009692.1|WP_002035358.1|3724115_3724391_-|stage-V-sporulation-protein-S
MENILKVSSKSSPNSVAGAIAGVLRASGKVEIQVIGAGSLNQAIKAIAIARGFVAPSGIDLVLVPAFQEVTIDNQERTAIKLIVGPRRRRS
>NZ_CP009692.1|WP_002012544.1|3724582_3724732_-|hypothetical-protein
MEKKKDEYLADNSIQGFKMLKYLNFKIVYRQSKEEKYLKDSILVKQRNG
>NZ_CP009692.1|WP_002127124.1|3724922_3725507_+|hypothetical-protein
MGSYYHSSSSYKRSSCHSSSSSYKKCSCHQSSSSYKKCSCDHSHKSSKPAYGTFWQTEFITVPFGGSFPFNHVGPLAGGVSLLNPTTIQFSKAGDYRISFISSINTTLNPVFPHIPVITIFLNNNPLANSQGDFAFQMNTSSNNECLQLVGETIVTVPANSTLQLRNNSGFNHQSIVTCDNGINSVELTVTKLS
>NZ_CP009692.1|WP_033733916.1|3725701_3727306_-|hypothetical-protein
MGIMKRSIALFIVLCFMSPLVFSANVHAEVVTELKTGFPNQEVFTPGEWFLGQKPANYDENKTPILFVQGRNGNADSWYGKTVYHEMNDMYDYALKAGYQTVFIQLYDAAGKGSASQWDNGKLLAQKLEEIYNHFGKKVNIVAHSKGGIDTQAALVGYGANRFVGNVITLATPHYGSNLADLSYSWWAGWLASILGQKDDGTYSLQIGEMAKFRSTIDNNPAAKLNRYYTATGTSWGPVFSALSMGGLYLSSYGSNDGLVNEWSAKLPYGTHLFTDSRFDHDNIRKGSAVFARIEPYLRTVNVPVPALLAPSNSSEDKVEQLNTTSNQAILGGELSQNEWVGQTVAVDKKAEGVVSILTASSDVEIQLISPKGKVYTNKDSAVSTGEGESLFKGATIRTFKFDKMEAGEWQVKMMAKQPKDAYLIVTDYKKDAQFVLQMPAKVKVNKAEYKLKKSPVAPEMKGDLSVTVRVINKDGKLVSESNESKNINTTTFTGALKNIEQPGVYNVTIDMKGMNKEGQPYNRTIVKSVYVEK
>NZ_CP009692.1|WP_002085943.1|3727575_3727785_-|hypothetical-protein
MKRRTYDIPVVLRREWFLIELAHLTKKYGIEIATSKIEDAPFLRDQVTEFKIGAGLQYDKYDDEYIIEF
>NZ_CP009692.1|WP_000395676.1|3728034_3728187_-|exosporium-protein-ExsG
MEFQLLVNCVLQEGNAYFLVTKVDDVITLKVPITAGVAGLFLALGVPRCS
>NZ_CP009692.1|WP_041868012.1|3728395_3729265_+|excalibur-calcium-binding-domain-containing-protein
MAVLSNIGVALFFIAFILLILCIISFFKKNGKAKQYGRPTVILFMISILLIGMGTTKSEHPVIDFFATLSLILFIFFLVLAILSVIKKTGVAKKQFIITAILFVIFVALSSISAPSSEKTAATSKKVASNNAEQKESEKKKELEKKEAEEQALKQEDEKRLADEQARKQQEEQKRLADEQARKQQEEQKRLADEQARKQQEEQKRQADEQARKQQEEQKRQADEQARKQQEDQQKAQQAQTQPAASNNSNVTYKNCTEVKNAGKAPLYRDQPGYSSKLDRDGDGVACEK
>NZ_CP009692.1|WP_003188862.1|3729468_3730176_+|iron-sulfur-cluster-repair-di-iron-protein
MKHTFTETSIIGEIVTQFPKASDLFKSYRIDFCCGGSRPLIDAINERNLSVTEVITELNTLYNNTKLLNESEIDWKNASYQELIDYVINKHHRYLNEELPQLSPYVTKVLRVHGANQPHLAQIHKLFHELKMELEQHLIKEETEDFPLILEFEQNPTNENYAKLRKVVDELEDEHNHAGNIIKELRKVTNDFTPPEGACGTYRLVYQRLEAIESDLFEHIHLENNILFPRAISRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009692_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009692_3

5139645-5139831

Orphan

Consensus_repeat	Method
AACCATAAATATCTGGATTAGAATA	CRISPRCasFinder

3 spacers

csa3

The CRISPR arrays of NZ_CP009692_3

>merge|NZ_CP009692|3|5139645-5139831|CRISPRCasFinder
AACCATAAATATCTGGATTAGAATAATTTATATCTCTTTTTTCCGAAAAATTAAAACCATAAATATCTGGATTAGAATATTGTATACTTCCTTCTTGTAAAGACTTCAATCCATATATATCTGGATTGGAATAATTTACCGATCCTTCTTTCAGGGATTTTACTCCATATATATCCGGATTCGAATA

>NZ_CP009692|3|2|5139645-5139831|CRISPRCasFinder
AACCATAAATATCTGGATTAGAATA	ATTTATATCTCTTTTTTCCGAAAAATTAA
AACCATAAATATCTGGATTAGAATA	TTGTATACTTCCTTCTTGTAAAGACTTCA
ATCCATATATATCTGGATTGGAATA	ATTTACCGATCCTTCTTTCAGGGATTTTA
CTCCATATATATCCGGATTCGAATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009692.1\|WP_002010453.1\|5148041_5149175_-\|alanine-dehydrogenase	unknown	unknown	gnl\|CDD\|240630
NZ_CP009692.1\|WP_033733778.1\|5135950_5136223_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009692.1\|WP_003187360.1\|5136237_5136756_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375857
NZ_CP009692.1\|WP_002169187.1\|5149545_5151417_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176521
NZ_CP009692.1\|WP_033733779.1\|5155304_5156111_+\|formate-dehydrogenase-accessory-sulfurtransferase-FdhD	unknown	unknown	gnl\|CDD\|234823
NZ_CP009692.1\|WP_003187355.1\|5132017_5133196_+\|pyrimidine-nucleoside-transporter-NupC	unknown	unknown	gnl\|CDD\|224883
NZ_CP009692.1\|WP_002169184.1\|5141194_5142658_+\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236426
NZ_CP009692.1\|WP_002140336.1\|5142882_5145237_-\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319847
NZ_CP009692.1\|WP_001017670.1\|5131539_5131926_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319940
NZ_CP009692.1\|WP_002134328.1\|5145844_5146396_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|226975
NZ_CP009692.1\|WP_002010461.1\|5145257_5145635_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009692.1\|WP_002125161.1\|5130133_5131432_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP009692.1\|WP_002125156.1\|5137155_5137704_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP009692.1\|WP_002029742.1\|5128518_5129952_-\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
NZ_CP009692.1\|WP_003187374.1\|5152066_5155009_-\|formate-dehydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|225918
NZ_CP009692.1\|WP_033708164.1\|5133385_5134399_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|181811
NZ_CP009692.1\|WP_003187373.1\|5151571_5152054_-\|DUF1641-domain-containing-protein	unknown	unknown	gnl\|CDD\|225283
NZ_CP009692.1\|WP_002063741.1\|5146522_5147938_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129987
NZ_CP009692.1\|WP_002186923.1\|5137767_5139468_-\|peptidase-M4-family-protein	unknown	unknown	gnl\|CDD\|225768
NZ_CP009692.1\|WP_002010475.1\|5134633_5135896_+\|VanW-family-protein	unknown	unknown	gnl\|CDD\|377286

