CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	0 crisprs	NA	0	0	2
NZ_CP009640	Bacillus cereus 03BB108 plasmid pBFI_3, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009637	Bacillus cereus 03BB108 plasmid pBFI_5, complete sequence	0 crisprs	NA	0	0	2
NZ_CP009635	Bacillus cereus 03BB108 plasmid pBFI_6, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009641	Bacillus cereus 03BB108 chromosome, complete genome	7 crisprs	DinG,cas14k,csa3,cas3,WYL,cas14j,DEDDh,RT,c2c9_V-U4	34	25	5
NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	0 crisprs	csa3,RT	0	0	22
NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	0 crisprs	csa3,cas14j	0	0	0
NZ_CP009634	Bacillus cereus 03BB108 plasmid pBFI_7, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 26751

Bacillus_phage(63.64%)

holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996374.1\|1250_2027_-	hypothetical protein	A0A1L2JY44	Aeribacillus_phage	8.3e-61	55.3
WP_042516204.1\|2564_2819_-	hypothetical protein	B5LPQ5	Bacillus_virus	5.5e-14	84.4
WP_001996382.1\|2986_3178_-	hypothetical protein	B5LPQ3	Bacillus_virus	9.8e-24	87.7
WP_000441079.1\|4135_4507_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	1.8e-21	48.8
WP_000529719.1\|4644_5274_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	4.5e-49	60.5
WP_001114347.1\|5276_5456_-	hypothetical protein	NA	NA	NA	NA
WP_001996385.1\|6016_6640_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_001996395.1\|6724_6883_-	hypothetical protein	A0A0A7AR63	Bacillus_phage	8.7e-10	58.8
WP_001996401.1\|7128_7374_-	hypothetical protein	A0A0S2MVC7	Bacillus_phage	7.2e-19	58.0
WP_001996379.1\|7409_7874_-	hypothetical protein	A0A1S6KV15	Providencia_phage	1.6e-06	28.8
WP_001996388.1\|8190_8793_-	hypothetical protein	A0A0S2SXN5	Bacillus_phage	7.1e-44	43.6
WP_001996427.1\|8833_9043_-	hypothetical protein	I1TLG8	Bacillus_phage	6.1e-35	100.0
WP_001053654.1\|9250_9697_-	dUTP diphosphatase	A0A0U3SLD3	Bacillus_phage	2.5e-70	90.5
WP_000434343.1\|9945_10071_-	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	2.4e-10	75.6
WP_001996422.1\|10079_10793_-	hypothetical protein	B5LPM7	Bacillus_virus	6.9e-38	50.8
WP_000811957.1\|10804_11068_-	hypothetical protein	A0A1B1P7U6	Bacillus_phage	7.2e-25	64.4
WP_080014233.1\|11064_11310_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	2.0e-29	83.3
WP_001996375.1\|11365_11761_-	hypothetical protein	E5DV95	Deep-sea_thermophilic_phage	1.9e-29	51.6
WP_001996387.1\|11773_11986_-	hypothetical protein	A6M987	Geobacillus_virus	1.7e-08	50.0
WP_001996394.1\|11990_13298_-	replicative DNA helicase	A6M986	Geobacillus_virus	2.2e-82	39.1
WP_080335328.1\|13308_14031_-	hypothetical protein	A0A1B1P7G4	Bacillus_phage	4.2e-59	50.4
WP_001996417.1\|14064_14298_-	hypothetical protein	NA	NA	NA	NA
WP_001996413.1\|14317_14932_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-31	48.1
WP_001996418.1\|15127_15328_-	hypothetical protein	NA	NA	NA	NA
WP_001996406.1\|15795_15975_-	hypothetical protein	NA	NA	NA	NA
WP_144405577.1\|15971_16673_-	hypothetical protein	A8ASM6	Listeria_phage	2.8e-31	52.5
WP_001996424.1\|16767_16968_-	helix-turn-helix transcriptional regulator	A0A1B1P7V5	Bacillus_phage	3.1e-28	97.0
WP_001996400.1\|17179_17530_+	helix-turn-helix transcriptional regulator	A0A1B1P8C2	Bacillus_phage	9.3e-36	65.5
WP_001996391.1\|18017_19145_-	hypothetical protein	D2XQ10	Bacillus_virus	4.6e-84	45.3
WP_001996414.1\|19611_19956_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	1.2e-56	99.1
WP_001996421.1\|20147_20621_+	hypothetical protein	NA	NA	NA	NA
WP_001996411.1\|20622_21153_+	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_001996403.1\|21476_22535_+	hypothetical protein	A0A1B1P784	Bacillus_phage	2.5e-28	50.3
WP_001996415.1\|22847_23879_+	ParM/StbA family protein	A0A0S2MVG2	Bacillus_phage	5.8e-195	98.8
WP_042516206.1\|23838_24165_+	hypothetical protein	D2XQ05	Bacillus_virus	1.6e-50	93.5
WP_001996381.1\|24293_24674_+	hypothetical protein	A0A1B1P8B2	Bacillus_phage	2.2e-59	94.4
WP_001996393.1\|24685_25216_+	hypothetical protein	A0A1B1P8A3	Bacillus_phage	1.1e-93	96.6
WP_000539769.1\|25302_25536_+	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	7.3e-37	100.0
WP_042516207.1\|25576_26326_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7G0	Bacillus_phage	9.0e-121	84.2
WP_001996432.1\|26325_26751_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	5.7e-64	87.2

DBSCAN-SWA_2

30243 : 42457

Bacillus_phage(25.0%)

portal,capsid,head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996409.1\|30243_31863_-	hypothetical protein	A0A0K1LLF9	Bacillus_phage	1.4e-89	35.5
WP_001996399.1\|31871_32690_-\|tail	phage tail family protein	A6M962	Geobacillus_virus	2.5e-71	53.1
WP_001996383.1\|32695_35428_-\|tail	phage tail tape measure protein	A0A2H4JI37	uncultured_Caudovirales_phage	1.5e-85	51.1
WP_001996396.1\|35427_35703_-	hypothetical protein	NA	NA	NA	NA
WP_001996378.1\|35726_36137_-	hypothetical protein	NA	NA	NA	NA
WP_001996389.1\|36139_36664_-\|tail	tail protein	NA	NA	NA	NA
WP_001996428.1\|36665_37073_-	hypothetical protein	NA	NA	NA	NA
WP_001996376.1\|37065_37494_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_001996434.1\|37477_37795_-	hypothetical protein	NA	NA	NA	NA
WP_001996429.1\|37791_38133_-\|head,tail	phage head-tail connector protein	A0A097PAS2	Streptococcus_pyogenes_phage	8.5e-10	37.6
WP_000729227.1\|38135_38315_-	hypothetical protein	NA	NA	NA	NA
WP_001996373.1\|38332_39271_-	DUF5309 family protein	W0XA97	Pseudomonas_phage	4.3e-19	28.6
WP_001996398.1\|39285_39924_-	DUF4355 domain-containing protein	A0A1L2K2N1	Aeribacillus_phage	2.1e-09	30.1
WP_001996386.1\|40029_40845_-\|capsid	minor capsid protein	A0A141E1Y0	Streptococcus_phage	2.2e-32	39.2
WP_001996425.1\|40963_42457_-\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	1.4e-48	32.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009638

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

167 : 28953

Bacillus_phage(66.67%)

capsid,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995604.1\|167_1097_-\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	1.5e-120	72.0
WP_000746380.1\|1118_2129_-	hypothetical protein	A0A1B1P7E4	Bacillus_phage	5.9e-51	35.5
WP_001995617.1\|2175_3102_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.4e-46	35.6
WP_001995603.1\|3088_4627_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-94	39.0
WP_144405579.1\|5719_6229_-	hypothetical protein	A0A2R4P8H7	Staphylococcus_phage	3.3e-42	49.7
WP_000810415.1\|6898_7693_-	hypothetical protein	D2XPX8	Bacillus_virus	4.8e-72	72.7
WP_001995624.1\|8295_8973_-	GIY-YIG nuclease family protein	D2XPX7	Bacillus_virus	2.0e-42	37.9
WP_001995611.1\|8985_9570_-	recombinase family protein	M9Q1K0	Clostridium_phage	7.7e-27	48.6
WP_001995620.1\|10072_10348_-	hypothetical protein	A0A142F1A2	Bacillus_phage	4.0e-18	50.6
WP_042516211.1\|10453_10789_-	hypothetical protein	NA	NA	NA	NA
WP_000529719.1\|12222_12852_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	4.5e-49	60.5
WP_001114347.1\|12854_13034_-	hypothetical protein	NA	NA	NA	NA
WP_001996385.1\|13594_14218_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_001996395.1\|14302_14461_-	hypothetical protein	A0A0A7AR63	Bacillus_phage	8.7e-10	58.8
WP_001996401.1\|14706_14952_-	hypothetical protein	A0A0S2MVC7	Bacillus_phage	7.2e-19	58.0
WP_001996379.1\|14987_15452_-	hypothetical protein	A0A1S6KV15	Providencia_phage	1.6e-06	28.8
WP_001996388.1\|15768_16371_-	hypothetical protein	A0A0S2SXN5	Bacillus_phage	7.1e-44	43.6
WP_001996427.1\|16411_16621_-	hypothetical protein	I1TLG8	Bacillus_phage	6.1e-35	100.0
WP_001053654.1\|16828_17275_-	dUTP diphosphatase	A0A0U3SLD3	Bacillus_phage	2.5e-70	90.5
WP_000434343.1\|17523_17649_-	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	2.4e-10	75.6
WP_001996422.1\|17657_18371_-	hypothetical protein	B5LPM7	Bacillus_virus	6.9e-38	50.8
WP_000811957.1\|18382_18646_-	hypothetical protein	A0A1B1P7U6	Bacillus_phage	7.2e-25	64.4
WP_042329751.1\|18642_18888_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	1.3e-31	89.7
WP_000332351.1\|18844_19108_-	hypothetical protein	A0A1B1P8D7	Bacillus_phage	3.8e-18	70.7
WP_041184387.1\|19120_20002_-	ATP-binding protein	Q2I8C8	Bacillus_phage	1.9e-85	55.2
WP_000073890.1\|19952_20768_-	replication protein	A0A1W6JP67	Staphylococcus_phage	1.4e-58	54.5
WP_000487938.1\|20768_20990_-	hypothetical protein	NA	NA	NA	NA
WP_001043060.1\|21189_21864_-	ERF family protein	A0A0M3ULL1	Bacillus_phage	2.5e-61	57.9
WP_000780697.1\|21860_22343_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	9.4e-39	51.2
WP_001006520.1\|22962_23733_-	phage antirepressor Ant	A0A2H4PQV4	Staphylococcus_phage	4.2e-57	45.1
WP_080011779.1\|23772_23994_-	helix-turn-helix transcriptional regulator	Q0H243	Geobacillus_phage	7.4e-07	50.0
WP_000578778.1\|24125_24476_+	helix-turn-helix transcriptional regulator	A0A0U3SD25	Bacillus_phage	6.9e-23	49.6
WP_000721629.1\|24800_24950_-	hypothetical protein	NA	NA	NA	NA
WP_001189353.1\|24989_26138_-	hypothetical protein	A0A0S2MVK2	Bacillus_phage	1.8e-51	33.8
WP_000859164.1\|26634_26982_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	8.3e-21	46.3
WP_000448836.1\|27186_27891_+	DUF4352 domain-containing protein	A0A1B1P898	Bacillus_phage	2.7e-58	90.4
WP_000831284.1\|27910_28255_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	2.0e-43	80.7
WP_000451516.1\|28389_28953_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	1.6e-37	50.0

DBSCAN-SWA_2

44331 : 58873

Bacillus_virus(30.0%)

tail,holin,plate,integrase

attL 44618:44632|attR 59651:59665

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000824133.1\|44331_46437_-\|integrase	tyrosine-type recombinase/integrase	L7TK95	Rhizobium_phage	8.4e-07	27.0
44618:44632	attL	NA	NA	NA	NA
WP_001265872.1\|46448_47567_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	2.3e-11	26.8
WP_001995606.1\|47790_48072_+	YolD-like family protein	NA	NA	NA	NA
WP_001995612.1\|48241_49150_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	4.3e-16	41.9
WP_001173690.1\|49162_49516_+	hypothetical protein	NA	NA	NA	NA
WP_001995628.1\|49712_50462_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7G0	Bacillus_phage	2.4e-121	83.4
WP_001995618.1\|50461_50887_-\|holin	phage holin family protein	D2XPZ9	Bacillus_virus	6.3e-71	97.9
WP_001995605.1\|50928_51600_-	hypothetical protein	A0A1B1P805	Bacillus_phage	3.9e-51	62.7
WP_001995614.1\|51613_52939_-\|plate	BppU family phage baseplate upper protein	B5LPS6	Bacillus_virus	1.1e-105	50.2
WP_001995608.1\|52953_55254_-	peptidase S74	A0A2P1JTV8	Anoxybacillus_phage	1.2e-128	56.4
WP_001995610.1\|55265_56147_-\|tail	phage tail family protein	A0A2P1JTW0	Anoxybacillus_phage	4.8e-73	47.2
WP_001995622.1\|56146_58873_-\|tail	tail length tape measure protein	B5LPS3	Bacillus_virus	9.4e-75	46.4
59651:59665	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP009641

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009641_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_1

2026523-2026625

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP009641_1

>merge|NZ_CP009641|1|2026523-2026625|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NZ_CP009641|1|1|2026523-2026625|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_042516386.1\|2034018_2035113_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP009641.1\|WP_000646423.1\|2031119_2032118_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP009641.1\|WP_000538119.1\|2027934_2028186_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000544588.1\|2023693_2024203_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP009641.1\|WP_000719639.1\|2035112_2035250_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NZ_CP009641.1\|WP_000164935.1\|2032296_2033763_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP009641.1\|WP_042516384.1\|2024296_2024974_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP009641.1\|WP_000798779.1\|2021184_2021415_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_001994099.1\|2015302_2016844_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_CP009641.1\|WP_000129175.1\|2017062_2017854_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366312
NZ_CP009641.1\|WP_001226311.1\|2025023_2025968_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP009641.1\|WP_000351707.1\|2022849_2023701_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP009641.1\|WP_001994089.1\|2017970_2019758_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009641.1\|WP_000571876.1\|2030605_2031010_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009641.1\|WP_000275811.1\|2035324_2035924_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NZ_CP009641.1\|WP_080011776.1\|2021525_2022734_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP009641.1\|WP_000422619.1\|2028522_2030142_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP009641.1\|WP_000417236.1\|2027264_2027918_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_001994226.1\|2036058_2036586_-\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
NZ_CP009641.1\|WP_000915188.1\|2019793_2020927_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_042516386.1\|2034018_2035113_+\|hypothetical-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.23845e-16
NZ_CP009641.1\|WP_000544588.1\|2023693_2024203_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	1.7183e-74
NZ_CP009641.1\|WP_000719639.1\|2035112_2035250_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	0.000197254
NZ_CP009641.1\|WP_000164935.1\|2032296_2033763_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP009641.1\|WP_042516384.1\|2024296_2024974_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	3.37835e-20
NZ_CP009641.1\|WP_001994099.1\|2015302_2016844_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_CP009641.1\|WP_000646423.1\|2031119_2032118_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	6.65827e-149
NZ_CP009641.1\|WP_001226311.1\|2025023_2025968_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	6.60592e-150
NZ_CP009641.1\|WP_000351707.1\|2022849_2023701_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22301e-86
NZ_CP009641.1\|WP_001994089.1\|2017970_2019758_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009641.1\|WP_000571876.1\|2030605_2031010_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.00495e-15
NZ_CP009641.1\|WP_000275811.1\|2035324_2035924_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.18494e-70
NZ_CP009641.1\|WP_080011776.1\|2021525_2022734_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.82498e-97
NZ_CP009641.1\|WP_000422619.1\|2028522_2030142_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	2.97731e-107
NZ_CP009641.1\|WP_000129175.1\|2017062_2017854_+\|hypothetical-protein	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.65353e-48
NZ_CP009641.1\|WP_001994226.1\|2036058_2036586_-\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	5.63823e-56
NZ_CP009641.1\|WP_000915188.1\|2019793_2020927_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.88233e-58