Protein	Function_ID	Function_description	E-value
NZ_CP009692.1\|WP_002169187.1\|5149545_5151417_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176521	cd08579, GDPD_memb_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial glycerophosphodiester phosphodiesterases. In addition to a C-terminal GDPD domain, most members in this family have an N-terminus that functions as a membrane anchor.	8.24749e-101
NZ_CP009692.1\|WP_002010453.1\|5148041_5149175_-\|alanine-dehydrogenase	gnl\|CDD\|240630	cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains. Alanine dehydrogenase (L-AlaDH) catalyzes the NAD-dependent conversion of pyruvate to L-alanine via reductive amination. Like formate dehydrogenase and related enzymes, L-AlaDH is comprised of 2 domains connected by a long alpha helical stretch, each resembling a Rossmann fold NAD-binding domain. The NAD-binding domain is inserted within the linear sequence of the more divergent catalytic domain. Ligand binding and active site residues are found in the cleft between the subdomains. L-AlaDH is typically hexameric and is critical in carbon and nitrogen metabolism in micro-organisms.	0
NZ_CP009692.1\|WP_003187360.1\|5136237_5136756_-\|hypothetical-protein	gnl\|CDD\|375857	pfam18431, RNAse_A_bac, Bacterial CdiA-CT RNAse A domain. Contact-dependent growth inhibition (CDI) is an important mechanism of inter-bacterial competition found in many Gram-negative pathogens. CDI+ cells express cell-surface CdiA proteins that bind neighboring bacteria and deliver C-terminal toxin domains (CdiA-CT) to inhibit target-cell growth. Structure analysis of CdiA-CT shows that it adopts the same fold (with two beta-sheets forming an overall kidney shape) as angiogenin and other RNase A paralogs, but the toxin does not share sequence similarity with these nucleases and lacks the characteristic disulfide bonds of the superfamily. Furthermore, structural comparison analysis identified human angiogenin, Rana pipiens protein P-30 (onconase) and mouse pancreatic ribonuclease (RNase 1) as the closest structural homologs of CdiA-CT.	5.60367e-38
NZ_CP009692.1\|WP_033733779.1\|5155304_5156111_+\|formate-dehydrogenase-accessory-sulfurtransferase-FdhD	gnl\|CDD\|234823	PRK00724, PRK00724, formate dehydrogenase accessory sulfurtransferase FdhD.	8.49779e-132
NZ_CP009692.1\|WP_003187355.1\|5132017_5133196_+\|pyrimidine-nucleoside-transporter-NupC	gnl\|CDD\|224883	COG1972, NupC, Nucleoside permease [Nucleotide transport and metabolism].	1.1864e-142
NZ_CP009692.1\|WP_002169184.1\|5141194_5142658_+\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|236426	PRK09243, PRK09243, nicotinate phosphoribosyltransferase; Validated.	0
NZ_CP009692.1\|WP_002140336.1\|5142882_5145237_-\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319847	cd07548, P-type_ATPase-Cd_Zn_Co_like, P-type heavy metal-transporting ATPase, similar to Bacillus subtilis CadA which appears to transport cadmium, zinc and cobalt but not copper out of the cell. Bacillus subtilis CadA/YvgW appears to transport cadmium, zinc and cobalt but not copper, out of the cell. Functions in metal ion resistance and cellular metal ion homeostasis. CadA/YvgW is also important for sporulation in B. subtilis, the significant specific expression of the cadA/yvgW gene during the late stage of sporulation, is controlled by forespore-specific sigma factor, sigma G, and mother cell-specific sigma factor, sigma E. This subfamily also includes Helicobacter pylori CadA an essential resistance pump with ion specificity towards Cd(2+), Zn(2+) and Co(2+), and Zn-transporting ATPase, ZiaA(N) in Synechocystis PCC 6803. Transcription of ziaA is induced by Zn under the control of the Zn responsive repressor ZiaR. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP009692.1\|WP_001017670.1\|5131539_5131926_-\|VOC-family-protein	gnl\|CDD\|319940	cd08352, VOC_Bs_YwkD_like, vicinal oxygen chelate (VOC) family protein Bacillus subtilis YwkD and similar proteins. uncharacterized subfamily of vicinal oxygen chelate (VOC) family contains Bacillus subtilis YwkD and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.26178e-69
NZ_CP009692.1\|WP_002134328.1\|5145844_5146396_-\|SAM-dependent-methyltransferase	gnl\|CDD\|226975	COG4627, COG4627, Uncharacterized protein conserved in bacteria [Function unknown].	2.04304e-71
NZ_CP009692.1\|WP_002010461.1\|5145257_5145635_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.55875e-21
NZ_CP009692.1\|WP_002125161.1\|5130133_5131432_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	3.11331e-147
NZ_CP009692.1\|WP_002125156.1\|5137155_5137704_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	5.78441e-19
NZ_CP009692.1\|WP_002029742.1\|5128518_5129952_-\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
NZ_CP009692.1\|WP_003187374.1\|5152066_5155009_-\|formate-dehydrogenase-subunit-alpha	gnl\|CDD\|225918	COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only].	0
NZ_CP009692.1\|WP_033708164.1\|5133385_5134399_+\|LCP-family-protein	gnl\|CDD\|181811	PRK09379, PRK09379, LytR family transcriptional regulator.	1.20099e-88
NZ_CP009692.1\|WP_003187373.1\|5151571_5152054_-\|DUF1641-domain-containing-protein	gnl\|CDD\|225283	COG2427, COG2427, Uncharacterized conserved protein [Function unknown].	6.56155e-20
NZ_CP009692.1\|WP_002063741.1\|5146522_5147938_-\|amino-acid-permease	gnl\|CDD\|129987	TIGR00909, putative_amino_acid_transporter, amino acid transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.8307e-141
NZ_CP009692.1\|WP_002186923.1\|5137767_5139468_-\|peptidase-M4-family-protein	gnl\|CDD\|225768	COG3227, LasB, Zinc metalloprotease (elastase) [Amino acid transport and metabolism].	1.92817e-166
NZ_CP009692.1\|WP_002010475.1\|5134633_5135896_+\|VanW-family-protein	gnl\|CDD\|377286	pfam04294, VanW, VanW like protein. Family members include vancomycin resistance protein W (VanW). Genes encoding members of this family have been found in vancomycin resistance gene clusters vanB and vanG. The function of VanW is unknown.	6.49808e-59