>NZ_CP009641.1|WP_001226311.1|2025023_2025968_-|glycerophosphodiester-phosphodiesterase
MRKIINVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKIPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLNKYNLVGQNMSSSRVMIQSFSKDSLKKIHSMNKNIPLVQLLWYYSNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARKNGLLIHPYTINEKPDMRLLIKWGATGMFTNYPDRLHSVLKEK
>NZ_CP009641.1|WP_042516384.1|2024296_2024974_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDAIFVFSGSHPGNWQAPLEAYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMEHGVPTDAILFETNSLHSIANVMEAKKIFDFTKVNRLLFVCKSLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPKKEVQGLEEYVSYYYNLA
>NZ_CP009641.1|WP_000544588.1|2023693_2024203_+|DUF3916-domain-containing-protein
MHEKKIRGIKRKANAMIKRIEEHTKTFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIKPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFTRNNEFQKWILLSNEIDFWETWRISICPTPQMLHFQEVIYDEDAIDEKEIWFIGELS
>NZ_CP009641.1|WP_000351707.1|2022849_2023701_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLISLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKPLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKEHEHDVLFNPLPNSFKKVPTTFITRKDIFRSASLQKFMEVTHNA
>NZ_CP009641.1|WP_080011776.1|2021525_2022734_-|MFS-transporter
MEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLLAGRLLDQYNEKLLISISSFLLGGSFLLTNIVNGFNVLLFVLLLVGMFYSVSQPGGSKVILKWFPNENRGLAMGIRQAGIPIGGALTGVLIPFLAIQYNVTYAINSMACICIIGGLLFFMFYKEPYVQEDARKEHIKISFWTQLKVVIRKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVLSVMFFSGMIGRIALAAISDVFYKGNRRIPLFIAVCASIGLILLLVININIHTITSGVLYSISALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYTHAWLCIVLLLSISAVSLYSKNKK
>NZ_CP009641.1|WP_000798779.1|2021184_2021415_+|hypothetical-protein
MKNTDKRNRLDAMMFHYRVTKNNIVLIEYYGKQIMILKGTDAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNERQ
>NZ_CP009641.1|WP_000915188.1|2019793_2020927_-|serine-hydrolase
MLKKWLIVFFIFAIFGGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANMKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKKTFVILFSNVQNGMNDAFNQEFRKMANDLIEGNGA
>NZ_CP009641.1|WP_001994089.1|2017970_2019758_+|oligoendopeptidase-F
MTELKDRLQVADKEKWDLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSIDEDTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTTNNGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYDNLIETTKKNIQSLHTYNELRKEKLNVDELRQYDLSVDLVKGVKQDIPYDNAFDIMIESLATLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADNLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NZ_CP009641.1|WP_000129175.1|2017062_2017854_+|hypothetical-protein
MTDFQKQFFARLHIEEKDKVSFEDLPNIMYAMAQTVPFENLNILENNFTEISKENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVHLVSGTVYNAANSIWAVDSGHIATVLKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKANAAQKIIVEHDGSPFNKVPLIVKLTEDGHASLTKDSLTIAKNGKKTKEKVTDVQYKNLLHSKFGITL
>NZ_CP009641.1|WP_001994099.1|2015302_2016844_-|alpha-amylase
MLKRIIVVGLSVVLFLPSIYGGSKVYADTVNNGTLMQYFEWYAPNDGNHWNRLHSDAGNLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNIEVSGDYEINAWTGFNFSGRGDAYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIRTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
>NZ_CP009641.1|WP_000417236.1|2027264_2027918_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFLLYILTNYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNEQI
>NZ_CP009641.1|WP_000538119.1|2027934_2028186_-|hypothetical-protein
MGVGTTAVSAFAGAKLGAAVGTVFGGPIGTVAGACIGFGVSIGASIVTDGIKFNKGDWNHDGKQDSIKDKVKTGIGAALDKII
>NZ_CP009641.1|WP_000422619.1|2028522_2030142_-|FAD-dependent-monooxygenase
MELNYVPVLIVGGGLSGLASALFLAKHNVDYSLVERHTSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKALENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARTLGGELSFYHELVSYEQNEQGVIATIRNRETEEESIIHCDYVIAADGAKSKIREQLGISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFSMVLHPEVLGALIPVDNERRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVESEIVSVLPWEATESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKANPKLLETYHEERYPVAKLTTYYASSLLFRAANREESSLNIMDGLAVTVGYQYSSKAIIDDSDNPHRMDSVELNGRPGTRAPHFFGTYDGKEISILDLLGNDFVLLTISENRTWAEYVQNVSSTLGINIKFYSVGLRGDFIAQEDIFSKLYGIENGGAVLIRPDAFIGWRLEKEVVNLDVVLEEVMGNLLCDF
>NZ_CP009641.1|WP_000571876.1|2030605_2031010_+|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILFVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLGLLKNLVLDIEKLLHNFYPTLTGSKTPTSEFSESKEFR
>NZ_CP009641.1|WP_000646423.1|2031119_2032118_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVIVKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKPVIDRVFSFEDAQKAMEYSEAGRAKGKIIVKIK
>NZ_CP009641.1|WP_000164935.1|2032296_2033763_+|YdiU-family-protein
MTKNNEVGWNLDNSYATLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYEKQWFIGMKKKLGLFSNEEQDQSLIEQLFKMMEKYKADYTNTFRSLTLDTLENTPLFDSPEFKEWYKLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNRPYRTFCGT
>NZ_CP009641.1|WP_042516386.1|2034018_2035113_+|hypothetical-protein
MNVQLQGNEQITKLFNDWYRIILQHQTIEATKIKNDIEDKISNSDKDTNLLLYYSLLNFRYEVLTNGLNITKDAFNKIDSYPIPENNCLTYYYHFFKAIHNTILADYNEAKNHFEKAEKLLKYVPEELELAEFNYRIASFYYQIYKPLLAINYIQQAKIFFSTHTGYEVNLAACDNIFGLSCLDLRQFEQAEESFNSAIDILKKKGEESLLLRTRNNIGLLYANQNLSSLAIRHLSEVTESMPNHFKALYLQADEYLKLGEKESASQFIERGLSVCNKLEIKEYQYRFKILDELCKESNTIEIEKVVLAGVSYFETEELWECIEEYTERIANKFYAEENHFKASKYFYLSNQARKKSLAKGALK
>NZ_CP009641.1|WP_000719639.1|2035112_2035250_+|Phr-family-secreted-Rap-phosphatase-inhibitor
MKKIGLTLSAIALTLILSFGFSHNSKDVALNKGDTWSPAYGLKQA
>NZ_CP009641.1|WP_000275811.1|2035324_2035924_-|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYKIIEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDLNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVERRKLVVGELEKVGSEGSRGIAELMKD
>NZ_CP009641.1|WP_001994226.1|2036058_2036586_-|GrpB-family-protein
MKQRITIEEYNIKWESEFNKLQTLINDVMEDSILSIEHVGSTSIKGLAAKPVLDIDIVIEDYVFFPKVVTKLEAIGYYHQAEWSYKGREAFGRKDAFVPWDGESADWMEHHLYVCDKESEELRRHIAFRDYLREHEDVAVEYGHLKEELARETKSRTSYSEGKTAFITNILEKIN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009641_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_2

2238514-2238936

Orphan

Consensus_repeat	Method
ACTGGACCTCANGGTGCT	CRT

10 spacers

The CRISPR arrays of NZ_CP009641_2

>merge|NZ_CP009641|2|2238514-2238936|CRT
ACTGGACCTACTGGGCCTACTGGGCCAGCTGGTGCTACTGGACCTCAGGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGCTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTATT

>NZ_CP009641|2|1|2238514-2238936|CRT
ACTGGACCTACTGGGCCT	ACTGGGCCAGCTGGTGCT
ACTGGACCTCAGGGTGCT	CAAGGTAACACAGGTGCTACTGGTGCC
ACTGGACCTCAAGGTGCT	CAAGGTAACACAGGTGCTACTGGTGCC
ACTGGACCTCAAGGCGCT	CAAGGTAACACGGGCGCT
ACTGGACCTCAGGGTGCT	CAAGGTAACACGGGCGCT
ACTGGACCTCAGGGTGTT	CAAGGTAACACGGGCGCTACTGGTGCC
ACTGGACCTCAAGGTGCT	CAAGGTAACACAGGTGCTACTGGTGCC
ACTGGACCTCAAGGTGCT	CAAGGTAACACAGGTGCT
ACTGGACCTCAAGGCGCT	CAAGGACCAGCGGGTGCTACTGGCGCT
ACTGGACCTCAAGGTGCT	CAAGGTAACACAGGTGCT
ACTGGACCTCAGGGTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_000228316.1\|2249535_2250078_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP009641.1\|WP_001989514.1\|2250389_2250731_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000391400.1\|2233627_2234902_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP009641.1\|WP_000813896.1\|2241596_2241821_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP009641.1\|WP_000032393.1\|2229234_2229777_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP009641.1\|WP_000734626.1\|2243285_2244218_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP009641.1\|WP_000135328.1\|2230416_2231751_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP009641.1\|WP_001179102.1\|2248255_2249419_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP009641.1\|WP_000640848.1\|2246436_2247348_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP009641.1\|WP_000438185.1\|2235887_2236844_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP009641.1\|WP_000814423.1\|2242977_2243223_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000704637.1\|2244566_2246423_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|182066
NZ_CP009641.1\|WP_000450309.1\|2236957_2237923_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP009641.1\|WP_000504940.1\|2241842_2242796_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP009641.1\|WP_000312272.1\|2234994_2235618_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP009641.1\|WP_001102624.1\|2229769_2230093_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP009641.1\|WP_001994668.1\|2232363_2233635_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP009641.1\|WP_000656783.1\|2231799_2232189_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP009641.1\|WP_000957268.1\|2247344_2248097_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP009641.1\|WP_000368856.1\|2230212_2230371_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_000228316.1\|2249535_2250078_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP009641.1\|WP_000391400.1\|2233627_2234902_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP009641.1\|WP_000813896.1\|2241596_2241821_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP009641.1\|WP_000032393.1\|2229234_2229777_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.79006e-84
NZ_CP009641.1\|WP_000734626.1\|2243285_2244218_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.45308e-35
NZ_CP009641.1\|WP_000135328.1\|2230416_2231751_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP009641.1\|WP_001179102.1\|2248255_2249419_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP009641.1\|WP_000640848.1\|2246436_2247348_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.78514e-142
NZ_CP009641.1\|WP_000438185.1\|2235887_2236844_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NZ_CP009641.1\|WP_000704637.1\|2244566_2246423_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	1.23985e-140
NZ_CP009641.1\|WP_000450309.1\|2236957_2237923_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13
NZ_CP009641.1\|WP_000504940.1\|2241842_2242796_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NZ_CP009641.1\|WP_001102624.1\|2229769_2230093_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.87607e-24
NZ_CP009641.1\|WP_001994668.1\|2232363_2233635_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP009641.1\|WP_000656783.1\|2231799_2232189_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP009641.1\|WP_000957268.1\|2247344_2248097_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NZ_CP009641.1\|WP_000312272.1\|2234994_2235618_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60

>NZ_CP009641.1|WP_000450309.1|2236957_2237923_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NZ_CP009641.1|WP_000438185.1|2235887_2236844_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NZ_CP009641.1|WP_000312272.1|2234994_2235618_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP009641.1|WP_000391400.1|2233627_2234902_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP009641.1|WP_001994668.1|2232363_2233635_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKLADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAVFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP009641.1|WP_000656783.1|2231799_2232189_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP009641.1|WP_000135328.1|2230416_2231751_-|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP009641.1|WP_000368856.1|2230212_2230371_-|hypothetical-protein
MDNIVVCEMNRMGARKTFEKNHEDYLKYVLAMNENVEIEICVVLIASWRGWM
>NZ_CP009641.1|WP_001102624.1|2229769_2230093_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGGTQLNLLVTEWRDFAKGVQEIIEGVQWDE
>NZ_CP009641.1|WP_000032393.1|2229234_2229777_-|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKNESDIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLLAIIAFIFSFWVGGIVSVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKGE
>NZ_CP009641.1|WP_000813896.1|2241596_2241821_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP009641.1|WP_000504940.1|2241842_2242796_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP009641.1|WP_000814423.1|2242977_2243223_+|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYVQNQFCSAYKIITGKTIYPFQ
>NZ_CP009641.1|WP_000734626.1|2243285_2244218_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVTKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP009641.1|WP_000704637.1|2244566_2246423_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKVDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP009641.1|WP_000640848.1|2246436_2247348_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP009641.1|WP_000957268.1|2247344_2248097_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP009641.1|WP_001179102.1|2248255_2249419_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NZ_CP009641.1|WP_000228316.1|2249535_2250078_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP009641.1|WP_001989514.1|2250389_2250731_-|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009641_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_3

2239069-2240130

Orphan

Consensus_repeat	Method
GTTCAAGGNNNNNCNGGT	CRT

24 spacers

The CRISPR arrays of NZ_CP009641_3

>merge|NZ_CP009641|3|2239069-2240130|CRT
GTTCAAGGACCAGCAGGCGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTGTTCAAGGACCAGCAGGCGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAGGGTGTTCAAGGACCAGCGGGTGCTACCGGTGCCACTGGACCTCAAGGTATTCAAGGACCAGCAGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGACCAGCAGGTGCTACCGGTGCTACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACCGGTGCTACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACGGGC

>NZ_CP009641|3|2|2239069-2240130|CRT
GTTCAAGGACCAGCAGGC	GCTACTGGCGCTACTGGACCTCAAGGC
GTTCAAGGTAACACAGGT	GCTACTGGACCTCAGGGT
GTTCAAGGACCAGCAGGC	GCTACTGGCGCTACTGGACCTCAAGGC
GTTCAAGGTAACACAGGT	GCTACTGGCGCTACTGGACCTCAAGGC
GTTCAAGGTAACACAGGT	GCTACTGGACCTCAGGGT
GTTCAAGGTAACACAGGT	GCTACTGGCGCTACTGGACCTCAAGGC
GTTCAAGGTAACACAGGT	GCTACTGGACCTCAGGGT
GTTCAAGGTAACACAGGT	GCTACTGGCGCTACTGGACCTCAAGGC
GTTCAAGGTAACACAGGT	GCTACTGGCGCTACTGGACCTCAGGGT
GTTCAAGGACCAGCGGGT	GCTACCGGTGCCACTGGACCTCAAGGT
ATTCAAGGACCAGCAGGT	GCTACTGGTGCCACTGGACCTCAAGGT
GTTCAAGGTAACACAGGT	GCTACTGGACCTCAGGGT
GTTCAAGGTAACACAGGT	GCTACTGGCGCTACTGGACCTCAAGGC
GCTCAAGGACCAGCGGGT	GCTACTGGCGCTACTGGACCTCAAGGC
GTTCAAGGTAACACGGGT	GCTACTGGTGCCACTGGACCTCAAGGC
GCTCAAGGACCAGCGGGT	GCTACTGGTGCCACTGGACCTCAAGGC
GCTCAAGGACCAGCGGGT	GCTACTGGTGCCACTGGACCTCAAGGT
GTTCAAGGGCCAGCAGGT	GCTACCGGTGCCACTGGACCTCAAGGT
GTTCAAGGGCCAGCAGGT	GCTACCGGTGCCACTGGACCTCAAGGT
GTTCAAGGACCAGCAGGT	GCTACCGGTGCTACTGGACCTCAAGGT
GTTCAAGGGCCAGCAGGT	GCTACCGGTGCCACTGGACCTCAAGGT
GTTCAAGGTAACACGGGT	GCTACCGGTGCTACTGGACCTCAAGGT
GTTCAAGGGCCAGCAGGT	GCTACCGGTGCCACTGGACCTCAAGGT
GTTCAAGGTAACACGGGT	GCTACTGGTGCCACTGGACCTCAAGGT
GCTCAAGGTAACACGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_000228316.1\|2249535_2250078_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP009641.1\|WP_001989514.1\|2250389_2250731_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000391400.1\|2233627_2234902_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP009641.1\|WP_000813896.1\|2241596_2241821_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP009641.1\|WP_000032393.1\|2229234_2229777_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP009641.1\|WP_000734626.1\|2243285_2244218_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP009641.1\|WP_000135328.1\|2230416_2231751_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP009641.1\|WP_001179102.1\|2248255_2249419_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP009641.1\|WP_000640848.1\|2246436_2247348_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP009641.1\|WP_000438185.1\|2235887_2236844_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP009641.1\|WP_000814423.1\|2242977_2243223_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000704637.1\|2244566_2246423_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|182066
NZ_CP009641.1\|WP_000450309.1\|2236957_2237923_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP009641.1\|WP_000504940.1\|2241842_2242796_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP009641.1\|WP_000312272.1\|2234994_2235618_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP009641.1\|WP_001102624.1\|2229769_2230093_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP009641.1\|WP_001994668.1\|2232363_2233635_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP009641.1\|WP_000656783.1\|2231799_2232189_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP009641.1\|WP_000957268.1\|2247344_2248097_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP009641.1\|WP_000368856.1\|2230212_2230371_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_000228316.1\|2249535_2250078_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP009641.1\|WP_000391400.1\|2233627_2234902_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP009641.1\|WP_000813896.1\|2241596_2241821_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP009641.1\|WP_000032393.1\|2229234_2229777_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.79006e-84
NZ_CP009641.1\|WP_000734626.1\|2243285_2244218_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.45308e-35
NZ_CP009641.1\|WP_000135328.1\|2230416_2231751_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP009641.1\|WP_001179102.1\|2248255_2249419_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP009641.1\|WP_000640848.1\|2246436_2247348_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.78514e-142
NZ_CP009641.1\|WP_000438185.1\|2235887_2236844_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NZ_CP009641.1\|WP_000704637.1\|2244566_2246423_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	1.23985e-140
NZ_CP009641.1\|WP_000450309.1\|2236957_2237923_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13
NZ_CP009641.1\|WP_000504940.1\|2241842_2242796_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NZ_CP009641.1\|WP_001102624.1\|2229769_2230093_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.87607e-24
NZ_CP009641.1\|WP_001994668.1\|2232363_2233635_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP009641.1\|WP_000656783.1\|2231799_2232189_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP009641.1\|WP_000957268.1\|2247344_2248097_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NZ_CP009641.1\|WP_000312272.1\|2234994_2235618_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60

>NZ_CP009641.1|WP_000450309.1|2236957_2237923_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NZ_CP009641.1|WP_000438185.1|2235887_2236844_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NZ_CP009641.1|WP_000312272.1|2234994_2235618_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP009641.1|WP_000391400.1|2233627_2234902_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP009641.1|WP_001994668.1|2232363_2233635_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKLADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAVFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP009641.1|WP_000656783.1|2231799_2232189_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP009641.1|WP_000135328.1|2230416_2231751_-|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP009641.1|WP_000368856.1|2230212_2230371_-|hypothetical-protein
MDNIVVCEMNRMGARKTFEKNHEDYLKYVLAMNENVEIEICVVLIASWRGWM
>NZ_CP009641.1|WP_001102624.1|2229769_2230093_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGGTQLNLLVTEWRDFAKGVQEIIEGVQWDE
>NZ_CP009641.1|WP_000032393.1|2229234_2229777_-|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKNESDIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLLAIIAFIFSFWVGGIVSVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKGE
>NZ_CP009641.1|WP_000813896.1|2241596_2241821_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP009641.1|WP_000504940.1|2241842_2242796_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP009641.1|WP_000814423.1|2242977_2243223_+|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYVQNQFCSAYKIITGKTIYPFQ
>NZ_CP009641.1|WP_000734626.1|2243285_2244218_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVTKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP009641.1|WP_000704637.1|2244566_2246423_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKVDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP009641.1|WP_000640848.1|2246436_2247348_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP009641.1|WP_000957268.1|2247344_2248097_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP009641.1|WP_001179102.1|2248255_2249419_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NZ_CP009641.1|WP_000228316.1|2249535_2250078_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP009641.1|WP_001989514.1|2250389_2250731_-|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009641_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_4

3194055-3194162

Orphan

Consensus_repeat	Method
TATATCAGCGATTTTTTGAATATATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009641_4

>merge|NZ_CP009641|4|3194055-3194162|CRISPRCasFinder
TATATCAGCGATTTTTTGAATATATCAACCGCAACTCGAAATATATCAGCGATTTTTTAAATATATCGACCACAACTCGAAATATATCAGCGATTTTTTAAATATATC

>NZ_CP009641|4|2|3194055-3194162|CRISPRCasFinder
TATATCAGCGATTTTTTGAATATATC	AACCGCAACTCGAAATATATCAGCGATTTTTTAAATATATCGACCACAACTCGAAA
TATATCAGCGATTTTTTAAATATATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_000757115.1\|3197722_3198157_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_001057490.1\|3195542_3195869_-\|bacillithiol-system-redox-active-protein-YtxJ	unknown	unknown	gnl\|CDD\|378538
NZ_CP009641.1\|WP_001994537.1\|3192359_3192722_+\|DUF4288-domain-containing-protein	unknown	unknown	gnl\|CDD\|379479
NZ_CP009641.1\|WP_001998456.1\|3195868_3196426_-\|DUF948-domain-containing-protein	unknown	unknown	gnl\|CDD\|227109
NZ_CP009641.1\|WP_001982862.1\|3186760_3187450_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP009641.1\|WP_000389138.1\|3191743_3192040_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000637893.1\|3192121_3192358_+\|DUF3949-domain-containing-protein	unknown	unknown	gnl\|CDD\|315735
NZ_CP009641.1\|WP_001010636.1\|3198351_3198756_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369049
NZ_CP009641.1\|WP_001994520.1\|3198172_3198355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000023843.1\|3187451_3188906_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP009641.1\|WP_000042825.1\|3189815_3190742_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP009641.1\|WP_001994479.1\|3199157_3201128_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
NZ_CP009641.1\|WP_001103285.1\|3192757_3193756_-\|catabolite-control-protein-A	unknown	unknown	gnl\|CDD\|130546
NZ_CP009641.1\|WP_001994471.1\|3201102_3201876_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP009641.1\|WP_000475171.1\|3189055_3189736_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP009641.1\|WP_000494668.1\|3203159_3203708_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP009641.1\|WP_000738004.1\|3194407_3195424_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227188
NZ_CP009641.1\|WP_000267006.1\|3190870_3191269_+\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|184416
NZ_CP009641.1\|WP_000636582.1\|3191320_3191593_-\|DUF3917-domain-containing-protein	unknown	unknown	gnl\|CDD\|372449
NZ_CP009641.1\|WP_000654739.1\|3196568_3197684_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|225191

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_001998456.1\|3195868_3196426_-\|DUF948-domain-containing-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	4.44562e-36
NZ_CP009641.1\|WP_001994537.1\|3192359_3192722_+\|DUF4288-domain-containing-protein	gnl\|CDD\|379479	pfam14119, DUF4288, Domain of unknown function (DUF4288). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.	5.53555e-20
NZ_CP009641.1\|WP_000654739.1\|3196568_3197684_+\|aminopeptidase	gnl\|CDD\|225191	COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism].	2.90365e-128
NZ_CP009641.1\|WP_001982862.1\|3186760_3187450_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29328e-84
NZ_CP009641.1\|WP_000042825.1\|3189815_3190742_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	1.33024e-47
NZ_CP009641.1\|WP_000637893.1\|3192121_3192358_+\|DUF3949-domain-containing-protein	gnl\|CDD\|315735	pfam13133, DUF3949, Protein of unknown function (DUF3949). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 69 and 87 amino acids in length.	3.45415e-24
NZ_CP009641.1\|WP_001010636.1\|3198351_3198756_-\|PH-domain-containing-protein	gnl\|CDD\|369049	pfam06713, bPH_4, Bacterial PH domain. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown. Members of this family have a PH domain like structure.	4.32544e-11
NZ_CP009641.1\|WP_000023843.1\|3187451_3188906_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.51712e-61
NZ_CP009641.1\|WP_000636582.1\|3191320_3191593_-\|DUF3917-domain-containing-protein	gnl\|CDD\|372449	pfam13055, DUF3917, Protein of unknown function (DUF3917). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	5.52795e-24
NZ_CP009641.1\|WP_001994479.1\|3199157_3201128_-\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	1.28861e-06
NZ_CP009641.1\|WP_001103285.1\|3192757_3193756_-\|catabolite-control-protein-A	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	0
NZ_CP009641.1\|WP_001994471.1\|3201102_3201876_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.10556e-111
NZ_CP009641.1\|WP_000475171.1\|3189055_3189736_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	2.81957e-25
NZ_CP009641.1\|WP_000494668.1\|3203159_3203708_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.35937e-28
NZ_CP009641.1\|WP_000738004.1\|3194407_3195424_-\|hypothetical-protein	gnl\|CDD\|227188	COG4851, CamS, Protein involved in sex pheromone biosynthesis [General function prediction only].	4.95096e-63
NZ_CP009641.1\|WP_000267006.1\|3190870_3191269_+\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|184416	PRK13955, mscL, large conductance mechanosensitive channel protein MscL.	1.03243e-76
NZ_CP009641.1\|WP_001057490.1\|3195542_3195869_-\|bacillithiol-system-redox-active-protein-YtxJ	gnl\|CDD\|378538	pfam11009, DUF2847, Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed.	4.38943e-48

>NZ_CP009641.1|WP_001103285.1|3192757_3193756_-|catabolite-control-protein-A
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKTTTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGIVFMGEDITDIHAEEFKKSPVPIVLAASFDEQNETPSVNIDYTQAAYDAMKHFIEQGHKRIGFVSGPFIDKAGSAKKLQGYRKALEEAGISYDENLVIDGDYTYDSGIEAFEKLWSLDEKPTAIFVSSDEMALGVIHAAQDAGLNVPTDVEVLGFDNTRLALMVRPQLSTVVQPMYDIGAVAMRLLTKYMNKEKVEDHTVILPHRIQFRDSTK
>NZ_CP009641.1|WP_001994537.1|3192359_3192722_+|DUF4288-domain-containing-protein
MYAVKLLFESVHSGEPDPTKMDGHYEENHDTLFEESIILVKASSLEEAHALSEQIAIQSEHTYVNMYDEQITWTFRKVLHVFELDNAPFETGKELYARFLHVKKNETVDTIVQTYYPEYK
>NZ_CP009641.1|WP_000637893.1|3192121_3192358_+|DUF3949-domain-containing-protein
MIWISLIVLAYFIILVPIQYNYIKLLKEKQKKLNVSQNELYDNMSYEESQVHYHYQSNVFTIPASLVASIIYRVKHAA
>NZ_CP009641.1|WP_000389138.1|3191743_3192040_+|hypothetical-protein
MEDDIVGYFTQVERFDYITIDLDKKFFYMEVVQLETNITLLKISLNLDKDETIIAGNVKQYDPSRLEQFIQSFKHTAQTCLAHNLRSPEELFAFWKGN
>NZ_CP009641.1|WP_000636582.1|3191320_3191593_-|DUF3917-domain-containing-protein
MIVLWIITLCITAIFAYMTLKQNGLKRFVPGSILAGIALITYVTSIFIESVSVDMSTSFMFMGITLFASSLMILMVAGIILFIHMNSETL
>NZ_CP009641.1|WP_000267006.1|3190870_3191269_+|large-conductance-mechanosensitive-channel-protein-MscL
MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTGLKITFGKASIMYGKFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEELPEPTKEEELLGEIRDLLKQQNSSKDRA
>NZ_CP009641.1|WP_000042825.1|3189815_3190742_+|Gfo/Idh/MocA-family-oxidoreductase
MSKPNIGMIGLGSIAQKAYLPTFTKETNWNFVGAFTPNAEKRKQICQQYRIQDFHSIETLASECDAIFVHSSTASHYEIVSELLKKGIDVYVDKPLAATVEQAEKLVELSEKYNRKLMVGFNRRFVPMYVAAKEQAHHISWIRIEKHRTNKVGPYTYDFTMLDDYLHIVDTARWLANDELNVVHNMMQINEKNELLYGHHTYTTANGLLLSTAMHRHAGTNLEQIELVTAGKIIRVKNMNTFEVEQENSVSQSGSPSWETTLKQRGFEDAVHHFIDCVHGDTKPVVDGLEGLRTQQLLQSLLDDANKK
>NZ_CP009641.1|WP_000475171.1|3189055_3189736_+|ankyrin-repeat-domain-containing-protein
MFKKTVSMICCVIFLQGCSQEQEVKKEMTNMETALLTATEKQETNTVISLLKKGADINITDNKGRTPLMIATYKNDVKTAKALIDAGADVNIQDDMKNNPFLYAGAEGYLHILKLTIDAGADPSLTNRYGGTALIPASEHGYIDVIKELLTRTNIDINHVNKLGWTALMEAIVLSNGNETQQQVIRLLIEYGADINIPDNDGITPLEHARAHHFEEIEKILLEGRK
>NZ_CP009641.1|WP_000023843.1|3187451_3188906_-|HAMP-domain-containing-histidine-kinase
MSIKTRFLFSYIAVILVSITLILIAGFLIVFSITGDLEAVKNFYKSSYIQKPLTSEEENAYIELKTAAKKHQSQLLDESFVSSLEKEGVKIVVRKGETISYATKVFESVALKEALPKFESANINSRGTTELGDTFYRYVKFDFYFPQEEEGSIFVLKKQSSFVDLTQKLFPILFVSLLLLAILLIGLLSYLVSRSVIKPIFVLKDATGKIKEGNLDFQIPVTSHDEIGQLNQGFEEMRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLTTIHTKARHMDTLIDELFLFSKLDLNRVPFQFETVELNMFMQELIEEMQMDLSKEGIEVNLQLHASPLYVTADCEKINRVISNLIHNSVKYMDKEEKKITVTVSSDNNKVIVKVMDNGSGIESDTLPYIFERFYRAEQSRNSSTGGSGLGLAIAKQIIEEHGGNIWAESELGEGTSIFFSLEKVEKCGE
>NZ_CP009641.1|WP_001982862.1|3186760_3187450_-|response-regulator-transcription-factor
MKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQMALQEDYDLIILDIMLPKMNGFEICKQIRAIKDIPILLVSAKKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHISRYERLLGNVSKQRDTLYIHGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV
>NZ_CP009641.1|WP_000738004.1|3194407_3195424_-|hypothetical-protein
MKKMALSFAVVSLLLGACSNDTISKKDEVIQKDTKEKSMIPRTAVSKDYYRTVIPLKEQKVINTANIKTNSKLDLAEYENGLMNIAKEQFDTENHVLQLNQYIPEKLVDELVAKVEAPVLTNIIEQDYFGKQNSNELSLSGVMIGLAMSSSVSNEEAMSKGTEVANQLIEAIHKNDKYNKSPITFAIFKQESTSSLKNGTYIASATVQKNDTNLGNWNAIEEKAYSYPSDEFTQAHGEDNTKINKFAEEMKGFSPGDFIPVNAKVSYKKNQMDTLNMNIVIKYNGKTELMALTQLAAQIMLEQLPKDAKVQLQIKSENKIEAIVIKEKNSDKPFVSFL
>NZ_CP009641.1|WP_001057490.1|3195542_3195869_-|bacillithiol-system-redox-active-protein-YtxJ
MNMTKVETIEELEVLVEKNEPYVLFKHSTTCPISHGAYTEFQAYCSEERAVPAYYLYVQDARDVSNRVAEQYSIKHESPQVLYIKDGMVVWNTSHWNIKKDALEENIK
>NZ_CP009641.1|WP_001998456.1|3195868_3196426_-|DUF948-domain-containing-protein
MYNRGKYEKDKGSDEMQVLLYVSAAIIAVAFAVLVVYVCRTLLSVQKTLENVASTLEGLEKQMQGISVETEQLLHKTNALADDIQQKSQSLNKVVSGVDGIGTTIHSLNTKLRNVSESVTDEIENNADKVAQVVQWSSAAIEVYNHYRATRQEKKVEKEERKLERLEKKAEKKEKRSRLRMRGES
>NZ_CP009641.1|WP_000654739.1|3196568_3197684_+|aminopeptidase
MKDPRIEKLAYNLINYSIRLQKGEKVLIENFGLQKELVTALVKEAYAAGGFPFVSLKDHQVDRSLLMGATEEHFEQIAAYEASVMKDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDIRVPKTRWVVLRYPNASMAQLAKMSTEAFEDFYFEVCNLDYGKMDKAMDSLVTLMNKTDKVRLTGPGTDLTFSIKDIPAIKCSGHLNIPDGEVYSAPVRDSVNGTVSYNTPSPYNGYTFENVQLKFENGQIVEATANDTERINKIFDTDEGARYVGEFAIGVNPYILHPMGDILFDEKIDGSFHFTPGQAYDDAWNGNNSNIHWDLVCIQRPEYGGGEIYFDDVLIRKDGRFVVPELEALNPENLK
>NZ_CP009641.1|WP_000757115.1|3197722_3198157_-|hypothetical-protein
MKKVLMLFVLLLTASVLLLGCSMKKEKADMNLEKAQKVEIESLTDSSEKKVITDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKELHEIGTMIVYKDVPYVEVEMKNKKMSFKVPEDAAKELLKY
>NZ_CP009641.1|WP_001994520.1|3198172_3198355_-|hypothetical-protein
MKYVKPLFCLEILFVIVGCTRVYTKWDLPLYVPIVIGTIAVALLYYFHFQQTKSEKSSSI
>NZ_CP009641.1|WP_001010636.1|3198351_3198756_-|PH-domain-containing-protein
MNFPIQRSKSVVIFVCLTLAFMFVYPLVMIVTNKEQWMSALIGMGLCFLVNVPLVWEVFIKQHKVENGVLKYGILNDDIVLKEIRIIRQVGKSLEITTNAYKVHMVAMPQDMNEFLVLIEKENPHVKIEMAGKK
>NZ_CP009641.1|WP_001994479.1|3199157_3201128_-|ABC-transporter-permease
MNFRQFALNNVIRNKRLYLGHFLSSTFAVIILFTFELLTFHPNFTGNLVSTSATISALGTQGFKIAQYLIIFFSFFFILYSITTFLKARKKEFGILILHGMSNSQLKKLIFMENLLIGCSAIIVGIGTGLVFGKLILLISASIFLLEGGLPFYFPIKAILVTSSIFFILFILVSFFTVRVMKVSQVIELLKAEEKPKKEPKSSKWLAFFSILCIIIGYVSAFCLDTALNNGNAYIYVMLICVCSSVLGTYFLFTQLSFYVIKMLKKRQHTFLKRTNMLTISELTYRITDNARTLFLVSILSAVAFTSIGACLAIGNGALAEVDSPYAFEYTSLKGNKEESSHISQIEKQLHDAGFSYKLVTSTGFDTEDGSTIMNLTDYNATAKTLGYSAEILKKETDSLILASKKYLRTASQKELKKVSASLTIEHGNMHFNLSGNKILRDNIISPSSHISVVVSDSMYETILNTKQLAEVKADQHKVYRFLIENMHETAAVAKKLEKLIPNDYVNPYRLFMFKCSVLNWLEGKQVNAILSIISVLVGVVFFIFAISFLYFRLFTDLDRDKSQFQMLSKIGLTKRELKKTVTQQTSILFFVPILISVLHSSVAFLAIRFLAQKKQIELPVAENSILIFTSFISVQIIYYLIIRKKYLRQILHSIK
>NZ_CP009641.1|WP_001994471.1|3201102_3201876_-|ABC-transporter-ATP-binding-protein
MSILTVRNLNKIYSTGKVSYKALSNIDLTIQKGEFVGIMGASGSGKSTLLNMISTIDTPTFGEVFINEKNPYCLSSNDLALFRRRELGFVFQSFNLMNTLTVKENIVLPLTLDNVSLNDMNEKVEVISKQLGIEKILNKRTYEISGGQAQRTAIARALIHSPQLILADEPTGNLDSKAANDVMELLKKLNQEEQVTMMLVTHDPVAASYCDRVVFMKDGSFYNEIYCGENRSIFHKNIMDVVSLLGGNQHEFSSVRA
>NZ_CP009641.1|WP_000494668.1|3203159_3203708_-|GNAT-family-N-acetyltransferase
MFTLRVDDEIELQLLEKHHKEELYQLINQNRNHLRRWLPWVDGTKSADAYNEICPMWLKKFAEGDGFESGIRYKGKLVGMVGIHPVSWGKKAASLGYYLAEDAGGKGIMTRSVKAVLHYAFENLKLNKMEIRCGVDNVKSRAIPERLGFKLDGILRDEEWLYDHFHDIAVYSLLASEWKEIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009641_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_5