>NZ_CP009692.1|WP_002186923.1|5137767_5139468_-|peptidase-M4-family-protein
MKRKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVDPKADLYVYQNGEETTYAYVVNLNFLEPNPGNYYYFIEAESGKVLNKYNKLDHVTNDDKSPVKQDAPKQEAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTLPGTLWADADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISDIFGTLVEFYDNRNPDWEIGEDIYTPGQAGDALRSMSDPAKYGDPDHYSKRYTGSSDNGGVHTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQAAADLYGASSAEVAAVKQSFSAVGVN
>NZ_CP009692.1|WP_002125156.1|5137155_5137704_+|TVP38/TMEM64-family-protein
MAETIQNFLTDYYSIAIPLSILINIIISLLGFIPSIFLTAINIQLFGVTNGTIISIAGEALGAIISFYIYRIGLQKFTHDKVNTYPKVERLLYVEGREAFLLVLSFRFIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVINGTNEAKWIITIAGCVGLFYLWKKWRKK
>NZ_CP009692.1|WP_003187360.1|5136237_5136756_-|hypothetical-protein
MKRLSSLFLSGLLALMLILSGCAGKEQKTEKPKEDHSTSVEKISDNILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQHDKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMNVKDKLVKTVTVLARDKSGNLGFKIITSYPSDK
>NZ_CP009692.1|WP_033733778.1|5135950_5136223_-|hypothetical-protein
MYPTLQYFLKSYCTLSIHEGEIVSVMEEFIEQEDEEIVLKLRDELVNMKKKNAWEEACVLAAKQGNRVWSLEETKDHLEIFLLLLQKKKA
>NZ_CP009692.1|WP_002010475.1|5134633_5135896_+|VanW-family-protein
MKLSKILIGSAIAGGILLCVGGIGGYQYVSKLNNQLNTTALPNTTFEGISLDGKNKADIQALVNQKMNELNQKSLNYVFQNDKQNYTWKDLGVDYKEKDIVDNIFKEQEGNVMNRYNMRKQAENGEVKRDYKLTPQLNTTTYETFIKDKYNETLKNPVNAELSVEGSTVNISQSQNGEKIDKGKLTDLTSAAITSGTPDVVLPVTLIKPERSTEDIQQMGIKEVIAEYSTPMAGRNGNQSYNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAVYSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPDLKFKNNTGKHIYIQAFSNGGSITTRIFGTNTGKNVEVSSQVISNTGDKITAVTYKKVTQNGEVLSNGQISKSVYKSAPKQ
>NZ_CP009692.1|WP_033708164.1|5133385_5134399_+|LCP-family-protein
MKSDINNETRAKKGRSKKKRLLWFILIPLLIVAMGAGGYSFHIYSKAKSVLSNAYSELGRGDKSSKREKAVKPMTDNISVLIMGVDESDIREKGYGKATRTDALLLATINKNDKSVKLVSIPRDSRVFIKSRDKYDKITHAHVFGGVDSTIDTVEKFLDVPVDYYVKFNFKSFIKIVDSLGGITVDVPVEFTEQNSSDEADAIHLKKGRQHLNGEEALALARTRHIDSDYMRGQRQQLVLEAIAEKALSLNSINKIGSLLDAVDTDLKTNLTFDDMMTIAKNSMDSNLKMDKLQVEGTDKYIGGIYYYVPNEKSVNDISTTLQEHLGVTNKNEHKKL
>NZ_CP009692.1|WP_003187355.1|5132017_5133196_+|pyrimidine-nucleoside-transporter-NupC
MKFITFFAGLIVVFFLAYIASNNKKHIKFKPIFIMLIIQLILTYLLLNTEIGLILITVISSLFTRLLEYAASGINFVFGGLANKGEMPFFLNVLLPIVFISVLIGILQHFKILPFFIRWIGFFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKHRLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIVLIINPYDVNDDEDILVIKGERQSFFEMLGEYILDGFRVAIVVGAMLIGFVALMSCINDLFLIIFGITFQQLIGYVFAPIAFLIGVPSSEIVTAGSIMATKLVTNEFVAMMDLSKISSTLSIRTVGIISVFLVSFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML
>NZ_CP009692.1|WP_001017670.1|5131539_5131926_-|VOC-family-protein
MNICRVHHVAIICSNYELSKDFYTRILGFKAINEVYRKERDSYKLDLCVGEEYQIELFSFPSPPERPSFPEAAGLRHLAFAVTNIEEAVNHLKQCGVETEAIRMDEITDKKFVFFQDPDGLPLELYEA
>NZ_CP009692.1|WP_002125161.1|5130133_5131432_-|HlyC/CorC-family-transporter
MDILKLLMVAILIALTAFFVAVEFAIIKVRSSRIDQLVSEKRRGALAAKKVTSNLDEYLSACQLGITITALGLGWLGEPTIKHILEPLFLKLHLSPAIASTVSFIIAFAVITFLHVVIGELAPKTLAIQRAEQVSLLLSKPIIYFYRVMYPFIWALNGSARLVTGLFGLHPASEHEVAHSEEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVPRTEVVGLYEDEPFETHIKIIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNREEGCSITPYTRPVIEVLENIPIHDLLLQMQRKRIPLAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEHPPIEHISEVCKIVEGKVLISEVNDLFGIHLVADDVDTIGGWIMVQKQIVAEGDIIEKHGFSFKVLEKDMHQIKRVEIKKVEE
>NZ_CP009692.1|WP_002029742.1|5128518_5129952_-|aspartate-ammonia-lyase
MIATKDIRIEKDFLGEKEVPSVAYYGVQTLRAVENFPITGYRIHPSLITAMAIVKKAAALANIDTGYLAKDIGQEIAEAAQEIVDGKFHDQFIVDPIQGGAGTSINMNTNEVIANRALERMGYEKGEYAKISPNTHVNMAQSTNDAFPTGIHIATLMMLEELLVTMEELHSAFHDKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLERDIKRIKQSRQHLYEVNMGATAVGTGLNANPTYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSAALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAFQVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIKGITANEELLKQYVEKSVGVITAVNPHIGYEAASRIAREAIATGKSVRELCLEHGVLTAEELDIILDPYEMTHPEIAGASLLKTKKM
>NZ_CP009692.1|WP_002169184.1|5141194_5142658_+|nicotinate-phosphoribosyltransferase
MNHYKDDSYALHTDLYQINMAYTYWKDGIHTRRSVFDLYFRKLPFENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEDFLHYLQNMKFTGTIRSMQEGEVVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAANNDELLEFGTRRAHEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAETHKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRIDFYGIRLDSGDMAYLSKEARKQLDAAGFTNTKIIASSDLDEYTIMHLKSQGAKIDVWGVGTKLITSFEQPALGAVYKLVAIEDTDGKLNDTIKISSNPEKITTPGLKRVYRIINRVNDHAEGDYIALESEEPGKEERLKMFHPVHTYISKFVTSFEARELHQDIFINGKRAYELPNILDIQKYNERSLSLFWEEYMRTLNPEEYPVDLSQECWDHKMNYIQTVREQVEKNIQK
>NZ_CP009692.1|WP_002140336.1|5142882_5145237_-|cadmium-translocating-P-type-ATPase
MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVTSCSVNFATKTMLLETPQNKENQVVTEAKQLVTKLEPHIKVQEEQKTKSVKEVFVLEGLDCANCAMKIENKVKEMPTISEATVDFVSKKLRVEVANKRELESTVQNIKNVVQKLEPDVKVVREEEKGHDHDHGDGNVKKMIGRLVVGGILTGIAALAGLPQMITIPLFVLAYLLIGGDIVWRAVRNITRGQVFDENFLMAIATLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGEYIIVKPGEKVPLDGKVVEGTSMMDTSALTGESVPREVEVGNDVLSGFVNQNGVLIVEVTKEFGESTVSKILDLVQNASSKKAPTENFITKFARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGILVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGITAEELLEYAAFAEVYSNHPIAQSIRNAYGKSIDENAIEDYSEISGHGTVVKVQGKEIFAGNAKLMSKENITFKQPNTVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKSVGEAVGKELGLDEVHAELLPHQKVEEIEKIDAAKRGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPSKIVTAVKIAKRTRSIVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL
>NZ_CP009692.1|WP_002010461.1|5145257_5145635_-|winged-helix-turn-helix-transcriptional-regulator
MAENKVETQQEACSQTVIHEEIVDQVKQTIPTDESLSKVAELFKVLGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYSLADQHVIHIFEQAFEHVNEEE
>NZ_CP009692.1|WP_002134328.1|5145844_5146396_-|SAM-dependent-methyltransferase
METKVVVGAEGYNNNPGWLHTNEKELHLLKRETWLNKFQPNSLSVILAEHVWEHLSYEEGIEAAKVCYEFLEDSGYIRCAVPDAFFQNEEYQRGVQVGGPGPLDHPAASHKIVHNYKTIISMFEAAGFQVKLLEYCDENGQFHYSDWEENGGFIYRSKRFDHRNQDGKLGFASLIVDAVKVNK
>NZ_CP009692.1|WP_002063741.1|5146522_5147938_-|amino-acid-permease
MANLFKKKSVTQLLGESKSKTLTKTLGAFDLTMLGIGAIIGTGVLVLTGLVAARDAGPAVIFSFMIAAIVCGFAALCYAEVASALPVSGSVYTYSYATIGEFVAHLMGWTLLSVYVVTTAAVAGGWTGYFNNLVSGLGLEIPKALLTIPSQGGMVNLPAVIVTLVITWLLSRGTKESKRVNNIMVLIKIGIVVLFIAVGVFYVKPENWIPFAPYGLSGVFAGGAAVFFAFLGFDALATSAEEVKNPQRDLPIGIIASLVICTIIYVVVCLVMTGMVSYKELDVPEAMAYVLEVVGQDKVAGVIAIGAVIGIMAVIFAYIYATTRVFFAMSRDGLLPKSFAKINKKTEAPTFSVWLTGIGSALIAGFIDLKELSNLANIGALLTFAMVGVTVIILRKTHPKLQRGFMVPLVPILPIISVASCLFLMVNLPLKTWIYFGVWLAIGVVVYFVYSKKHSHLKDDGSSQDSLEKAN
>NZ_CP009692.1|WP_002010453.1|5148041_5149175_-|alanine-dehydrogenase
MRIGVPAEIKNNENRVAMTPAGVVHLVRNNHEVFIQKDAGVGSGFTDAQYVEAGAKIVDTAEEAWNMEMVMKVKEPVESEYKHFSEGLILFTYLHLAPEPELTKALIEKKVVAIAYETVQLENRSLPLLAPMSEVAGRMAAQIGAQFLEKNKGGKGILLAGVPGVKRGKVTIIGGGQAGTNAAKIAVGLGADVTIIDLSAERLRQLDDIFGNQVKTLMSNPYNIAEAVKESDLVIGAVLIPGAKAPKLVTEEMIKSMEQGSVVVDIAIDQGGIFETTDRITTHDNPTYEKHGVVHYAVANMPGAVPRTSTLALTNVTVPYAVQIANKGYKEACLGNTALLKGINTLEGYVTFEAVAEAHGVEYKGAKELLEAETVSC
>NZ_CP009692.1|WP_002169187.1|5149545_5151417_-|glycerophosphodiester-phosphodiesterase
MQHRKRLSIPGVMGHSFQTVRFAFWNVLTFQLAYKLLAAIVFVPLFGIIFNKLLYFGGYANATNDELLAFLKTPYGILAIVILSLLALFLIFTEFAVLIIISYFAHKRQKVKLRPILYKTVTYLPTLFTYCLPGFILYAVVLLPLLNLGYETALIPQIQIPNFITGELFKTTMGQVGYYTFFAVVAYLNLRWIFVLPIVVLEQKPFRTAARKSATLVKESFFKVLFFLVGFFISIGIVYGVFFGMYLLCLWGMYEFTNPQGTFALLAESTMSVFLTSTLYLFSFIVTPFYIMAITRLYLQKVPVEDVLLEEGLDYSKTKADKCFFQKHRWKFIGVYIVGIITAGMVVAFIVTFISNSYKEPIIMAHRGYISKGVENTKEALQGAIDAKADYAEIDVLQTKDGELAVIHDLKLKRLANANVHVSDLTMEELRQLTLSQDGFSGQISTLDEIIKLAKGKIKLNIEVKLHGGEKDFVNKVLKAIKDNEFEKQCVIQTLHYPLIKEFKRANPNIKVGYILYASRANLKNVKADFYVAEEYMLNKKLVKEARKLNKPIYVWTVNDMESLKAYYKLNVDGIITDYPEDARETIKMLKEQEDRESDMFDKITETTEDLFSKLFMIYPAAG
>NZ_CP009692.1|WP_003187373.1|5151571_5152054_-|DUF1641-domain-containing-protein
MAKEITLIKKKIVTEEEKKQQVTDELLNDLAENREAVEETMRLLAQLQKAGILDAAISLLAAKEDVSKIAVEQLNREPVKNALNNMMGAGEALSSVDPEITKQITSSLVTGLQFATDELKNGKKTKVMDFFKVLKDPDINRAITFGFSFLKAFGQGLEKK
>NZ_CP009692.1|WP_003187374.1|5152066_5155009_-|formate-dehydrogenase-subunit-alpha
MTEQTVRVTVDGKEFFVSGEKTILQLFNESNLEHPQICHVPEVDPIQTCDTCIVEVNGSLLRACSTKLEDGMHIERQSERAKEAQTEAMDRILENHLLYCTVCDNNNGNCKVHNTVHMMEIEEQKYPYEPKVSACEVDTSHPFYRYDPNQCIACGQCVEVCQNLQVNETLSIDWSLDRPRVIWDNGVSINDSSCVSCGQCVTVCPCNALMEKTMLGEAGFMTGLKPDVLNPMIDFVKDVEPGYSSILAVSEVESAMRKTKINKTKTVCTFCGVGCSFEVWTKDRQILKVQPVSDAPVNGISTCVKGKFGWDFVNSEERITKPLIRQGDMFVEASWEEALEVVASNMQHIKSEYGSDAFGFISSSKVTNEENYLMQKLARQIYGTNNVDNCSRYCQSPATDGLFKTVGMGGDAGTVKDIAEAGLVIIVGANPTEGHPVLATRVKRAHKLHEQKLIVADLRKHEMAERADIFVHPSQGTDYVWLAGITKYIIDQDWHDKKFIAENVKNFDEYSKMLEKYTLDYTEKITGISKDQLKEMARMVYEADGTCVLWGMGVTQNTGGSTTSAAISNLLLVTGNYRRPGAGAYPLRGHNNVQGACDMATLPNWLPGYQAVSDDVHRAKFEKAYGTTIPKEPGLNNIAMLLAAEEGKLRGMYVMGEEMALVDSNANHVQHILANLDFLVVQDMFLSKTARFADVILPAAPSLEKEGTFTNTERRIQRLYEVLKPLGDSKPDWWILQKVARALGGDWNYGSPSEIMDEIASLAPLYSQATYDRLEGWNSLCWGSHDGSDTPLLYVDGFNFPDKLARLSLDEWVPPVIAPDEYDLLLNNGRMLEHFHEGNMTNKSAGILSKVSEVFVEISPELAKERNVKDGGLVELASPFGKIKVQALVTDRVTGNELYLPMHATVNEEAINILTGTATDIYTCTPAYKQTMVKLRVLREKGNRPLPSSNPRDKKRHPQNGVEIERKWQRKQYVSLVDQN
>NZ_CP009692.1|WP_033733779.1|5155304_5156111_+|formate-dehydrogenase-accessory-sulfurtransferase-FdhD
MGPIQETYTIVRYQSGTFSKQTDEVVTESPITIKLNSEEYVTVVCTPNYIEDMVTGFLISEGIISSYKDIEELWIQKENGIVHVKSSKINPLYQTLYNKRYVTSCCGKSRQGFVFVNDAAKAKKLHDIHITITPEECFHLMNSLQQSSTTFRQTGGVHNTALCDRNNILLSRMDIGRHNALDKIYGHCLRNNISVQGKIIAFSGRISSEILLKVSKIGCEIVLSKSAPTKLALQLAHDLGITVVGFIRNGSCNIYTHPERIDGYKIND

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691.1	122354-122383	1	0.967
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691.1	122468-122497	1	0.967
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691.1	122582-122611	1	0.967
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691.1	122639-122668	1	0.967
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122477-122497	1	0.952
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122591-122611	1	0.952
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122648-122668	1	0.952
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122753-122773	1	0.952
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691.1	122468-122497	2	0.933
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691.1	122582-122611	2	0.933
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691.1	122639-122668	2	0.933
NZ_CP009692_2	2.3\|3721234\|21\|NZ_CP009692\|CRT	3721234-3721254	21	NZ_CP009691.1	122477-122497	2	0.905
NZ_CP009692_2	2.3\|3721234\|21\|NZ_CP009692\|CRT	3721234-3721254	21	NZ_CP009691.1	122591-122611	2	0.905
NZ_CP009692_2	2.3\|3721234\|21\|NZ_CP009692\|CRT	3721234-3721254	21	NZ_CP009691.1	122648-122668	2	0.905
NZ_CP009692_2	2.3\|3721234\|21\|NZ_CP009692\|CRT	3721234-3721254	21	NZ_CP009691.1	122753-122773	2	0.905
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691.1	122354-122383	2	0.933
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691.1	122411-122440	2	0.933
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691.1	122696-122725	2	0.933
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122363-122383	2	0.905
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122420-122440	2	0.905
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122534-122554	2	0.905
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691.1	122705-122725	2	0.905

1. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to position: 122354-122383, mismatch: 1, identity: 0.967

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctagtgg	Protospacer
******************.***********

2. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to position: 122468-122497, mismatch: 1, identity: 0.967

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
****** ***********************

3. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to position: 122582-122611, mismatch: 1, identity: 0.967

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
****** ***********************

4. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to position: 122639-122668, mismatch: 1, identity: 0.967

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
****** ***********************

5. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122477-122497, mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

6. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122591-122611, mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

7. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122648-122668, mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

8. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122753-122773, mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

9. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to position: 122468-122497, mismatch: 2, identity: 0.933

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
******************.******.****

10. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to position: 122582-122611, mismatch: 2, identity: 0.933

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
******************.******.****

11. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to position: 122639-122668, mismatch: 2, identity: 0.933

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
******************.******.****

12. spacer 2.3|3721234|21|NZ_CP009692|CRT matches to position: 122477-122497, mismatch: 2, identity: 0.905

agcaactggaccttctggcgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.***********.**

13. spacer 2.3|3721234|21|NZ_CP009692|CRT matches to position: 122591-122611, mismatch: 2, identity: 0.905

agcaactggaccttctggcgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.***********.**

14. spacer 2.3|3721234|21|NZ_CP009692|CRT matches to position: 122648-122668, mismatch: 2, identity: 0.905

agcaactggaccttctggcgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.***********.**

15. spacer 2.3|3721234|21|NZ_CP009692|CRT matches to position: 122753-122773, mismatch: 2, identity: 0.905

agcaactggaccttctggcgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.***********.**

16. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to position: 122354-122383, mismatch: 2, identity: 0.933

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctagtgg	Protospacer
****** ******************.****

17. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to position: 122411-122440, mismatch: 2, identity: 0.933

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagtaaccggaccttctggtgg	Protospacer
****** ****.******************

18. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to position: 122696-122725, mismatch: 2, identity: 0.933

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagtaaccggaccttctggtgg	Protospacer
****** ****.******************

19. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122363-122383, mismatch: 2, identity: 0.905

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctagtgg	Protospacer
******.*********.****

20. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122420-122440, mismatch: 2, identity: 0.905

agcaactggaccttctggtgg	CRISPR spacer
agtaaccggaccttctggtgg	Protospacer
**.***.**************

21. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122534-122554, mismatch: 2, identity: 0.905

agcaactggaccttctggtgg	CRISPR spacer
agtaaccggaccttctggtgg	Protospacer
**.***.**************

22. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to position: 122705-122725, mismatch: 2, identity: 0.905