3369233-3369319

Orphan

Consensus_repeat	Method
GATATATCTTAAAAATCGCTGATATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009641_5

>merge|NZ_CP009641|5|3369233-3369319|CRISPRCasFinder
GATATATCTTAAAAATCGCTGATATATTTTAAGTATCGGTCGATAAAATGTGAAAATCGCCGATAAAAGTTAAGAATCGCTGATATA

>NZ_CP009641|5|3|3369233-3369319|CRISPRCasFinder
GATATATCTTAAAAATCGCTGATATA	TTTTAAGTATCGGTCGATAAAATGTGAAAATCGCC
GATAAAAGTTAAGAATCGCTGATATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_000957374.1\|3365861_3366593_+\|yteA-family-sporulation-protein	unknown	unknown	gnl\|CDD\|274340
NZ_CP009641.1\|WP_000842310.1\|3398261_3399257_+\|potassium-channel-protein	unknown	unknown	gnl\|CDD\|369572
NZ_CP009641.1\|WP_000449557.1\|3358085_3359531_-\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|235146
NZ_CP009641.1\|WP_000728866.1\|3378519_3382743_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173800
NZ_CP009641.1\|WP_000057610.1\|3374397_3375528_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP009641.1\|WP_033681254.1\|3371801_3373232_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP009641.1\|WP_001260120.1\|3368225_3368948_+\|lipase-family-protein	unknown	unknown	gnl\|CDD\|238287
NZ_CP009641.1\|WP_001193054.1\|3366637_3366838_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP009641.1\|WP_000494083.1\|3369374_3371783_-\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|340853
NZ_CP009641.1\|WP_001994498.1\|3373344_3374379_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP009641.1\|WP_001059246.1\|3361458_3363213_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|236020
NZ_CP009641.1\|WP_000386685.1\|3397485_3398166_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP009641.1\|WP_001994538.1\|3382914_3383859_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|178836
NZ_CP009641.1\|WP_000616715.1\|3363209_3364604_-\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
NZ_CP009641.1\|WP_000053948.1\|3377881_3378487_+\|cell-division-protein-FtsN	unknown	unknown	gnl\|CDD\|372085
NZ_CP009641.1\|WP_001147838.1\|3367164_3367947_+\|TIGR00266-family-protein	unknown	unknown	gnl\|CDD\|376704
NZ_CP009641.1\|WP_001994463.1\|3375475_3377413_-\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445
NZ_CP009641.1\|WP_001103368.1\|3360649_3361462_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	unknown	unknown	gnl\|CDD\|274729
NZ_CP009641.1\|WP_000425747.1\|3364798_3365752_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP009641.1\|WP_000963876.1\|3359761_3360580_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|180958

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_000957374.1\|3365861_3366593_+\|yteA-family-sporulation-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	7.0071e-76
NZ_CP009641.1\|WP_000842310.1\|3398261_3399257_+\|potassium-channel-protein	gnl\|CDD\|369572	pfam07885, Ion_trans_2, Ion channel. This family includes the two membrane helix type ion channels found in bacteria.	1.50592e-14
NZ_CP009641.1\|WP_000449557.1\|3358085_3359531_-\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|235146	PRK03640, PRK03640, o-succinylbenzoate--CoA ligase.	0
NZ_CP009641.1\|WP_000728866.1\|3378519_3382743_+\|S8-family-serine-peptidase	gnl\|CDD\|173800	cd07474, Peptidases_S8_subtilisin_Vpr-like, Peptidase S8 family domain in Vpr-like proteins. The maturation of the peptide antibiotic (lantibiotic) subtilin in Bacillus subtilis ATCC 6633 includes posttranslational modifications of the propeptide and proteolytic cleavage of the leader peptide. Vpr was identified as one of the proteases, along with WprA, that are capable of processing subtilin. Asp, Ser, His triadPeptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	4.25453e-72
NZ_CP009641.1\|WP_000057610.1\|3374397_3375528_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP009641.1\|WP_033681254.1\|3371801_3373232_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP009641.1\|WP_001260120.1\|3368225_3368948_+\|lipase-family-protein	gnl\|CDD\|238287	cd00519, Lipase_3, Lipase (class 3). Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. .	6.32344e-48
NZ_CP009641.1\|WP_001193054.1\|3366637_3366838_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	2.0492e-32
NZ_CP009641.1\|WP_000494083.1\|3369374_3371783_-\|glycogen-phosphorylase	gnl\|CDD\|340853	cd04300, GT35_Glycogen_Phosphorylase, glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0
NZ_CP009641.1\|WP_001994498.1\|3373344_3374379_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	6.50218e-124
NZ_CP009641.1\|WP_001059246.1\|3361458_3363213_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|236020	PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated.	0
NZ_CP009641.1\|WP_000386685.1\|3397485_3398166_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	4.42486e-52
NZ_CP009641.1\|WP_001994538.1\|3382914_3383859_-\|L-lactate-dehydrogenase	gnl\|CDD\|178836	PRK00066, ldh, L-lactate dehydrogenase; Reviewed.	0
NZ_CP009641.1\|WP_000616715.1\|3363209_3364604_-\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	2.58992e-115
NZ_CP009641.1\|WP_000053948.1\|3377881_3378487_+\|cell-division-protein-FtsN	gnl\|CDD\|372085	pfam12389, Peptidase_M73, Camelysin metallo-endopeptidase.	1.26785e-97
NZ_CP009641.1\|WP_001147838.1\|3367164_3367947_+\|TIGR00266-family-protein	gnl\|CDD\|376704	pfam01987, AIM24, Mitochondrial biogenesis AIM24. In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.	2.19617e-86
NZ_CP009641.1\|WP_001994463.1\|3375475_3377413_-\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
NZ_CP009641.1\|WP_001103368.1\|3360649_3361462_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	9.62975e-130
NZ_CP009641.1\|WP_000425747.1\|3364798_3365752_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	1.86783e-131
NZ_CP009641.1\|WP_000963876.1\|3359761_3360580_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|180958	PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated.	0

>NZ_CP009641.1|WP_001260120.1|3368225_3368948_+|lipase-family-protein
MRTPLSFDKDTAILLASCCELTYEQYKQNGIFEIPDGFQYVQGFQGKTIQTTEWFGFILESEDTIIVAFRGTQTDTDWIIDSLVNQKPYPYALNSGNVHNGFLSIYESCRDSIMDMLVSLPAHKKLLATGHSLGGALATLHILDARINTAFAQYGLYTFASPKVGDIAFRNYYKLQVASSFRFVNLFDVVPLLPPRNVHFNEQDWEYAHVHHNMTFTKNTKSIANNHAMTTYKTCLTSHF
>NZ_CP009641.1|WP_001147838.1|3367164_3367947_+|TIGR00266-family-protein
MQAHEIEYKLYGDDMQFVEIELDPEESVIAEAGAMMMMEDYIEMETIFGDGSGPSGGLFGKLMGAGKRLVTGESMFMTVFTNTGHGKRHVSFAAPYPGKIIPVDLTEYQGKVVCQKDAFLCAAKGVSIGIEFTKKIGTGFFGGEGFIMQKLEGDGLAFMHAGGTVYKRELKPGEKLRIDTGCLVAMTKDVNYDVEFVGKVKTALFGGEGLFFATLEGPGTVWIQSLTLSRLSARLTSPAAQGSGEGSVLGGLGRLLDGKE
>NZ_CP009641.1|WP_001193054.1|3366637_3366838_-|cold-shock-protein
MQTGKVKWFNSEKGFGFIEVEGGDDVFVHFSAIQGDGFKTLEEGQEVSFEIVEGNRGPQAANVTKN
>NZ_CP009641.1|WP_000957374.1|3365861_3366593_+|yteA-family-sporulation-protein
MLTPQQINQFKSVLEKQKQELEQTIQTHENEDRASERESVGELSSYDNHPADMATELYEREKDFGLIELWHKQLEDTKHALQKIEAGTYGICEVSGEEIPFERLEAMPTATTCIQHATNKLNMDTRPVEEEVLSPSFHKHDEDRSVEYDAEDAWQDVANYGTSETPADLERRDSKNYNGMYVNSEENVGYVEDFENFIGTDMYGKNPQVFATEEHEEYEQMLDDFEDRTFKGELSSNESSSKE
>NZ_CP009641.1|WP_000425747.1|3364798_3365752_+|1,4-dihydroxy-2-naphthoate-polyprenyltransferase
MEMNVETNSSPTAPKPSKQTGWRIWWSLLRPHTLTAAFVPVFIGTAYAMQVGGINQIHLPLFLIMLLACLLIQAATNMFNEYFDYKRGLDHEGSVGIGGAIVRDGIQPKTVLNLAFGFFGIAILLGVYICMNSSWWLAAIGLVCMAVAYLYTGGPLPIAYTPFGELTAGLFMGVIIIGISFFIQTGTVTSEVVLLSIPSSILIGAILLANNIRDLDGDKENGRKTLAILVGRERAVGVLASMFIVSYIWTIALIIVGIVSPWMLIVFLSAPKAFKATKGFIGKSIPMEMVPAMIATAKTNTIFGLLMGIGLLLGYFL
>NZ_CP009641.1|WP_000616715.1|3363209_3364604_-|isochorismate-synthase
MIQTKQIGLQEVLSAAIKRATDEKILVSFVKQIDWMDPLLFYAAGKRIAFENRCYFADPAQHVIFAGIGSVFTIATASHKRFQTARDEWDKVKEKAFVQREKYEFGTGPLLFGGFSFDQEKEKTDLWKEFDDTTFSLPAFLLTVKNEKAWLTMNTFVSATDCAETLYNEIVSLEEKIFEESKCALEGSKLTVTSKVEVDPKGWMKAIEKVQDEMKQGNVQKVVLARELKVEMDHHIDSALVLEALRIGQPDCYVFSFDYKGACFLGATPERLIRKEDEKFTSMCLAGSTGHGQSIEESKRNSNALLHDEKNLAEHGYVVNMIRSVLNEHCEYVNIPESPGLLTTKNLIHLYTPVEAKGDASLLTMVEELHPTPALGGTPRLEAMKLIRDVELLDRGLYGAPIGWIDDEGNGEFAVALRCGLLNGEKASLFAGCGIVIDSVPQLEYEETSLKFRPMLGALEELMK
>NZ_CP009641.1|WP_001059246.1|3361458_3363213_-|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MNNHIEALSYYLGAFVDELTRLNVCDVVISPGSRSTPIALLMEQHEGMNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQINLYGTFVKQFTEMALPEASEAMYHYARMTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLESLWDKGRGEYTGVVQQGNAVMPSEYVDSLVGRLSHMEKGLIICGDDSHSEIATFATQLAEKTGYPILADPLSNIRSGHHDKTMVIDCYDTFLRNELLKETWKPDVLIRFGGMPVSKALTQFIKKQTKAVHIVVDESGQWRDPALVATEVVQASDIAFCSALIEKMPVMKKNDWFRMWQHINEKTKETLREMETYDTAFEGRVITDIVRVLPEGATLFASNSMPIRDTDSFFFTSDKNIQVMANRGVNGIDGIISTALGASMICDPLVLVIGDLSFYHDLNGLLAAKLHELNITIVVVNNDGGGIFSFLPQYEKKEHFESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGATTEGLHVVEICTNRDENLTLHRKLWAKTQDVITTSLQGESK
>NZ_CP009641.1|WP_001103368.1|3360649_3361462_-|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLEREDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNSNGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDEKFFRILKNIEKCVSDAKFVKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
>NZ_CP009641.1|WP_000963876.1|3359761_3360580_-|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MAIEWVKEGNYEDIIYSTYNGIAKISINRPEVHNAFRPKTVMELIDAFAHARDDANVGVIILTGEGGRAFCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRAIPKPVIAMVAGYAIGGGHVLHIVCDLTIAADNAVFGQTGPKVGSFDGGYGAGYLARMVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQLEAETVQWAQEILANSPMALRFLKAAFNADTDGLAGIQQLAGDATLLYYTTDEAKEGRDAFKEKRSPDFGQFPRFP
>NZ_CP009641.1|WP_000449557.1|3358085_3359531_-|o-succinylbenzoate--CoA-ligase
METMPNWLKQRAFLTPDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQDFEAKDIPVYSFAEVMNGPKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDADFIHKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMLLGGGPAPKPLLETCVDKGIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLRIEKDGVVVPPFVEGEIVVKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPAQIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVVKSGEITEEEILHFCEEKLAKYKVPKKACFLEELPRNASKKLLRRELRQLVEEM
>NZ_CP009641.1|WP_000494083.1|3369374_3371783_-|glycogen-phosphorylase
MFTHVESFKSAFLEKLETMYGKSFKDSTTRDQYNTLGYMVREYMNSQWIATNESYRSGERKQMYYLSIEFLLGRLLGSNILNLGIRDVCEQGLSELGISLQQLEEVEADAGLGNGGLGRLAACFLDSLASLNLPGHGCGIRYKHGLFDQKIVDGYQVEFPEQWLLHENVWEVRRHDQAVEVSYFGNVEPLYIDGRLEFRHTNAEVIMAVPYDVPVVGYETSTVNTLRLWNAEPVPFPQNCKDILKYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVSASLQNIVRLHRERYGDLRQLHEKIAIHINDTHPVLAIPELMRILLDEEKLAWEEAWHITTQTISYTNHTTLSEALEKWPIHIFKPLLPRIYMIIEEINERFCHELWERYPYEWHRIEEMAIIAHDLVKMAHLAIVGSHSVNGVAKIHTEILKQREMRLFYEFYPDKFNNKTNGIAHRRWLMKANPQLTNLISEAIGTEWKKEPIKLQELQLVQYDASFQEKFAEVKQERKEILAERIHNTMGITIDPNSIFDVQVKRLHAYKRQLLNVLHILYLYNRLKEDASFTFYPRTFIFGAKASPGYYYAKKIIKLINELARKVNNDPYVSQYMKVIFLENYRVSLAEDIFPAADVSEQISTASKEASGTGNMKFMMNGAITLGTLDGANIEIKDRVGDDNCFIFGLTAEEVLHYYQNGGYRASDYYHHNGHIKKVVDQLTNGFFAQSGAEFEAIYDSLVIQNDEYFVLRDFGPYAERQEAVGRAYENRTKWLEMSILNIAQSGHFASDRTILQYSNEIWGIGNTVTQI
>NZ_CP009641.1|WP_033681254.1|3371801_3373232_-|glycogen-synthase-GlgA
MNILFAVSECVPFVKSGGLADVAGALPKELKKLGVEVRIILPNYSLIPQKLRDGCTLHKVINVPLGWRNQYCGILKGEQDGITYYLIDNEYYFKRDSLYGHYDDGERFSYFSKAVLECIPHLDFEVDVLHSHDWHTAMVNFLLREKYQDNPLYEHIKTVYTIHNLQFQGVFPPEVMYDLLELGDEYFHSEQLEFYGNVNFMKGGIIASDQITAVSPTYKEEIQYEFFGEKLDGLLRKYNDKLSGIVNGIDTSVYNPETDSYITAQYAVDSLYEKNENKRALQRYFGLPEKEDTPIISMVTRLTKQKGLDLVRTVFREIMEEDVQCIILGSGDSEYEQFFEWMAYEYPEKVKVYIGFNEELAHQVYAGSDLFLMPSLFEPCGLGQLIALAYGTIPIVRETGGLNDTVQSYDEETGEGNGFSFTNFNAHDMLHTVLRAIEFYHDKPVWDRLVKQAMTEDYSWEKSALAYKKLYKSLME
>NZ_CP009641.1|WP_001994498.1|3373344_3374379_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MGEKMLGIINATGSFPSLKKVTGHRSLAALPFGGRYRLIDFMLSNMVNSNIHSVAVFTSHKNRSLMDHVGSGKQWDLDRKRDGLFLFPPNCQCDQDEFGSFAHFRRHIDYFLRSREEYVVITNSHLVTALNFQAVLERHIHTAADITEVCHEGVPLQTYVLKKQLLLDLFEAYKDMEQYSLFDVVREKRGKSLHIATYEHTGYVAIIDSIESYYKHSLEILQPAIWKQVFKKEAPIFTKVKDEPPTRYVKGAAVKNTMIANGSIIEGEVENSVVSRSVKIGKGSIVRNSIIMQKSQIGDNCIIDGVIIDKDVKIGDGVVLKGNADEPYVVEKGSVQNSTINSYS
>NZ_CP009641.1|WP_000057610.1|3374397_3375528_-|glucose-1-phosphate-adenylyltransferase
MAQKQKCVAMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPDYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVEFEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVGTVKSLWEANMDLLRDETSLNLNDRDWRIYSVNPNEPPQYIAEKAKVEESLINEGCVIEGDVKHSVLFQGVTVEEGSMVIDSVVMPGAKIGKNVVIERAIVGSEMVIEDGTIIRPEKNVDDVVLIAEGK
>NZ_CP009641.1|WP_001994463.1|3375475_3377413_-|1,4-alpha-glucan-branching-protein-GlgB
MSVINCEEVKRDEFHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDYEQHKMLQVTEEGIWSLFIPHIEEREIYKYAIETMAGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWNDKNWSRKKKKKSVYKEAMTVYELHFGSWKKKEDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRYFHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLVTAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHDKMTFSLLYTYSENFILPLSHDEVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDWNLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSREGFQWIDANNNEQSIFSFIRQGDKQEDALVVVCNFTKATYDNYKVGVPDFEYYNEILNSDAEQYGGSGQVNKKRLKTIQEPYHNQTAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
>NZ_CP009641.1|WP_000053948.1|3377881_3378487_+|cell-division-protein-FtsN
MSLKQKVGMGVVTATLGLSLTFGGVFAYFSDSETSSNSFQAGTLDLSINPSVIIDVKDLKPGDFIERNFTLENKGTLDIAKVALETSYEVTDAKKNNDGEDLGDHIIVKFLVNDGKPSNPNDDHEILWETKLSQLKTMKPEDVATSLERHNLIDGIKSGETDYLHVLFSFEDNEQDQNTFQGDSLQLNWTFHAKQTPGTEK
>NZ_CP009641.1|WP_000728866.1|3378519_3382743_+|S8-family-serine-peptidase
MKKKNRFVTGIVTAGVLFSTALPFNVLAENPINQIDSSNAQSLLSKLSKEQRQALQTLDANPGFTISPDINTSSSEPVNIIVEFQTAPVKINELKQKEKGLQAAPENIKARIDQEHEEFQKGLKRLYHFSPSVKSGNFQSVQIKRSYKHAINGVALTLPANTVEELLRIGVVKRIWKDYEVKLNLPKQSEQKAPQKLTDSIPQIGVDKLHSEGITGKGIKVGVLDTGIDYNHPDLKDVYKGYRAKPGEDSSKIDPNSVKGWDFISNDADPMETTYTEWQQSGAPEFDDRGSSFYTAHGTHVAGIVSAQKKNTSDSAVKGVAPDIELYNYRVLGPYGSGDSSGIIAAIDKSISDGMNVINLSLGDDSNNPLDPTSIAVNNAMLSGVVTVVAAGNSGPNPATLGSPGASPFAITVGASDSSISLPKLSGHAGQVQFPNLILFGKNFTDKIEDFKGQSLPIESVGIGTANEFSQKDVKGKIALIARGTLSFDEKIANAKQAGAKAVIIYNNVDGEIPFYIGESTKYIPAFRLPKEDGEKLKAQIEQGNTSFTFDELTYIQTEGDHLADFSSRGPVTSNDDIKPDITAPGVAVLSTVPEYINDPQEGENYDVSYERMQGTSMASPHIAGVAALILQEHPEYSPFDVKASLMNTADDLKEKYSVYEVGAGRIDAYNAVHTETSFKVLDTTKTVVNDEIIEVPEETGSIAFGKFYQKDGEALEQKRNIKVENHNKQEKKEFKTEISYTPASSSINDAIANGVKVSTPETITLDAGKSDEIEAKINVPAGVKQGRYEGYIHITNTKNKEETYQIPFSIRVSEPGIEDAILSRKAISTDTTKFNPYRESYVHGAFQLNSNLETLDLIVKDSKTNKALGFLGTLNTSGLQTDVYYYLESFFNGKVYPFTNDSAKPIGDEKIDLPEGDYTIEFVGYDKDGKARVKDDYVVIDNTPPEVKLTGLKPGIYELNEENYAVEDGKKALWIKGNVYDSNVDYLKGKGLNITQEANGVMYYDYSPYLHKFLPIDANGDFKIGITPESFKVEGPMNTGVYIFDYATAGPDYPSGVNNYWFIQQGAQYAKASYDKKELYKGDEFTVTLNAKHVKQFVAGEFNVKFLEKNFKFANVKLNPAFEKLLSEKGVTAKVNEPKLEEGSVTVGGTIDDKNFAGLDGDFPFIDVTFKVENDEFYEANAQLESPVFVYWKPGETEPNRMRVLQDQTFSVMSLNSLVEGNIKPGAFLNERGYLDEKFDYTKLGVKVYATDSYRHKFEGSLDKYGYFKLNGLPVNKRDYNLFVEVPGHLTSRLTTKLGTEKDGKLLGQYYYARLDENLAGDVNGDKVIDIKDAEIIASNYGKKGLSVKDGDLNKDGIVDEKDIRFVEKNFLKKGPDASKSQTAAEKSKSGTLADILKKLGLTPKK
>NZ_CP009641.1|WP_001994538.1|3382914_3383859_-|L-lactate-dehydrogenase
MKKGINRVVLVGTGAVGCSYAYSMINQGVAEEFVLVDVNEAKAEGEAMDLSHAVPFSPSPTKVWSGSYADCKDADLVVITAGLPQKPGETRLDLVEKNTKIFKQIVRGIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGDYLDVDPRNVHAYIVGEHGDTELPVWSHATIGVQKLETILANNEQYKQEDLDKIFENVRDAAYHIIERKGATYYGIGMSLLRVTKAILNNENSVLTVSAYLEGQYGEKDAYVGVPAVINREGVREIVEIELNEEEKAKFAHSVKVLKETMAPVL
>NZ_CP009641.1|WP_000386685.1|3397485_3398166_+|MgtC/SapB-family-protein
MDYTDLLIKLGLSAILGFAIGLERELKRKPLGLKTCLVISIISCLLTIVSIKAAYNLPHTDHMNMDPLRLAAQIVSGIGFLGAGVILRRGNDSIAGLTTAAMIWGASGIGIAVGAGFYIEAIFGMCFLMISVELIPLTMKFVGPRSFRQRDIVVKLVVRNMDNIPVVIEEIKEMDIKVKNMKLKTLENGSHYLHLKLCIDQKRHTADVYYALQHLESVQQTEVESM
>NZ_CP009641.1|WP_000842310.1|3398261_3399257_+|potassium-channel-protein
MKSRPKLVDAFRDSIIFRLICFIVVLTAFSGFLIHILEPSHFTTWFDGIWWSIVTIFTVGYGDFAPHTLIGKLIGIGIILFGTGFCSYYMVLFATDMINKQYMKVKGEEAATSNGHMIIVGWNERAKHVVKQMHILQPNLDIVLIDETLSLLPKPFHHLEFIKGCPHHDQTLLKANITTAHTILITADKEKNESLADTQSILNILTAKGLNPNIHCIAELLTSEQIQNATRAGASEIIEGNKLTSYVFTASLLFPSISGVLFSLYNEISDNKLQLMELPSSCTGQTFANCSYTLLKQNILLLGIKRDEQYMINPVHSFVLIQSDILIVIHH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009641_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_6