agcaactggaccttctggtgg	CRISPR spacer
agtaaccggaccttctggtgg	Protospacer
**.***.**************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122354-122383	1	0.967
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122468-122497	1	0.967
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122582-122611	1	0.967
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122639-122668	1	0.967
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122477-122497	1	0.952
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122591-122611	1	0.952
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122648-122668	1	0.952
NZ_CP009692_2	2.10\|3721600\|21\|NZ_CP009692\|CRT	3721600-3721620	21	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122753-122773	1	0.952
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122468-122497	2	0.933
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122582-122611	2	0.933
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122639-122668	2	0.933
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122354-122383	2	0.933
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122411-122440	2	0.933
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122696-122725	2	0.933
NZ_CP009692_2	2.5\|3721327\|30\|NZ_CP009692\|CRT	3721327-3721356	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122411-122440	3	0.9
NZ_CP009692_2	2.5\|3721327\|30\|NZ_CP009692\|CRT	3721327-3721356	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122696-122725	3	0.9
NZ_CP009692_2	2.7\|3721429\|30\|NZ_CP009692\|CRT	3721429-3721458	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122468-122497	3	0.9
NZ_CP009692_2	2.7\|3721429\|30\|NZ_CP009692\|CRT	3721429-3721458	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122582-122611	3	0.9
NZ_CP009692_2	2.7\|3721429\|30\|NZ_CP009692\|CRT	3721429-3721458	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122639-122668	3	0.9
NZ_CP009692_2	2.8\|3721486\|30\|NZ_CP009692\|CRT	3721486-3721515	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122468-122497	3	0.9
NZ_CP009692_2	2.8\|3721486\|30\|NZ_CP009692\|CRT	3721486-3721515	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122582-122611	3	0.9
NZ_CP009692_2	2.8\|3721486\|30\|NZ_CP009692\|CRT	3721486-3721515	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122639-122668	3	0.9
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122525-122554	3	0.9
NZ_CP009692_2	2.5\|3721327\|30\|NZ_CP009692\|CRT	3721327-3721356	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122525-122554	4	0.867
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122744-122773	4	0.867
NZ_CP009692_3	3.1\|5139670\|29\|NZ_CP009692\|CRISPRCasFinder	5139670-5139698	29	NZ_KM521836	Staphylococcus epidermidis strain 12-00322 plasmid p12-00322, complete sequence	2120-2148	4	0.862
NZ_CP009692_3	3.1\|5139670\|29\|NZ_CP009692\|CRISPRCasFinder	5139670-5139698	29	NZ_KR230047	Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence	2257-2285	4	0.862
NZ_CP009692_3	3.1\|5139670\|29\|NZ_CP009692\|CRISPRCasFinder	5139670-5139698	29	CP030483	Staphylococcus aureus strain ER03913.3 plasmid unnamed2, complete sequence	21785-21813	4	0.862
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	100654-100683	5	0.833
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NC_010854	Candidatus Phytoplasma australiense plasmid pPAPh2, complete sequence	1283-1312	5	0.833
NZ_CP009692_2	2.1\|3721111\|39\|NZ_CP009692\|CRT	3721111-3721149	39	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122771-122809	5	0.872
NZ_CP009692_2	2.2\|3721177\|30\|NZ_CP009692\|CRT	3721177-3721206	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122744-122773	5	0.833
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MT811961	Vibrio phage vB_pir03, complete genome	153061-153090	6	0.8
NZ_CP009692_2	2.5\|3721327\|30\|NZ_CP009692\|CRT	3721327-3721356	30	KP790009	Gordonia phage Gmala1, complete genome	65863-65892	6	0.8
NZ_CP009692_2	2.7\|3721429\|30\|NZ_CP009692\|CRT	3721429-3721458	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122744-122773	6	0.8
NZ_CP009692_2	2.8\|3721486\|30\|NZ_CP009692\|CRT	3721486-3721515	30	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122744-122773	6	0.8
NZ_CP009692_3	3.2\|5139724\|29\|NZ_CP009692\|CRISPRCasFinder	5139724-5139752	29	MN693450	Marine virus AFVG_25M486, complete genome	6331-6359	6	0.793
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22858-22887	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22195-22224	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22195-22224	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22195-22224	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22195-22224	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21835-21864	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22987-23016	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21458-21487	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22011-22040	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22312-22341	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21934-21963	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22141-22170	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22061-22090	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21677-21706	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21659-21688	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22987-23016	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MK268686	Enterococcus phage vB_EfaH_EF1TV, complete genome	54229-54258	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MK721192	Enterococcus phage vB_EfaM_Ef2.3, complete genome	58683-58712	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MK693030	Enterococcus phage vB_EfaM_Ef2.1, complete genome	54430-54459	7	0.767
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	NC_029026	Enterococcus phage EFLK1, complete genome	111736-111765	7	0.767
NZ_CP009692_2	2.1\|3721111\|39\|NZ_CP009692\|CRT	3721111-3721149	39	NC_004821	Bacillus prophage phBC6A52, complete genome	12463-12501	7	0.821
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	6950-6979	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	10308-10337	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	240845-240874	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	240893-240922	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	JN882287	Cronobacter phage vB_CsaM_GAP161, complete genome	149941-149970	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76482-76511	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8118-8147	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22737-22766	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88639-88668	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194711-194740	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228653-228682	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163921-163950	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	577058-577087	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20376-20405	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213933-213962	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17362-17391	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81230-81259	7	0.767
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183714-183743	7	0.767
NZ_CP009692_3	3.1\|5139670\|29\|NZ_CP009692\|CRISPRCasFinder	5139670-5139698	29	NC_004959	Lactococcus lactis W-37 plasmid pSRQ900, complete sequence	4466-4494	7	0.759
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	MG592506	Vibrio phage 1.135.O._10N.222.54.B6, partial genome	38902-38931	8	0.733
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	10356-10385	8	0.733
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	10404-10433	8	0.733
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	10452-10481	8	0.733
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	MN694073	Marine virus AFVG_250M377, complete genome	27166-27195	8	0.733
NZ_CP009692_2	2.9\|3721543\|30\|NZ_CP009692\|CRT	3721543-3721572	30	MN694769	Marine virus AFVG_250M378, complete genome	26951-26980	8	0.733
NZ_CP009692_1	1.1\|704662\|30\|NZ_CP009692\|CRISPRCasFinder	704662-704691	30	AP014334	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S36-C59, * SEQUENCING IN PROGRESS *	23809-23838	9	0.7

1. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.967

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctagtgg	Protospacer
******************.***********

2. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.967

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
****** ***********************

3. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.967

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
****** ***********************

4. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.967

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
****** ***********************

5. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

6. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

7. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

8. spacer 2.10|3721600|21|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 1, identity: 0.952

agcaactggaccttctggtgg	CRISPR spacer
agcaaccggaccttctggtgg	Protospacer
******.**************

9. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 2, identity: 0.933

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
******************.******.****

10. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 2, identity: 0.933

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
******************.******.****

11. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 2, identity: 0.933

aataactggagcaaccgggccttctagtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
******************.******.****

12. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 2, identity: 0.933

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctagtgg	Protospacer
****** ******************.****

13. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 2, identity: 0.933

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagtaaccggaccttctggtgg	Protospacer
****** ****.******************

14. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 2, identity: 0.933

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataactggagtaaccggaccttctggtgg	Protospacer
****** ****.******************

15. spacer 2.5|3721327|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagtaactggaccttctggtgg	CRISPR spacer
aataactggagtaaccggaccttctggtgg	Protospacer
 *****.********.**************

16. spacer 2.5|3721327|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagtaactggaccttctggtgg	CRISPR spacer
aataactggagtaaccggaccttctggtgg	Protospacer
 *****.********.**************

17. spacer 2.7|3721429|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
 *****.***********.***********

18. spacer 2.7|3721429|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
 *****.***********.***********

19. spacer 2.7|3721429|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
 *****.***********.***********

20. spacer 2.8|3721486|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
 *****.***********.***********

21. spacer 2.8|3721486|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
 *****.***********.***********

22. spacer 2.8|3721486|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
aataactggagcaaccggaccttctggtgg	Protospacer
 *****.***********.***********

23. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 3, identity: 0.9

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
agtaactggagtaaccggaccttctggtgg	Protospacer
*.**** ****.******************

24. spacer 2.5|3721327|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 4, identity: 0.867

cataaccggagtaactggaccttctggtgg	CRISPR spacer
agtaactggagtaaccggaccttctggtgg	Protospacer
 .****.********.**************

25. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 4, identity: 0.867

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
acctactggagcaaccggaccttctggtgg	Protospacer
* . ** ***********************

26. spacer 3.1|5139670|29|NZ_CP009692|CRISPRCasFinder matches to NZ_KM521836 (Staphylococcus epidermidis strain 12-00322 plasmid p12-00322, complete sequence) position: , mismatch: 4, identity: 0.862

atttat-atctcttttttccgaaaaattaa	CRISPR spacer
-tgtataatctcttttttttgaaaaattaa	Protospacer
 * *** ***********..**********

27. spacer 3.1|5139670|29|NZ_CP009692|CRISPRCasFinder matches to NZ_KR230047 (Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence) position: , mismatch: 4, identity: 0.862

atttat-atctcttttttccgaaaaattaa	CRISPR spacer
-tgtataatctcttttttttgaaaaattaa	Protospacer
 * *** ***********..**********

28. spacer 3.1|5139670|29|NZ_CP009692|CRISPRCasFinder matches to CP030483 (Staphylococcus aureus strain ER03913.3 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.862

atttat-atctcttttttccgaaaaattaa	CRISPR spacer
-tgtataatctcttttttttgaaaaattaa	Protospacer
 * *** ***********..**********

29. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 5, identity: 0.833

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
aataaaccagaaaataaaaaagaagataaa	Protospacer
*  **********.***** *********.

30. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NC_010854 (Candidatus Phytoplasma australiense plasmid pPAPh2, complete sequence) position: , mismatch: 5, identity: 0.833

acgaaacc---agaaagtaaaacagaagataag	CRISPR spacer
---aaaccaaaagaaaataaaacagaagataaa	Protospacer
   *****   *****.***************.

31. spacer 2.1|3721111|39|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 5, identity: 0.872

tggacctccggggcctactggacctaccggcataaccgg	CRISPR spacer
tggacctccggggcctactggacctaccggacttacagt	Protospacer
******************************  * ** *

32. spacer 2.2|3721177|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 5, identity: 0.833

aataactggagcaaccgggccttctagtgg	CRISPR spacer
acctactggagcaaccggaccttctggtgg	Protospacer
* . **************.******.****

33. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MT811961 (Vibrio phage vB_pir03, complete genome) position: , mismatch: 6, identity: 0.8

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
attcaaccacaaactaaaacagaagataaa	Protospacer
*.  ***** *** ***************.

34. spacer 2.5|3721327|30|NZ_CP009692|CRT matches to KP790009 (Gordonia phage Gmala1, complete genome) position: , mismatch: 6, identity: 0.8

cataaccggagtaactggaccttctggtgg	CRISPR spacer
cataaccggagtaaccggagctttcggggc	Protospacer
***************.*** ***..** *

35. spacer 2.7|3721429|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 6, identity: 0.8

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
acctactggagcaaccggaccttctggtgg	Protospacer
  . **.***********.***********

36. spacer 2.8|3721486|30|NZ_CP009692|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 6, identity: 0.8

cataaccggagcaaccgggccttctggtgg	CRISPR spacer
acctactggagcaaccggaccttctggtgg	Protospacer
  . **.***********.***********

37. spacer 3.2|5139724|29|NZ_CP009692|CRISPRCasFinder matches to MN693450 (Marine virus AFVG_25M486, complete genome) position: , mismatch: 6, identity: 0.793

ttgtatacttccttcttgtaaagacttca	CRISPR spacer
aattatactttcttcttgtaaaaacttta	Protospacer
   *******.***********.****.*

38. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

39. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

40. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

41. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

42. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

43. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

44. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

45. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

46. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

47. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

48. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

49. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

50. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

51. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

52. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

53. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tcgcaaccagaaaataaaacagaagccgaa	Protospacer
 ** *********.*********** ..*.

54. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MK268686 (Enterococcus phage vB_EfaH_EF1TV, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
gctgaaccagaaagtacaacagaagtaatg	Protospacer
.* .************ ********  * *

55. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MK721192 (Enterococcus phage vB_EfaM_Ef2.3, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
tctgaaccagaaagtacaacagaagtaatg	Protospacer
 * .************ ********  * *

56. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MK693030 (Enterococcus phage vB_EfaM_Ef2.1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
gctgaaccagaaagtacaacagaagtaatg	Protospacer
.* .************ ********  * *

57. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to NC_029026 (Enterococcus phage EFLK1, complete genome) position: , mismatch: 7, identity: 0.767

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
gctgaaccagaaagtacaacagaagtaatg	Protospacer
.* .************ ********  * *

58. spacer 2.1|3721111|39|NZ_CP009692|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 7, identity: 0.821

tggacctccggggcctactggacctaccggcataaccgg	CRISPR spacer
tggacctactgggcctactggacctaccgggcctactgg	Protospacer
******* * ********************  . **.**

59. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
tgtaacaggaccaactggaccttctggacc	Protospacer
 .******** ****.***********

60. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
tgtaacaggaccaacgggaccttctggacc	Protospacer
 .******** **** ***********

61. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
tgtaacaggaccaacgggaccttctggacc	Protospacer
 .******** **** ***********

62. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
agcaacaggaccaacgggaccttctggacc	Protospacer
*..******* **** ***********

63. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to JN882287 (Cronobacter phage vB_CsaM_GAP161, complete genome) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
tttaacaggaacaaccgtaccttctgggat	Protospacer
  ********.****** ********* .

64. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

65. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

66. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

67. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

68. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggacc	Protospacer
*************** *****  *.**

69. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggacc	Protospacer
*************** *****  *.**

70. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggacc	Protospacer
*************** *****  *.**

71. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggacc	Protospacer
*************** *****  *.**

72. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

73. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggacc	Protospacer
*************** *****  *.**

74. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

75. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggact	Protospacer
*************** *****  *.**

76. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 7, identity: 0.767

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
aataacaggagcaacaggaccaaccggacc	Protospacer
*************** *****  *.**

77. spacer 3.1|5139670|29|NZ_CP009692|CRISPRCasFinder matches to NC_004959 (Lactococcus lactis W-37 plasmid pSRQ900, complete sequence) position: , mismatch: 7, identity: 0.759

atttatatctcttttttccgaaaaattaa	CRISPR spacer
cacaaaaactcttttttcagaaaaattaa	Protospacer
  . * * ********** **********

78. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to MG592506 (Vibrio phage 1.135.O._10N.222.54.B6, partial genome) position: , mismatch: 8, identity: 0.733

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
gaagaacaagaaagtaaaacagatgatttg	Protospacer
. ..*** *************** ***  *

79. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.733

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
accgacaggaccaacgggaccttctggacc	Protospacer
* ..****** **** ***********

80. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.733

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
accgacaggaccaacgggaccttctggacc	Protospacer
* ..****** **** ***********

81. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.733

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
accgacaggaccaacgggaccttctgggct	Protospacer
* ..****** **** ***********

82. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to MN694073 (Marine virus AFVG_250M377, complete genome) position: , mismatch: 8, identity: 0.733

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
cgcaacaggtgcaaccgcaccttctgcttc	Protospacer
 ..****** ******* ******** *

83. spacer 2.9|3721543|30|NZ_CP009692|CRT matches to MN694769 (Marine virus AFVG_250M378, complete genome) position: , mismatch: 8, identity: 0.733

aataacaggagcaaccggaccttctggtgg	CRISPR spacer
cgcaacaggtgcaaccgcaccttctgcttc	Protospacer
 ..****** ******* ******** *

84. spacer 1.1|704662|30|NZ_CP009692|CRISPRCasFinder matches to AP014334 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S36-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.7

acgaaaccagaaagtaaaacagaagataag	CRISPR spacer
ggtttctcagaaagtaagccagaagataag	Protospacer
.     .**********. ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

220586 : 228534

Bacillus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016126477.1\|220586_222092_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-31	30.8
WP_002029454.1\|222075_222777_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_002091603.1\|222922_224248_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.4e-44	30.2
WP_164091242.1\|224632_226174_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.4e-21	31.2
WP_002029451.1\|226577_228212_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	57.8
WP_002009985.1\|228249_228534_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	4.4e-20	53.8

DBSCAN-SWA_2

1429608 : 1437251

uncultured_Caudovirales_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003191683.1\|1429608_1430592_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	6.5e-18	27.1
WP_033731383.1\|1430581_1431352_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-14	26.6
WP_002129321.1\|1431383_1432148_+	class B sortase	NA	NA	NA	NA
WP_002143312.1\|1432217_1432541_-	heme oxygenase	NA	NA	NA	NA
WP_002129320.1\|1432789_1433989_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	40.5
WP_001014315.1\|1434032_1434227_-	YwbE family protein	NA	NA	NA	NA
WP_002015431.1\|1434227_1434401_-	hypothetical protein	NA	NA	NA	NA
WP_002088884.1\|1434571_1435264_+	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.8e-06	28.8
WP_002034262.1\|1435265_1436201_+	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	2.5e-11	25.9
WP_003191672.1\|1436327_1437251_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-45	43.5

DBSCAN-SWA_3

3886150 : 3894984

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002168604.1\|3886150_3887029_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.1e-64	44.4
WP_002168605.1\|3887162_3887834_-	O-methyltransferase	W8CYT3	Bacillus_phage	1.4e-64	92.0
WP_000818985.1\|3887983_3888703_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_016126786.1\|3888871_3889945_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-171	87.4
WP_002126920.1\|3889941_3890619_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.5e-116	90.7
WP_002031356.1\|3890705_3892466_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-265	94.5
WP_002086164.1\|3892741_3893506_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003188709.1\|3893673_3894984_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.7e-10	28.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009691