3486189-3486311

Orphan

Consensus_repeat	Method
TTAAACAAACGTTTGATTAACTCCCTATTTTTCTTTGTTCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009641_6

>merge|NZ_CP009641|6|3486189-3486311|CRISPRCasFinder
TTAAACAAACGTTTGATTAACTCCCTATTTTTCTTTGTTCACTCTTGAGCTGCAACAATTTCTCCCTACCGAACATATCCCTTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCAC

>NZ_CP009641|6|4|3486189-3486311|CRISPRCasFinder
TTAAACAAACGTTTGATTAACTCCCTATTTTTCTTTGTTCAC	TCTTGAGCTGCAACAATTTCTCCCTACCGAACATATCCC
TTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_000929160.1\|3478589_3479375_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP009641.1\|WP_000171583.1\|3488688_3488880_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000218967.1\|3485616_3485982_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP009641.1\|WP_000722404.1\|3479614_3480421_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP009641.1\|WP_000713745.1\|3489852_3490500_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP009641.1\|WP_000026899.1\|3485191_3485575_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP009641.1\|WP_000568168.1\|3484044_3484344_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP009641.1\|WP_001994535.1\|3489181_3489709_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000735107.1\|3480493_3481306_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP009641.1\|WP_000666170.1\|3490555_3491569_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP009641.1\|WP_000601755.1\|3481987_3483013_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP009641.1\|WP_000475831.1\|3487109_3487352_-\|DUF3937-family-protein	unknown	unknown	gnl\|CDD\|372461
NZ_CP009641.1\|WP_127813462.1\|3491591_3492725_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427
NZ_CP009641.1\|WP_000525952.1\|3488895_3489126_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_001224776.1\|3486620_3486992_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000781219.1\|3483545_3483890_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000640869.1\|3484356_3484701_-\|DNA-primase	unknown	unknown	gnl\|CDD\|224572
NZ_CP009641.1\|WP_001982701.1\|3487975_3488365_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000359553.1\|3481329_3481995_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP009641.1\|WP_001002987.1\|3492788_3493037_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_000929160.1\|3478589_3479375_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	8.75164e-150
NZ_CP009641.1\|WP_000218967.1\|3485616_3485982_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.64822e-61
NZ_CP009641.1\|WP_000722404.1\|3479614_3480421_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	1.39287e-111
NZ_CP009641.1\|WP_000713745.1\|3489852_3490500_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	1.4759e-16
NZ_CP009641.1\|WP_000026899.1\|3485191_3485575_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	5.279e-70
NZ_CP009641.1\|WP_000568168.1\|3484044_3484344_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	8.74686e-18
NZ_CP009641.1\|WP_001002987.1\|3492788_3493037_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	9.62029e-15
NZ_CP009641.1\|WP_000735107.1\|3480493_3481306_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	8.97855e-111
NZ_CP009641.1\|WP_000666170.1\|3490555_3491569_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.06298e-86
NZ_CP009641.1\|WP_000475831.1\|3487109_3487352_-\|DUF3937-family-protein	gnl\|CDD\|372461	pfam13073, DUF3937, Protein of unknown function (DUF3937). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	3.99939e-30
NZ_CP009641.1\|WP_127813462.1\|3491591_3492725_-\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP009641.1\|WP_000601755.1\|3481987_3483013_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	3.41006e-176
NZ_CP009641.1\|WP_000640869.1\|3484356_3484701_-\|DNA-primase	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21
NZ_CP009641.1\|WP_000359553.1\|3481329_3481995_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	2.85082e-98

>NZ_CP009641.1|WP_000218967.1|3485616_3485982_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ
>NZ_CP009641.1|WP_000026899.1|3485191_3485575_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQNELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP009641.1|WP_000640869.1|3484356_3484701_-|DNA-primase
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSSHLANVLWGADIDVYTEYLR
>NZ_CP009641.1|WP_000568168.1|3484044_3484344_-|thioredoxin-family-protein
MIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYMELK
>NZ_CP009641.1|WP_000781219.1|3483545_3483890_-|hypothetical-protein
MKLYSLLQSFVNYANGQYHLEPLLRQGEKTVNFRFGDESCSLQISRDYIELLHEERGTEQIVCVGEEDVKQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>NZ_CP009641.1|WP_000601755.1|3481987_3483013_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKAKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQKDITKRFVQQLTDSEDTNETIESLIEKYPDGKVIRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP009641.1|WP_000359553.1|3481329_3481995_-|ABC-transporter-permease
MDKLLTNVDWNQMLEATGETLYMTAIAALATFILGLILGLLLFMTAKDNLWENKAVNTAIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFFIQWIGDRVTTRIDKR
>NZ_CP009641.1|WP_000735107.1|3480493_3481306_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDNDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEVAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVADHGRGLAILQKEGILKIKDGVDPVKATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIESNDSPYANVVAVRKGDKDKKEIKALVEVLHSKEIEDFINKEYKGAVVPVKE
>NZ_CP009641.1|WP_000722404.1|3479614_3480421_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKDLPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAISIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPVSE
>NZ_CP009641.1|WP_000929160.1|3478589_3479375_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINEMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETTEQEA
>NZ_CP009641.1|WP_001224776.1|3486620_3486992_-|hypothetical-protein
MRKFLISYIASLLTFTIIWFLIPYISDPSYSNENGLPNIVGFIVILIIFGSVLDLVACLIGEVLYRNIKQCRKFRFGIPVFIGLALIYIFILSLFTITSAYASSLVAPIIMGSLVFYVVRRKI
>NZ_CP009641.1|WP_000475831.1|3487109_3487352_-|DUF3937-family-protein
MFKNKKLIRFGLTLLVCLFVIDFTISYFQTYLESAAGIKWVISETWRTILLDVPESILVILGAIALYDFTKETSPKDASI
>NZ_CP009641.1|WP_001982701.1|3487975_3488365_-|hypothetical-protein
MLKTIKNTLLFFLCLVVLSGCFTREGTIVGGKVHGGSNSIDGKYKSFTGFATQDMDVKKGESWTFTFEDKTKQGTIKAYVLDSNDNAILEVNSGNSKNNIKVSKDDTYKVKIITEEHGGEFEISWKKEK
>NZ_CP009641.1|WP_000171583.1|3488688_3488880_-|hypothetical-protein
MTLESLKKNLKVLFVICFLGTIIFTMFDATYNLKEKIIFSLIYLITVPISFFILYKIGKFFIK
>NZ_CP009641.1|WP_000525952.1|3488895_3489126_-|hypothetical-protein
MGNAEVADKIDKNGFEIGEEASLAKYEAGIDIPIPFTDHDLHLGGLLKISSSGFKVKFPWGPGASPVDTGVEVEIK
>NZ_CP009641.1|WP_001994535.1|3489181_3489709_-|hypothetical-protein
MKRLSYFLVFILICLASAGCAMDKEGEKLEYNGRALVIGVVGEKPKDTFRNIKFEEMKLEELEKKSKEVDGFLIMKAHFQDASTDQYKNVFSSLKKPVFFIGLQDKSYSIFITKGIEYNSARKDGNAMYTQGFANIGSGEGQQWGIGLSNGGNVEESIHNMYIVVFQTIADYLNR
>NZ_CP009641.1|WP_000713745.1|3489852_3490500_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSAVHAVDVTTVVDDWIPFVKAFIIPYLIWFPYLYGALIYYCFADRKQYYVTLSSIILGKLACFSIYYFWQTTVPRPTVVGTDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHAFEYYILTFFGTLIILSTLFTKQHAFVDAVSGMTLASILYFGVQLLLAKETVRVPVKQNHKM
>NZ_CP009641.1|WP_000666170.1|3490555_3491569_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNAVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVVPAMVITYIVIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NZ_CP009641.1|WP_127813462.1|3491591_3492725_-|L-lactate-dehydrogenase
MINIFPVVTNMTKMEYNNSQKGQKLCSIFHKVSMVSIVGTSIIRSVRNKRNRLYDQLGEIAMKRHTRKIAIIGTGLVGSSCAYSIVNQGICEELLLIDINHERAVGEAMDLSHCINFTNTRTKVYAGSYEDCKDMDIVIITAGPAPKPGQSRLDTLGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYQVWKLSGLPRNRVIGTGTSLDSSRLRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKERFGEIDLDEIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYGEYDICTGVPAIITRDGIREIVELNLTEDEESRFAKSNDILRDYMKTIGY
>NZ_CP009641.1|WP_001002987.1|3492788_3493037_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009641_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009641_7

5230910-5231018

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009641_7

>merge|NZ_CP009641|7|5230910-5231018|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>NZ_CP009641|7|5|5230910-5231018|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009641.1\|WP_000003393.1\|5222901_5224728_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009641.1\|WP_000043381.1\|5226143_5226542_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP009641.1\|WP_000654717.1\|5232606_5233767_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP009641.1\|WP_000673194.1\|5228506_5229304_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP009641.1\|WP_001081482.1\|5227849_5228488_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP009641.1\|WP_001078427.1\|5239140_5239830_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP009641.1\|WP_000872717.1\|5231791_5232532_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP009641.1\|WP_000360638.1\|5225250_5226144_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP009641.1\|WP_001292832.1\|5234825_5235578_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009641.1\|WP_001079116.1\|5229319_5230213_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP009641.1\|WP_000799204.1\|5219980_5221525_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP009641.1\|WP_001271183.1\|5239826_5240513_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009641.1\|WP_001994556.1\|5233885_5234812_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP009641.1\|WP_000651527.1\|5240527_5241208_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009641.1\|WP_000444380.1\|5235792_5236638_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP009641.1\|WP_000191105.1\|5226722_5227301_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP009641.1\|WP_000612274.1\|5221606_5222851_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP009641.1\|WP_001180009.1\|5227447_5227819_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009641.1\|WP_000932917.1\|5237831_5238929_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP009641.1\|WP_001994552.1\|5236760_5237666_-\|sporulation-protein-BclA	unknown	unknown	gnl\|CDD\|375999

Protein	Function_ID	Function_description	E-value
NZ_CP009641.1\|WP_000003393.1\|5222901_5224728_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009641.1\|WP_000043381.1\|5226143_5226542_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NZ_CP009641.1\|WP_000654717.1\|5232606_5233767_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.52178e-99
NZ_CP009641.1\|WP_000673194.1\|5228506_5229304_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP009641.1\|WP_001081482.1\|5227849_5228488_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP009641.1\|WP_001078427.1\|5239140_5239830_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	3.57676e-18
NZ_CP009641.1\|WP_000872717.1\|5231791_5232532_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP009641.1\|WP_000360638.1\|5225250_5226144_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	5.36453e-93
NZ_CP009641.1\|WP_001292832.1\|5234825_5235578_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.79414e-19
NZ_CP009641.1\|WP_001079116.1\|5229319_5230213_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	3.88119e-102
NZ_CP009641.1\|WP_000799204.1\|5219980_5221525_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP009641.1\|WP_001271183.1\|5239826_5240513_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.25249e-108
NZ_CP009641.1\|WP_001994556.1\|5233885_5234812_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2498e-25
NZ_CP009641.1\|WP_000651527.1\|5240527_5241208_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.1131e-109
NZ_CP009641.1\|WP_000444380.1\|5235792_5236638_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.59865e-154
NZ_CP009641.1\|WP_000191105.1\|5226722_5227301_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NZ_CP009641.1\|WP_000612274.1\|5221606_5222851_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	2.34429e-57
NZ_CP009641.1\|WP_000932917.1\|5237831_5238929_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.02122e-54
NZ_CP009641.1\|WP_001994552.1\|5236760_5237666_-\|sporulation-protein-BclA	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	2.97711e-18

>NZ_CP009641.1|WP_001079116.1|5229319_5230213_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFQGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTAMIPSDMQEVLRQT
>NZ_CP009641.1|WP_000673194.1|5228506_5229304_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP009641.1|WP_001081482.1|5227849_5228488_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP009641.1|WP_001180009.1|5227447_5227819_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP009641.1|WP_000191105.1|5226722_5227301_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP009641.1|WP_000043381.1|5226143_5226542_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP009641.1|WP_000360638.1|5225250_5226144_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP009641.1|WP_000003393.1|5222901_5224728_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP009641.1|WP_000612274.1|5221606_5222851_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCTRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSIAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPIWNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNLFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP009641.1|WP_000799204.1|5219980_5221525_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP009641.1|WP_000872717.1|5231791_5232532_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKEAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP009641.1|WP_000654717.1|5232606_5233767_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGTVSCFAIASAQVSLPPFLQNVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFATAVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASIIITLFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP009641.1|WP_001994556.1|5233885_5234812_-|glycosyltransferase-family-2-protein
MTSEKDLPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIIGDDSTNDETETLIHEQYLPHYKNVTYIRNTPPLGQFHNDLMLLEKSNGEYINFLMDDDVFYKHKIQKMMDYFEQDTNKALALVTSYRVRIDDHGDLIGDAHPTQRLYSEDTPLNGMFLGDWMLKEGHNIIGEPTTTLFRKELLTEPFGTLKERQYSCSVDMASWISLLSKGDAVYISEPLSQFRYHAGQQIHNKLLQGCEDFTHLVITAKEYGFLQNTTDYRTALLSAYKWCKSSLKYYLHQLDIFPDAHVRLSHCLVIIIKELNN
>NZ_CP009641.1|WP_001292832.1|5234825_5235578_-|class-I-SAM-dependent-methyltransferase
MSELNKEITLLPPPELVQYVGGDFKEVGKEFLTHFIQIGALKSNEKVLDVGCGVGRMAVPLMNYLTDDGAYYGFDLFKDGITWCQNNIATIRNNFHFEHVDIYNQFYNPEGKEDASQYRFPYEDETFDFIFLTSVFTHLLPKELEHYLSEIVRVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIENCYVVNKDIPNFAVAYPETNIYSLLNKYGLEAINKPYYGLWCGRHEYTSYQDIVITKKRV
>NZ_CP009641.1|WP_000444380.1|5235792_5236638_-|macrocin-O-methyltransferase
MESKSAVQLYLELLKKTILFEIWLEYEAYLPASLHISKELEFEPVTVPLPLFIKQYAENHNLKIVKPNVSKSERHDGMDWPRAAHSMIGRERMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRNVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLEQVQENFKKYDLLNDQVKFLKGWFKDTLPTAPIEKIAIARLDGDMYESTMDGLVNLYDKVSKGGYIIIDDYGLPPCAEAVTDFRNHRNLKAPITKIDVFGVYWRKE
>NZ_CP009641.1|WP_001994552.1|5236760_5237666_-|sporulation-protein-BclA
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGDTGATGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGATGLTGPTGPTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIVYTAAVSLLGGLTIQVNGIPVPGTGASLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP009641.1|WP_000932917.1|5237831_5238929_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKREIDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGEVFSSNVAITHKKEKKVTDRNLKIFQNTVAAGEELSPRDLFYYANESTDNQKYDDAILLYETFLNQDEGWYEEKIYACGKLGDCYAKLGMWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQEKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSRLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRGVFDKPYKE
>NZ_CP009641.1|WP_001078427.1|5239140_5239830_+|class-I-SAM-dependent-methyltransferase
MNREKSSLYEEKSEHYYNAANPNLLKHIKKEWKEVLDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP009641.1|WP_001271183.1|5239826_5240513_+|streptomycin-biosynthesis-protein-StrF
MSAADKTILFVTCINDRKLYANCVRHILQLLVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYLHQDVFIINRAFLYGLLQLFEEHEHLGMIGMVGAQYVPPTGVWNEGRGIVGKVIGYMNDLFYMASLEQPYHESKTFIPVECIDGLLMATQYDVPWREDLFDGFDFYDVSQSFEFKKAGYTVGVPVQRDAWCIHYHFDVNMTNYEKYRKIFVEHYMSDVNKEE
>NZ_CP009641.1|WP_000651527.1|5240527_5241208_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCVNNEELFKQCESQIRNIFVPPGYVVQIFPIRDAQSMASAYNRALSYPAKYKVYIHQDTYLINRDMFSTLISLFKENEKLGLIGVAGAQFLPNNGIWWEGKNLVGKVIEYRRRNYQLLNLDQVFYGNQPFLSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009641_2	2.4\|2238658\|18\|NZ_CP009641\|CRT	2238658-2238675	18	NZ_CP009641.1	2238937-2238954	0	1.0
NZ_CP009641_2	2.4\|2238658\|18\|NZ_CP009641\|CRT	2238658-2238675	18	NZ_CP009641.1	2240116-2240133	0	1.0
NZ_CP009641_2	2.4\|2238658\|18\|NZ_CP009641\|CRT	2238658-2238675	18	NZ_CP009641.1	2240449-2240466	0	1.0
NZ_CP009641_2	2.5\|2238694\|18\|NZ_CP009641\|CRT	2238694-2238711	18	NZ_CP009641.1	2238937-2238954	0	1.0
NZ_CP009641_2	2.5\|2238694\|18\|NZ_CP009641\|CRT	2238694-2238711	18	NZ_CP009641.1	2240116-2240133	0	1.0
NZ_CP009641_2	2.5\|2238694\|18\|NZ_CP009641\|CRT	2238694-2238711	18	NZ_CP009641.1	2240449-2240466	0	1.0
NZ_CP009641_2	2.8\|2238820\|18\|NZ_CP009641\|CRT	2238820-2238837	18	NZ_CP009641.1	2239027-2239044	0	1.0
NZ_CP009641_2	2.8\|2238820\|18\|NZ_CP009641\|CRT	2238820-2238837	18	NZ_CP009641.1	2240242-2240259	0	1.0
NZ_CP009641_2	2.8\|2238820\|18\|NZ_CP009641\|CRT	2238820-2238837	18	NZ_CP009641.1	2240278-2240295	0	1.0
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	2240314-2240340	0	1.0
NZ_CP009641_2	2.10\|2238901\|18\|NZ_CP009641\|CRT	2238901-2238918	18	NZ_CP009641.1	2239027-2239044	0	1.0
NZ_CP009641_2	2.10\|2238901\|18\|NZ_CP009641\|CRT	2238901-2238918	18	NZ_CP009641.1	2240242-2240259	0	1.0
NZ_CP009641_2	2.10\|2238901\|18\|NZ_CP009641\|CRT	2238901-2238918	18	NZ_CP009641.1	2240278-2240295	0	1.0
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240257-2240274	0	1.0
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240257-2240274	0	1.0
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240257-2240274	0	1.0
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240374-2240400	0	1.0
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240680-2240706	0	1.0
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240212-2240238	0	1.0
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240419-2240445	0	1.0
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240770-2240796	0	1.0
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240986-2241012	0	1.0
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240257-2240274	0	1.0
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NZ_CP009641.1	2240329-2240355	0	1.0
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240212-2240238	0	1.0
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240419-2240445	0	1.0
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240770-2240796	0	1.0
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240986-2241012	0	1.0
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240374-2240400	0	1.0
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240680-2240706	0	1.0
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240374-2240400	0	1.0
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240680-2240706	0	1.0
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240500-2240526	0	1.0
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240545-2240571	0	1.0
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240725-2240751	0	1.0
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240374-2240400	0	1.0
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240680-2240706	0	1.0
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240500-2240526	0	1.0
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240545-2240571	0	1.0
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240725-2240751	0	1.0
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240374-2240400	0	1.0
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240680-2240706	0	1.0
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240212-2240238	0	1.0
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240419-2240445	0	1.0
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240770-2240796	0	1.0
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240986-2241012	0	1.0
NZ_CP009641_2	2.1\|2238532\|18\|NZ_CP009641\|CRT	2238532-2238549	18	NZ_CP009641.1	5237226-5237243	1	0.944
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	NZ_CP009641.1	2240404-2240430	1	0.963
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	NZ_CP009641.1	2240404-2240430	1	0.963
NZ_CP009641_2	2.4\|2238658\|18\|NZ_CP009641\|CRT	2238658-2238675	18	NZ_CP009641.1	2240404-2240421	1	0.944
NZ_CP009641_2	2.5\|2238694\|18\|NZ_CP009641\|CRT	2238694-2238711	18	NZ_CP009641.1	2240404-2240421	1	0.944
NZ_CP009641_2	2.6\|2238730\|27\|NZ_CP009641\|CRT	2238730-2238756	27	NZ_CP009641.1	2240404-2240430	1	0.963
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	NZ_CP009641.1	2240404-2240430	1	0.963
NZ_CP009641_2	2.8\|2238820\|18\|NZ_CP009641\|CRT	2238820-2238837	18	NZ_CP009641.1	2240404-2240421	1	0.944
NZ_CP009641_2	2.8\|2238820\|18\|NZ_CP009641\|CRT	2238820-2238837	18	NZ_CP009641.1	2240935-2240952	1	0.944
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	119445-119471	1	0.963
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	2240152-2240178	1	0.963
NZ_CP009641_2	2.10\|2238901\|18\|NZ_CP009641\|CRT	2238901-2238918	18	NZ_CP009641.1	2240404-2240421	1	0.944
NZ_CP009641_2	2.10\|2238901\|18\|NZ_CP009641\|CRT	2238901-2238918	18	NZ_CP009641.1	2240935-2240952	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	119484-119501	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2239051-2239068	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240131-2240148	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240176-2240193	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240464-2240481	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240509-2240526	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240554-2240571	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240734-2240751	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240824-2240841	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2240950-2240967	1	0.944
NZ_CP009641_3	3.2\|2239132\|18\|NZ_CP009641\|CRT	2239132-2239149	18	NZ_CP009641.1	2241040-2241057	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	119484-119501	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2239051-2239068	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240131-2240148	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240176-2240193	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240464-2240481	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240509-2240526	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240554-2240571	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240734-2240751	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240824-2240841	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2240950-2240967	1	0.944
NZ_CP009641_3	3.5\|2239258\|18\|NZ_CP009641\|CRT	2239258-2239275	18	NZ_CP009641.1	2241040-2241057	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	119484-119501	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2239051-2239068	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240131-2240148	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240176-2240193	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240464-2240481	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240509-2240526	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240554-2240571	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240734-2240751	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240824-2240841	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2240950-2240967	1	0.944
NZ_CP009641_3	3.7\|2239339\|18\|NZ_CP009641\|CRT	2239339-2239356	18	NZ_CP009641.1	2241040-2241057	1	0.944
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP009641.1	2239042-2239068	1	0.963
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP009641.1	2240167-2240193	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240212-2240238	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240419-2240445	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240500-2240526	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240545-2240571	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240725-2240751	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240770-2240796	1	0.963
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2240986-2241012	1	0.963
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240374-2240400	1	0.963
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240680-2240706	1	0.963
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	119484-119501	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2239051-2239068	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240131-2240148	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240176-2240193	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240464-2240481	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240509-2240526	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240554-2240571	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240734-2240751	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240824-2240841	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2240950-2240967	1	0.944
NZ_CP009641_3	3.12\|2239555\|18\|NZ_CP009641\|CRT	2239555-2239572	18	NZ_CP009641.1	2241040-2241057	1	0.944
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240374-2240400	1	0.963
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240680-2240706	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240212-2240238	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240419-2240445	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240500-2240526	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240545-2240571	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240725-2240751	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240770-2240796	1	0.963
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2240986-2241012	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240212-2240238	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240419-2240445	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240500-2240526	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240545-2240571	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240725-2240751	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240770-2240796	1	0.963
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2240986-2241012	1	0.963
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240374-2240400	1	0.963
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240680-2240706	1	0.963
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2241031-2241057	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240212-2240238	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240419-2240445	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240500-2240526	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240545-2240571	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240725-2240751	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240770-2240796	1	0.963
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2240986-2241012	1	0.963
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240374-2240400	1	0.963
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240680-2240706	1	0.963
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2241031-2241057	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240212-2240238	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240419-2240445	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240500-2240526	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240545-2240571	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240725-2240751	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240770-2240796	1	0.963
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2240986-2241012	1	0.963
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240374-2240400	1	0.963
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240680-2240706	1	0.963
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	119193-119219	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	119247-119273	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	119301-119327	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	119400-119426	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP009641.1	2240800-2240826	2	0.926
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP009641.1	2240815-2240841	2	0.926
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP009641.1	2241031-2241057	2	0.926
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NZ_CP009641.1	2241031-2241057	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2239042-2239068	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240167-2240193	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240500-2240526	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240545-2240571	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP009641.1	2240725-2240751	2	0.926
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	NZ_CP009641.1	2240329-2240355	2	0.926
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	NZ_CP009641.1	2240329-2240355	2	0.926
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	NZ_CP009641.1	2240590-2240616	2	0.926
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	NZ_CP009641.1	2240635-2240661	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2239042-2239068	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240167-2240193	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240500-2240526	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240545-2240571	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP009641.1	2240725-2240751	2	0.926
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NZ_CP009641.1	2241031-2241057	2	0.926
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NZ_CP009641.1	2241031-2241057	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	119484-119510	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2239042-2239068	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240167-2240193	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240212-2240238	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240419-2240445	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240770-2240796	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NZ_CP009641.1	2240986-2241012	2	0.926
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NZ_CP009641.1	2241031-2241057	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	119484-119510	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2239042-2239068	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240167-2240193	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240212-2240238	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240419-2240445	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240770-2240796	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NZ_CP009641.1	2240986-2241012	2	0.926
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NZ_CP009641.1	2241031-2241057	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2239042-2239068	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240167-2240193	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240500-2240526	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240545-2240571	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP009641.1	2240725-2240751	2	0.926

1. spacer 2.4|2238658|18|NZ_CP009641|CRT matches to position: 2238937-2238954, mismatch: 0, identity: 1.0

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggcgct	Protospacer
******************

2. spacer 2.4|2238658|18|NZ_CP009641|CRT matches to position: 2240116-2240133, mismatch: 0, identity: 1.0

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggcgct	Protospacer
******************

3. spacer 2.4|2238658|18|NZ_CP009641|CRT matches to position: 2240449-2240466, mismatch: 0, identity: 1.0

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggcgct	Protospacer
******************

4. spacer 2.5|2238694|18|NZ_CP009641|CRT matches to position: 2238937-2238954, mismatch: 0, identity: 1.0

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggcgct	Protospacer
******************

5. spacer 2.5|2238694|18|NZ_CP009641|CRT matches to position: 2240116-2240133, mismatch: 0, identity: 1.0

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggcgct	Protospacer
******************

6. spacer 2.5|2238694|18|NZ_CP009641|CRT matches to position: 2240449-2240466, mismatch: 0, identity: 1.0

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggcgct	Protospacer
******************

7. spacer 2.8|2238820|18|NZ_CP009641|CRT matches to position: 2239027-2239044, mismatch: 0, identity: 1.0

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacaggtgct	Protospacer
******************

8. spacer 2.8|2238820|18|NZ_CP009641|CRT matches to position: 2240242-2240259, mismatch: 0, identity: 1.0

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacaggtgct	Protospacer
******************

9. spacer 2.8|2238820|18|NZ_CP009641|CRT matches to position: 2240278-2240295, mismatch: 0, identity: 1.0

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacaggtgct	Protospacer
******************

10. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 2240314-2240340, mismatch: 0, identity: 1.0

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcgggtgctactggcgct	Protospacer
***************************

11. spacer 2.10|2238901|18|NZ_CP009641|CRT matches to position: 2239027-2239044, mismatch: 0, identity: 1.0

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacaggtgct	Protospacer
******************

12. spacer 2.10|2238901|18|NZ_CP009641|CRT matches to position: 2240242-2240259, mismatch: 0, identity: 1.0

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacaggtgct	Protospacer
******************

13. spacer 2.10|2238901|18|NZ_CP009641|CRT matches to position: 2240278-2240295, mismatch: 0, identity: 1.0

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacaggtgct	Protospacer
******************

14. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

15. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240257-2240274, mismatch: 0, identity: 1.0

gctactggacctcagggt	CRISPR spacer
gctactggacctcagggt	Protospacer
******************

16. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

17. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

18. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240257-2240274, mismatch: 0, identity: 1.0

gctactggacctcagggt	CRISPR spacer
gctactggacctcagggt	Protospacer
******************

19. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

20. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240257-2240274, mismatch: 0, identity: 1.0

gctactggacctcagggt	CRISPR spacer
gctactggacctcagggt	Protospacer
******************

21. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

22. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

23. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

24. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

25. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

26. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

27. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

28. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240257-2240274, mismatch: 0, identity: 1.0

gctactggacctcagggt	CRISPR spacer
gctactggacctcagggt	Protospacer
******************

29. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

30. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 0, identity: 1.0

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
***************************

31. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

32. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

33. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

34. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

35. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

36. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

37. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

38. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

39. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 0, identity: 1.0

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***************************

40. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 0, identity: 1.0

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***************************

41. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 0, identity: 1.0

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***************************

42. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

43. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

44. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 0, identity: 1.0

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***************************

45. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 0, identity: 1.0

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***************************

46. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 0, identity: 1.0

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***************************

47. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

48. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 0, identity: 1.0

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***************************

49. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

50. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

51. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

52. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 0, identity: 1.0

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
***************************

53. spacer 2.1|2238532|18|NZ_CP009641|CRT matches to position: 5237226-5237243, mismatch: 1, identity: 0.944

actgggccagctggtgct	CRISPR spacer
actgggccaactggtgct	Protospacer
*********.********

54. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to position: 2240404-2240430, mismatch: 1, identity: 0.963

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacacgggtgctactggtgcc	Protospacer
***********.***************

55. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to position: 2240404-2240430, mismatch: 1, identity: 0.963

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacacgggtgctactggtgcc	Protospacer
***********.***************

56. spacer 2.4|2238658|18|NZ_CP009641|CRT matches to position: 2240404-2240421, mismatch: 1, identity: 0.944

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggtgct	Protospacer
**************.***

57. spacer 2.5|2238694|18|NZ_CP009641|CRT matches to position: 2240404-2240421, mismatch: 1, identity: 0.944

caaggtaacacgggcgct	CRISPR spacer
caaggtaacacgggtgct	Protospacer
**************.***

58. spacer 2.6|2238730|27|NZ_CP009641|CRT matches to position: 2240404-2240430, mismatch: 1, identity: 0.963

caaggtaacacgggcgctactggtgcc	CRISPR spacer
caaggtaacacgggtgctactggtgcc	Protospacer
**************.************

59. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to position: 2240404-2240430, mismatch: 1, identity: 0.963

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacacgggtgctactggtgcc	Protospacer
***********.***************

60. spacer 2.8|2238820|18|NZ_CP009641|CRT matches to position: 2240404-2240421, mismatch: 1, identity: 0.944

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacgggtgct	Protospacer
***********.******

61. spacer 2.8|2238820|18|NZ_CP009641|CRT matches to position: 2240935-2240952, mismatch: 1, identity: 0.944

caaggtaacacaggtgct	CRISPR spacer
caaggtaatacaggtgct	Protospacer
********.*********

62. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 119445-119471, mismatch: 1, identity: 0.963

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccggcgggtgctactggcgct	Protospacer
********.******************

63. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 2240152-2240178, mismatch: 1, identity: 0.963

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgctactggcgct	Protospacer
***********.***************

64. spacer 2.10|2238901|18|NZ_CP009641|CRT matches to position: 2240404-2240421, mismatch: 1, identity: 0.944

caaggtaacacaggtgct	CRISPR spacer
caaggtaacacgggtgct	Protospacer
***********.******

65. spacer 2.10|2238901|18|NZ_CP009641|CRT matches to position: 2240935-2240952, mismatch: 1, identity: 0.944

caaggtaacacaggtgct	CRISPR spacer
caaggtaatacaggtgct	Protospacer
********.*********

66. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 119484-119501, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

67. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2239051-2239068, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

68. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240131-2240148, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

69. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240176-2240193, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

70. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240464-2240481, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

71. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240509-2240526, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

72. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240554-2240571, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

73. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240734-2240751, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

74. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240824-2240841, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

75. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2240950-2240967, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

76. spacer 3.2|2239132|18|NZ_CP009641|CRT matches to position: 2241040-2241057, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

77. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 119484-119501, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

78. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2239051-2239068, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

79. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240131-2240148, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

80. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240176-2240193, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

81. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240464-2240481, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

82. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240509-2240526, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

83. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240554-2240571, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

84. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240734-2240751, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

85. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240824-2240841, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

86. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2240950-2240967, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

87. spacer 3.5|2239258|18|NZ_CP009641|CRT matches to position: 2241040-2241057, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

88. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 119484-119501, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

89. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2239051-2239068, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

90. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240131-2240148, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

91. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240176-2240193, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

92. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240464-2240481, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

93. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240509-2240526, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

94. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240554-2240571, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

95. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240734-2240751, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

96. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240824-2240841, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

97. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2240950-2240967, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

98. spacer 3.7|2239339|18|NZ_CP009641|CRT matches to position: 2241040-2241057, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

99. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to position: 2239042-2239068, mismatch: 1, identity: 0.963

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
***********************.***

100. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to position: 2240167-2240193, mismatch: 1, identity: 0.963

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
***********************.***

101. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

102. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

103. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

104. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

105. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

106. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

107. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

108. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
*****.*********************

109. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
*****.*********************

110. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 119484-119501, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

111. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2239051-2239068, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

112. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240131-2240148, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

113. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240176-2240193, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

114. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240464-2240481, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

115. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240509-2240526, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

116. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240554-2240571, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

117. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240734-2240751, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

118. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240824-2240841, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

119. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2240950-2240967, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

120. spacer 3.12|2239555|18|NZ_CP009641|CRT matches to position: 2241040-2241057, mismatch: 1, identity: 0.944

gctactggacctcagggt	CRISPR spacer
gctactggacctcaaggt	Protospacer
**************.***

121. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
*****.*********************

122. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
*****.*********************

123. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

124. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

125. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

126. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

127. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

128. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

129. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

130. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

131. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

132. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

133. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

134. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

135. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

136. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

137. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 1, identity: 0.963

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***********.***************

138. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 1, identity: 0.963

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***********.***************

139. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 1, identity: 0.963

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.******************

140. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

141. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

142. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

143. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

144. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

145. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

146. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

147. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 1, identity: 0.963

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***********.***************

148. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 1, identity: 0.963

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
***********.***************

149. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 1, identity: 0.963

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.******************

150. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

151. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

152. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

153. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

154. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
***********.***************

155. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

156. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 1, identity: 0.963

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*********************

157. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240374-2240400, mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
*****.*********************

158. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240680-2240706, mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgccactggacctcaaggt	Protospacer
*****.*********************

159. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 119193-119219, mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggacctgctggtgctactggcgct	Protospacer
******** ** ***************

160. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 119247-119273, mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggacctgctggtgctactggcgct	Protospacer
******** ** ***************

161. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 119301-119327, mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggacctgctggtgctactggcgct	Protospacer
******** ** ***************

162. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 119400-119426, mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggacctgctggtgctactggcgct	Protospacer
******** ** ***************

163. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to position: 2240800-2240826, mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgccactggcgct	Protospacer
***********.*****.*********

164. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

165. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

166. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

167. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

168. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

169. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

170. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

171. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

172. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

173. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

174. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to position: 2240815-2240841, mismatch: 2, identity: 0.926

gctactggcgctactggacctcagggt	CRISPR spacer
gccactggcgctactggacctcaaggt	Protospacer
**.********************.***

175. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 2, identity: 0.926

gctactggcgctactggacctcagggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
*****.*****************.***

176. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.**.***************

177. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2239042-2239068, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
********.**.***************

178. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240167-2240193, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
********.**.***************

179. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

180. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

181. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

182. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

183. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

184. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

185. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.**.******************

186. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
********.**.***************

187. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.*****.***************

188. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.*****.***************

189. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to position: 2240329-2240355, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggcgctactggacctcaaggc	Protospacer
********.**.***************

190. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to position: 2240590-2240616, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.*****.***************

191. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to position: 2240635-2240661, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctaccggtgctactggacctcaaggc	Protospacer
*****.*****.***************

192. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2239042-2239068, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
********.**.***************

193. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240167-2240193, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
********.**.***************

194. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

195. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

196. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

197. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.**.***************

198. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.**.***************

199. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 119484-119510, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctacgggggctactggacctcaaggt	Protospacer
***** ** ******************

200. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2239042-2239068, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
*****.**.******************

201. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240167-2240193, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
*****.**.******************

202. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

203. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

204. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

205. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

206. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.**.***************

207. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 119484-119510, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctacgggggctactggacctcaaggt	Protospacer
***** ** ******************

208. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2239042-2239068, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
*****.**.******************

209. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240167-2240193, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
*****.**.******************

210. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240212-2240238, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

211. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240419-2240445, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

212. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240770-2240796, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

213. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to position: 2240986-2241012, mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgccactggacctcaaggt	Protospacer
*****.*****.***************

214. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to position: 2241031-2241057, mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggcgctactggacctcaaggt	Protospacer
********.**.***************

215. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2239042-2239068, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
********.**.***************

216. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240167-2240193, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggcgctactggacctcaaggt	Protospacer
********.**.***************

217. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240500-2240526, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

218. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240545-2240571, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

219. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to position: 2240725-2240751, mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctcaaggt	Protospacer
*****.*****.***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	1	0.963
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	1	0.963
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	1	0.963
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	1	0.963
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	1	0.963
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	1	0.963
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17323-17349	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9179-9205	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9009-9035	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9781-9807	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14923-14949	2	0.926
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4478-4504	2	0.926
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	2	0.926
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	2	0.926
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	2	0.926
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	2	0.926
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	2	0.926
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	2	0.926
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	2	0.926
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	2	0.926
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	2	0.926
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85244	3	0.889
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MN163280	Klebsiella phage KpGranit, complete genome	83369-83395	3	0.889
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MN163280	Klebsiella phage KpGranit, complete genome	84572-84598	3	0.889
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79837	3	0.889
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84342	3	0.889
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85244	3	0.889
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MN163280	Klebsiella phage KpGranit, complete genome	83369-83395	3	0.889
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MN163280	Klebsiella phage KpGranit, complete genome	84572-84598	3	0.889
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79837	3	0.889
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84342	3	0.889
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85244	3	0.889
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MN163280	Klebsiella phage KpGranit, complete genome	83369-83395	3	0.889
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MN163280	Klebsiella phage KpGranit, complete genome	84572-84598	3	0.889
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79837	3	0.889
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84342	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83705-83731	3	0.889
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88210-88236	3	0.889
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	3	0.889
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MN163280	Klebsiella phage KpGranit, complete genome	83327-83353	3	0.889
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MN163280	Klebsiella phage KpGranit, complete genome	84530-84556	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29809-29835	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MN693405	Marine virus AFVG_25M416, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15071-15097	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15068-15094	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3670-3696	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MN693333	Marine virus AFVG_25M417, complete genome	18974-19000	3	0.889
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71430-71456	3	0.889
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MN693092	Marine virus AFVG_25M37, complete genome	19112-19138	3	0.889
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	3	0.889
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MN163280	Klebsiella phage KpGranit, complete genome	83327-83353	3	0.889
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MN163280	Klebsiella phage KpGranit, complete genome	84530-84556	3	0.889
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	3	0.889
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	3	0.889
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	3	0.889
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	3	0.889
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	3	0.889
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	3	0.889
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	799-825	3	0.889
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MN163280	Klebsiella phage KpGranit, complete genome	83327-83353	3	0.889
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MN163280	Klebsiella phage KpGranit, complete genome	84530-84556	3	0.889
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81977	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MN163280	Klebsiella phage KpGranit, complete genome	81266-81292	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76489	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78625	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80994	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83130	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255637	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29550	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3955-3981	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81977	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MN163280	Klebsiella phage KpGranit, complete genome	81266-81292	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76489	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78625	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80994	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83130	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255637	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29550	4	0.852
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3955-3981	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81977	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MN163280	Klebsiella phage KpGranit, complete genome	81266-81292	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76489	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78625	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80994	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83130	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255637	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29550	4	0.852
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3955-3981	4	0.852
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	1058073-1058099	4	0.852
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	GU323708	Lactobacillus phage phiPYB5, complete genome	19361-19387	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH020238	Mycobacterium phage Lilith, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH727554	Mycobacterium phage MuchMore, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH338240	Mycobacterium phage Sabia, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	KM233455	Mycobacterium phage Farber, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	KX664448	Mycobacterium phage Watson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	KX507362	Mycobacterium phage Aglet, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH576949	Mycobacterium phage BreSam8, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MF185733	Mycobacterium phage StepMih, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MF185732	Mycobacterium phage Stagni, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MK494096	Mycobacterium phage Mainiac, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	JF704101	Mycobacterium virus Microwolf, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	KT359365	Mycobacterium phage DaHudson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MH651179	Mycobacterium phage MadMarie, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	4	0.852
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181177-181203	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179859-179885	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182278-182304	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MT724048	Staphylococcus phage SAP3, partial genome	27092-27118	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963386-963412	4	0.852
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963422-963448	4	0.852
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NC_024210	Escherichia phage e4/1c, complete genome	7863-7889	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MN163280	Klebsiella phage KpGranit, complete genome	83327-83353	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MN163280	Klebsiella phage KpGranit, complete genome	84530-84556	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4775-4801	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14987-15013	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14990-15016	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14987-15013	4	0.852
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MT724048	Staphylococcus phage SAP3, partial genome	27092-27118	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MN163280	Klebsiella phage KpGranit, complete genome	83327-83353	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MN163280	Klebsiella phage KpGranit, complete genome	84530-84556	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4775-4801	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14987-15013	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14990-15016	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14987-15013	4	0.852
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MT724048	Staphylococcus phage SAP3, partial genome	27092-27118	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181177-181203	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179859-179885	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182278-182304	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MT724048	Staphylococcus phage SAP3, partial genome	27092-27118	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963386-963412	4	0.852
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963422-963448	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH020238	Mycobacterium phage Lilith, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH727554	Mycobacterium phage MuchMore, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH338240	Mycobacterium phage Sabia, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	KM233455	Mycobacterium phage Farber, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	KX664448	Mycobacterium phage Watson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	KX507362	Mycobacterium phage Aglet, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH576949	Mycobacterium phage BreSam8, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MF185733	Mycobacterium phage StepMih, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MF185732	Mycobacterium phage Stagni, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MK494096	Mycobacterium phage Mainiac, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	JF704101	Mycobacterium virus Microwolf, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	KT359365	Mycobacterium phage DaHudson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MH651179	Mycobacterium phage MadMarie, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	4	0.852
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH020238	Mycobacterium phage Lilith, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH727554	Mycobacterium phage MuchMore, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH338240	Mycobacterium phage Sabia, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	KM233455	Mycobacterium phage Farber, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	KX664448	Mycobacterium phage Watson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	KX507362	Mycobacterium phage Aglet, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH576949	Mycobacterium phage BreSam8, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MF185733	Mycobacterium phage StepMih, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MF185732	Mycobacterium phage Stagni, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MK494096	Mycobacterium phage Mainiac, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	JF704101	Mycobacterium virus Microwolf, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	KT359365	Mycobacterium phage DaHudson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MH651179	Mycobacterium phage MadMarie, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	4	0.852
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	4	0.852
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	4	0.852
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	4	0.852
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	4	0.852
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH020238	Mycobacterium phage Lilith, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH727554	Mycobacterium phage MuchMore, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH338240	Mycobacterium phage Sabia, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	KM233455	Mycobacterium phage Farber, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	KX664448	Mycobacterium phage Watson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	KX507362	Mycobacterium phage Aglet, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH576949	Mycobacterium phage BreSam8, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MF185733	Mycobacterium phage StepMih, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MF185732	Mycobacterium phage Stagni, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MK494096	Mycobacterium phage Mainiac, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	JF704101	Mycobacterium virus Microwolf, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	KT359365	Mycobacterium phage DaHudson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MH651179	Mycobacterium phage MadMarie, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	4	0.852
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	4	0.852
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	4	0.852
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	4	0.852
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	4	0.852
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH020238	Mycobacterium phage Lilith, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH727554	Mycobacterium phage MuchMore, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH338240	Mycobacterium phage Sabia, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	KM233455	Mycobacterium phage Farber, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	KX664448	Mycobacterium phage Watson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	KX507362	Mycobacterium phage Aglet, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH576949	Mycobacterium phage BreSam8, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MF185733	Mycobacterium phage StepMih, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MF185732	Mycobacterium phage Stagni, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MK494096	Mycobacterium phage Mainiac, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	JF704101	Mycobacterium virus Microwolf, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	KT359365	Mycobacterium phage DaHudson, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MH651179	Mycobacterium phage MadMarie, complete genome	2465-2491	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2464-2490	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2020	4	0.852
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2065	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181177-181203	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179859-179885	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182278-182304	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MT724048	Staphylococcus phage SAP3, partial genome	27092-27118	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963386-963412	4	0.852
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963422-963448	4	0.852
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79792	5	0.815
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84297	5	0.815
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	JQ691611	Cronobacter phage CR9, complete genome	9706-9732	5	0.815
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79792	5	0.815
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84297	5	0.815
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	JQ691611	Cronobacter phage CR9, complete genome	9706-9732	5	0.815
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79792	5	0.815
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84297	5	0.815
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	JQ691611	Cronobacter phage CR9, complete genome	9706-9732	5	0.815
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP035420	Leisingera sp. NJS204 plasmid unnamed3, complete sequence	16041-16067	5	0.815
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NZ_CP014061	Pseudomonas monteilii strain FDAARGOS_171 plasmid unnamed, complete sequence	24231-24257	5	0.815
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	KU716094	Mycobacterium phage Eidsmoe, complete genome	5029-5055	5	0.815
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	MH371122	Mycobacterium phage Priya, complete genome	5030-5056	5	0.815
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	NC_023716	Mycobacterium virus Alma, complete genome	5030-5056	5	0.815
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	MG872835	Mycobacterium phage Conquerage, complete genome	5029-5055	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76457-76483	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80962-80988	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9187-9213	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9340-9366	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21366-21392	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21519-21545	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10339-10365	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10717-10743	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	NZ_AP018204	Leptolyngbya boryana NIES-2135 plasmid plasmid1 DNA, complete genome	167821-167847	5	0.815
NZ_CP009641_3	3.9\|2239420\|27\|NZ_CP009641\|CRT	2239420-2239446	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	5	0.815
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	5	0.815
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	5	0.815
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	5	0.815
NZ_CP009641_3	3.10\|2239465\|27\|NZ_CP009641\|CRT	2239465-2239491	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14987-15013	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14990-15016	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14987-15013	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.11\|2239510\|27\|NZ_CP009641\|CRT	2239510-2239536	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4775-4801	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10798-10824	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21754-21780	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32228-32254	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	104-130	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	131-157	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	257-283	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	995-1021	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1184-1210	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1634-1660	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1688-1714	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1742-1768	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1769-1795	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1850-1876	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733024-733050	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733177-733203	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733375-733401	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733402-733428	5	0.815
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13186-13212	5	0.815
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	37628-37654	5	0.815
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15803-15829	5	0.815
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16964-16990	5	0.815
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	37628-37654	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14987-15013	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14990-15016	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14987-15013	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.17\|2239771\|27\|NZ_CP009641\|CRT	2239771-2239797	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4775-4801	5	0.815
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	5	0.815
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	5	0.815
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	5	0.815
NZ_CP009641_3	3.18\|2239816\|27\|NZ_CP009641\|CRT	2239816-2239842	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	5	0.815
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	5	0.815
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	5	0.815
NZ_CP009641_3	3.19\|2239861\|27\|NZ_CP009641\|CRT	2239861-2239887	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13196-13222	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15098-15124	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13199-13225	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15101-15127	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13196-13222	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15098-15124	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2021-2047	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP017924	Ralstonia phage RP12 DNA, complete genome	152340-152366	5	0.815
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	AP017925	Ralstonia phage RP31 DNA, complete genome	149086-149112	5	0.815
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	5	0.815
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	5	0.815
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	5	0.815
NZ_CP009641_3	3.21\|2239951\|27\|NZ_CP009641\|CRT	2239951-2239977	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13196-13222	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15098-15124	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13199-13225	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15101-15127	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13196-13222	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15098-15124	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2021-2047	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP017924	Ralstonia phage RP12 DNA, complete genome	152340-152366	5	0.815
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	AP017925	Ralstonia phage RP31 DNA, complete genome	149086-149112	5	0.815
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29526	5	0.815
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3979-4005	5	0.815
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MN693099	Marine virus AFVG_25M184, complete genome	13869-13895	5	0.815
NZ_CP009641_3	3.23\|2240041\|27\|NZ_CP009641\|CRT	2240041-2240067	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14987-15013	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14990-15016	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14987-15013	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MN693189	Marine virus AFVG_25M326, complete genome	18913-18939	5	0.815
NZ_CP009641_3	3.24\|2240086\|27\|NZ_CP009641\|CRT	2240086-2240112	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4775-4801	5	0.815
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KM262192	Leuconostoc phage Ln-9, complete genome	17572-17598	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	NC_041979	Escherichia coli O157 typing phage 1, complete genome	75013-75039	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MH571750	Escherichia phage vB_EcoM-Ro111lw, complete genome	39746-39772	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	NC_012749	Enterobacteria phage WV8, complete genome	54952-54978	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	EU877232	Enterobacteria phage WV8, complete sequence	54952-54978	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14492-14518	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KP869113	Escherichia coli O157 typing phage 15, partial genome	4243-4269	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KP869106	Escherichia coli O157 typing phage 8, partial genome	73803-73829	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KP869109	Escherichia coli O157 typing phage 11, complete genome	52983-53009	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MK524176	Escherichia phage PHB11, complete genome	39306-39332	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	MN694321	Marine virus AFVG_250M307, complete genome	32963-32989	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	JX560968	Escherichia phage EC6, complete genome	40420-40446	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	NC_028872	Escherichia phage HY02, complete genome	53565-53591	6	0.778
NZ_CP009641_2	2.2\|2238568\|27\|NZ_CP009641\|CRT	2238568-2238594	27	KP869110	Escherichia coli O157 typing phage 12, complete genome	61244-61270	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KM262192	Leuconostoc phage Ln-9, complete genome	17572-17598	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	NC_041979	Escherichia coli O157 typing phage 1, complete genome	75013-75039	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MH571750	Escherichia phage vB_EcoM-Ro111lw, complete genome	39746-39772	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	NC_012749	Enterobacteria phage WV8, complete genome	54952-54978	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	EU877232	Enterobacteria phage WV8, complete sequence	54952-54978	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14492-14518	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KP869113	Escherichia coli O157 typing phage 15, partial genome	4243-4269	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KP869106	Escherichia coli O157 typing phage 8, partial genome	73803-73829	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KP869109	Escherichia coli O157 typing phage 11, complete genome	52983-53009	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MK524176	Escherichia phage PHB11, complete genome	39306-39332	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	MN694321	Marine virus AFVG_250M307, complete genome	32963-32989	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	JX560968	Escherichia phage EC6, complete genome	40420-40446	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	NC_028872	Escherichia phage HY02, complete genome	53565-53591	6	0.778
NZ_CP009641_2	2.3\|2238613\|27\|NZ_CP009641\|CRT	2238613-2238639	27	KP869110	Escherichia coli O157 typing phage 12, complete genome	61244-61270	6	0.778
NZ_CP009641_2	2.6\|2238730\|27\|NZ_CP009641\|CRT	2238730-2238756	27	KU682439	Stenotrophomonas phage vB_SmaS-DLP_6, complete genome	61266-61292	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KM262192	Leuconostoc phage Ln-9, complete genome	17572-17598	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	NC_041979	Escherichia coli O157 typing phage 1, complete genome	75013-75039	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MH571750	Escherichia phage vB_EcoM-Ro111lw, complete genome	39746-39772	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	NC_012749	Enterobacteria phage WV8, complete genome	54952-54978	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	EU877232	Enterobacteria phage WV8, complete sequence	54952-54978	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14492-14518	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KP869113	Escherichia coli O157 typing phage 15, partial genome	4243-4269	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KP869106	Escherichia coli O157 typing phage 8, partial genome	73803-73829	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KP869109	Escherichia coli O157 typing phage 11, complete genome	52983-53009	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MK524176	Escherichia phage PHB11, complete genome	39306-39332	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	MN694321	Marine virus AFVG_250M307, complete genome	32963-32989	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	JX560968	Escherichia phage EC6, complete genome	40420-40446	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	NC_028872	Escherichia phage HY02, complete genome	53565-53591	6	0.778
NZ_CP009641_2	2.7\|2238775\|27\|NZ_CP009641\|CRT	2238775-2238801	27	KP869110	Escherichia coli O157 typing phage 12, complete genome	61244-61270	6	0.778
NZ_CP009641_2	2.9\|2238856\|27\|NZ_CP009641\|CRT	2238856-2238882	27	MK613348	Roseobacter phage CRP-6, complete genome	35829-35855	6	0.778
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.1\|2239087\|27\|NZ_CP009641\|CRT	2239087-2239113	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.3\|2239168\|27\|NZ_CP009641\|CRT	2239168-2239194	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.4\|2239213\|27\|NZ_CP009641\|CRT	2239213-2239239	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.6\|2239294\|27\|NZ_CP009641\|CRT	2239294-2239320	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.8\|2239375\|27\|NZ_CP009641\|CRT	2239375-2239401	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.13\|2239591\|27\|NZ_CP009641\|CRT	2239591-2239617	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.14\|2239636\|27\|NZ_CP009641\|CRT	2239636-2239662	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.15\|2239681\|27\|NZ_CP009641\|CRT	2239681-2239707	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78593-78619	6	0.778
NZ_CP009641_3	3.16\|2239726\|27\|NZ_CP009641\|CRT	2239726-2239752	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83098-83124	6	0.778
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MT066160	Vibrio phage Saratov-12, complete genome	4502-4528	6	0.778
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25954-25980	6	0.778
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MT767883	Vibrio phage Saratov-15, complete genome	10812-10838	6	0.778
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MT066160	Vibrio phage Saratov-12, complete genome	4502-4528	6	0.778
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25954-25980	6	0.778
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MT767883	Vibrio phage Saratov-15, complete genome	10812-10838	6	0.778
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MK448998	Streptococcus phage Javan636, complete genome	35464-35490	7	0.741
NZ_CP009641_3	3.20\|2239906\|27\|NZ_CP009641\|CRT	2239906-2239932	27	MK448821	Streptococcus phage Javan623, complete genome	30478-30504	7	0.741
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MK448998	Streptococcus phage Javan636, complete genome	35464-35490	7	0.741
NZ_CP009641_3	3.22\|2239996\|27\|NZ_CP009641\|CRT	2239996-2240022	27	MK448821	Streptococcus phage Javan623, complete genome	30478-30504	7	0.741

1. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** ***************

2. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** ***************

3. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** ***************

4. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** ***************

5. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** ***************

6. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 1, identity: 0.963

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** ***************

7. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgcaactggcgct	Protospacer
***********.***** *********

8. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgcaactggcgct	Protospacer
***********.***** *********

9. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgcaactggcgct	Protospacer
***********.***** *********

10. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgcaactggcgct	Protospacer
***********.***** *********

11. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgcaactggcgct	Protospacer
***********.***** *********

12. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcaggtgcaactggcgct	Protospacer
***********.***** *********

13. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

14. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

15. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

16. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

17. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

18. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

19. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

20. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** ********.***************

21. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
***********.***** *********

22. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

23. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
********.******** *********

24. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** **************.

25. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** **************.

26. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
***********.***** *********

27. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** **************.

28. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*********** **************.

29. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
***********.***** *********

30. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** ********.***************

31. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
***********.***** *********

32. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

33. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

34. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

35. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

36. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

37. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** **.*********************

38. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

39. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
*****.*********** *********

40. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

41. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

42. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

43. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** **.*********************

44. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

45. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 2, identity: 0.926

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
*****.*********** *********

46. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

47. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
*****.***** ***************

48. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** ********.***************

49. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 2, identity: 0.926

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
***********.***** *********

50. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacaaaggtgatactggtgct	Protospacer
********** ***** *********.

51. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacacaggtgctactggtcct	Protospacer
**.********************* *.

52. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacacaggtgctactggtcct	Protospacer
**.********************* *.

53. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtgct	Protospacer
**.******** **************.

54. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtgct	Protospacer
**.******** **************.

55. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacaaaggtgatactggtgct	Protospacer
********** ***** *********.

56. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacacaggtgctactggtcct	Protospacer
**.********************* *.

57. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacacaggtgctactggtcct	Protospacer
**.********************* *.

58. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtgct	Protospacer
**.******** **************.

59. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtgct	Protospacer
**.******** **************.

60. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacaaaggtgatactggtgct	Protospacer
********** ***** *********.

61. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacacaggtgctactggtcct	Protospacer
**.********************* *.

62. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacacaggtgctactggtcct	Protospacer
**.********************* *.

63. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtgct	Protospacer
**.******** **************.

64. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtgct	Protospacer
**.******** **************.

65. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

66. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

67. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

68. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

69. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

70. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

71. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

72. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

73. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

74. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

75. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

76. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

77. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

78. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

79. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

80. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

81. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

82. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

83. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

84. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

85. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

86. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

87. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

88. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

89. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

90. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

91. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

92. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

93. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

94. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

95. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

96. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

97. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

98. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

99. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

100. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

101. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

102. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

103. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

104. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

105. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

106. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

107. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

108. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

109. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

110. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggtgctactggaccgcaggga	Protospacer
********.*********** *****

111. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggtgctactggaccgcaggga	Protospacer
********.*********** *****

112. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
***********.***** ********.

113. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** *********

114. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** *********

115. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

116. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

117. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

118. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

119. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

120. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

121. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

122. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

123. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

124. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

125. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
********.******** ********.

126. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

127. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

128. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

129. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggcgctacaggtcctcaaggt	Protospacer
************** ** ********.

130. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggtgcaactggacctcaaggt	Protospacer
********.** **************.

131. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggccctcaaggt	Protospacer
******** ******** ********.

132. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggcgctactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** *****.*****************.

133. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
***********.***** ********.

134. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** ********.**************.

135. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggc	CRISPR spacer
gctactggtgctactggtcctcaaggt	Protospacer
***********.***** ********.

136. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggc	CRISPR spacer
gcaactggtgctactggacctcaaggt	Protospacer
** ********.**************.

137. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
***********.***** ********.

138. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** *********

139. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** *********

140. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
*****.*********** ********.

141. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
*********************   ***

142. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
*********************   ***

143. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
*****.*********** ********.

144. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
*********************   ***

145. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

gctaccggtgctactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
*********************   ***

146. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gctactggtgctactggccctcaaggc	Protospacer
***********.***** ********.

147. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** *********

148. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** *********

149. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcca	Protospacer
**.******** ************ *

150. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacaccggtgctactggtcca	Protospacer
**.******** ************ *

151. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

152. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

153. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

154. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

155. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacaccggtgctactggtgca	Protospacer
 *****.**** **************

156. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaatacaggagctactggtcca	Protospacer
********.***** ********* *

157. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaatacaggagctactggtcca	Protospacer
********.***** ********* *

158. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcca	Protospacer
**.******** ************ *

159. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacaccggtgctactggtcca	Protospacer
**.******** ************ *

160. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

161. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

162. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

163. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

164. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacaccggtgctactggtgca	Protospacer
 *****.**** **************

165. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaatacaggagctactggtcca	Protospacer
********.***** ********* *

166. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaatacaggagctactggtcca	Protospacer
********.***** ********* *

167. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcca	Protospacer
**.******** ************ *

168. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacaccggtgctactggtcca	Protospacer
**.******** ************ *

169. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

170. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

171. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

172. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
cagggtaacactggtgctactggtcct	Protospacer
**.******** ************ *.

173. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacaccggtgctactggtgca	Protospacer
 *****.**** **************

174. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaatacaggagctactggtcca	Protospacer
********.***** ********* *

175. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaatacaggagctactggtcca	Protospacer
********.***** ********* *

176. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

caaggaccagcgggtgctactggcgct	CRISPR spacer
caaggaccagcgggcgctgctggcctt	Protospacer
**************.***.***** .*

177. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

178. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

179. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

180. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

181. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

182. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

183. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

184. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

185. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

186. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

187. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

188. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

189. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

190. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

191. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

192. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

193. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

194. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

195. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

196. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

197. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcagggt	CRISPR spacer
cctactggtgctactggaccacagggg	Protospacer
 *******.*********** *****

198. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

199. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

200. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

201. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

202. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

203. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

204. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

205. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

206. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

207. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

208. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

209. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

210. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

211. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

212. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

213. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

214. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

215. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

216. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

217. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

218. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

219. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

220. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

221. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.******

222. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

223. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

224. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.******

225. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

226. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * ********.**************

227. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggagccactggacctaaagga	Protospacer
* ****** ************ ****

228. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcagctggtgcaactggaccgcaaggt	Protospacer
** .******* ******** ******

229. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcagctggtgcaactggaccgcaaggt	Protospacer
** .******* ******** ******

230. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

231. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

232. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

233. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

234. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

235. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

236. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.*****************

237. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

gctactggcgctactggacctcaaggc	CRISPR spacer
gatcctggcgatactgggcctcaaggc	Protospacer
* * ****** ******.*********

238. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

239. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

240. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * ********.**************

241. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** ********.

242. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** ********.

243. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
ccgactggtgccactggcgctcaaggc	Protospacer
 * **************  ********

244. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** *********

245. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** *********

246. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** *********

247. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
gatactggagccactggacctaaagga	Protospacer
* ****** ************ ****

248. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

249. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

250. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * ********.**************

251. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** ********.

252. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
gatactggtgccaccggtcctcaaggt	Protospacer
* ************.** ********.

253. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
ccgactggtgccactggcgctcaaggc	Protospacer
 * **************  ********

254. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** *********

255. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** *********

256. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** *********

257. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggc	CRISPR spacer
gatactggagccactggacctaaagga	Protospacer
* ****** ************ ****

258. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

259. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

260. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.******

261. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

262. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

263. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.******

264. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

265. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * ********.**************

266. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggagccactggacctaaagga	Protospacer
* ****** ************ ****

267. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcagctggtgcaactggaccgcaaggt	Protospacer
** .******* ******** ******

268. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcagctggtgcaactggaccgcaaggt	Protospacer
** .******* ******** ******

269. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

270. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

271. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

272. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

273. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

274. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

275. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

276. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

277. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

278. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

279. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

280. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

281. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

282. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

283. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

284. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

285. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

286. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

287. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

288. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

289. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