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3601 : 75821

Bacillus_phage(42.11%)

transposase,integrase

attL 37445:37463|attR 78065:78083

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033734500.1\|3601_4750_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	7.5e-50	37.7
WP_003193346.1\|4913_5594_-	DUF1266 domain-containing protein	NA	NA	NA	NA
WP_033734502.1\|5606_6905_-	J domain-containing protein	NA	NA	NA	NA
WP_003193351.1\|6901_8605_-	molecular chaperone HscC	F2Y0P3	Organic_Lake_phycodnavirus	1.0e-87	37.6
WP_002191614.1\|10193_11036_+	hypothetical protein	NA	NA	NA	NA
WP_003193504.1\|11363_11879_+	hypothetical protein	NA	NA	NA	NA
WP_002191609.1\|12341_12698_+	hypothetical protein	NA	NA	NA	NA
WP_002191606.1\|13257_13572_+	hypothetical protein	NA	NA	NA	NA
WP_002191605.1\|13584_13851_+	hypothetical protein	NA	NA	NA	NA
WP_002191604.1\|13862_14381_+	hypothetical protein	NA	NA	NA	NA
WP_003193514.1\|14730_15363_+	hypothetical protein	NA	NA	NA	NA
WP_003193516.1\|15797_17339_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_016127734.1\|17961_18606_-	hypothetical protein	NA	NA	NA	NA
WP_041867973.1\|19207_20329_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.4e-170	80.2
WP_003193706.1\|20526_21276_+	DUF4362 domain-containing protein	NA	NA	NA	NA
WP_033734589.1\|21892_23257_+	erythromycin esterase family protein	NA	NA	NA	NA
WP_033734508.1\|25536_26883_+	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_002094912.1\|28279_29449_+	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_078214605.1\|29558_30209_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-60	58.1
WP_033732430.1\|30788_32402_+	S-layer homology domain-containing protein	A0A1J0MS59	Bacillus_phage	6.6e-44	54.9
WP_002187074.1\|32609_34394_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_033734559.1\|34647_37395_+	M4 family metallopeptidase	NA	NA	NA	NA
37445:37463	attL	NA	NA	NA	NA
WP_003193599.1\|38161_40375_+	cell wall-binding protein	NA	NA	NA	NA
WP_003193597.1\|40454_41138_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.4e-48	45.2
WP_002187084.1\|41506_42691_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_002187085.1\|42687_43368_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-35	39.7
WP_002187086.1\|43364_44564_+	ABC transporter permease	NA	NA	NA	NA
WP_003193589.1\|44672_45371_+	DUF1282 family protein	NA	NA	NA	NA
WP_033713865.1\|47438_47648_-	hypothetical protein	NA	NA	NA	NA
WP_002187095.1\|48263_49664_+	zinc dependent phospholipase C family protein	NA	NA	NA	NA
WP_002187096.1\|50214_50439_+	hypothetical protein	NA	NA	NA	NA
WP_002187098.1\|51744_52008_+	hypothetical protein	NA	NA	NA	NA
WP_002187100.1\|52412_54503_+	right-handed parallel beta-helix repeat-containing protein	A0A0K2D0C1	Bacillus_phage	1.3e-15	22.5
WP_002187101.1\|54610_55138_-\|integrase	phage integrase N-terminal SAM-like domain-containing protein	NA	NA	NA	NA
WP_041867956.1\|55867_56575_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-41	42.2
WP_002187103.1\|56882_59213_+	glycoside hydrolase	NA	NA	NA	NA
WP_002187105.1\|59894_61505_+	S-layer homology domain-containing protein	A0A1J0MS59	Bacillus_phage	1.9e-43	54.9
WP_002187109.1\|63084_63279_+	hypothetical protein	NA	NA	NA	NA
WP_002191412.1\|63281_63647_+	hypothetical protein	NA	NA	NA	NA
WP_157263207.1\|64407_64557_+	hypothetical protein	NA	NA	NA	NA
WP_002187112.1\|65163_65523_-	hypothetical protein	NA	NA	NA	NA
WP_002187113.1\|65904_66165_+	hypothetical protein	NA	NA	NA	NA
WP_002187114.1\|66203_66380_+	hypothetical protein	A0A1B1P875	Bacillus_phage	1.4e-21	86.0
WP_002191414.1\|66382_67012_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	3.8e-48	60.2
WP_003193183.1\|67149_67521_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	1.8e-21	48.8
WP_002187120.1\|68368_68647_+	hypothetical protein	NA	NA	NA	NA
WP_033734453.1\|69008_69200_+	hypothetical protein	NA	NA	NA	NA
WP_002187122.1\|69378_70086_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-43	43.7
WP_003193178.1\|70265_71651_+	S-layer homology domain-containing protein	Q0H255	Geobacillus_phage	2.3e-77	60.7
WP_002069688.1\|71653_71866_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	7.3e-12	51.5
WP_002187126.1\|72688_73129_+	hypothetical protein	NA	NA	NA	NA
WP_002187128.1\|73153_73381_+	hypothetical protein	A0A217ERD4	Bacillus_phage	1.2e-07	53.6
WP_002187129.1\|73452_73731_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.6e-14	62.3
WP_002187131.1\|73788_74001_+	hypothetical protein	NA	NA	NA	NA
WP_033734452.1\|74777_75821_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	2.2e-08	23.4
78065:78083	attR	NA	NA	NA	NA

DBSCAN-SWA_2

205752 : 211275

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003193048.1\|205752_205986_-	hypothetical protein	A0A1B1P857	Bacillus_phage	1.5e-29	83.1
WP_002069589.1\|206338_206536_-	hypothetical protein	NA	NA	NA	NA
WP_003193045.1\|207297_207669_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	2.3e-21	52.0
WP_003193043.1\|207823_208342_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.3e-46	59.0
WP_000140898.1\|208443_208608_+	hypothetical protein	A0A288WGN0	Bacillus_phage	1.0e-08	50.0
WP_002161752.1\|209023_209239_+	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	3.4e-25	83.8
WP_016127797.1\|209640_210108_+	hypothetical protein	NA	NA	NA	NA
WP_002187359.1\|210648_210876_-	hypothetical protein	NA	NA	NA	NA
WP_016127798.1\|210915_211275_-	DUF1071 domain-containing protein	B7T0A4	Staphylococcus_virus	3.3e-20	57.6

DBSCAN-SWA_3

293120 : 302054

Bacillus_phage(87.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003193333.1\|293120_293918_+	LysM peptidoglycan-binding domain-containing protein	A0A172JHR8	Bacillus_phage	7.0e-31	37.5
WP_016127851.1\|293966_294227_+	hypothetical protein	NA	NA	NA	NA
WP_016127852.1\|294505_295627_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	8.9e-173	81.0
WP_033734418.1\|296100_296442_-	YolD-like family protein	NA	NA	NA	NA
WP_003192920.1\|296438_297704_-	Y-family DNA polymerase	O64031	Bacillus_phage	1.3e-108	49.1
WP_003192922.1\|298034_298256_-	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	2.7e-09	45.2
WP_033734420.1\|298544_298865_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	7.9e-34	68.9
WP_003192925.1\|298880_300047_+	DNA translocase FtsK	W8CYG2	Bacillus_phage	4.7e-185	81.7
WP_016127863.1\|300069_300642_+	replication-relaxation family protein	W8CZ47	Bacillus_phage	6.3e-82	77.0
WP_002106904.1\|301775_302054_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.4e-15	70.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009692

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009691

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection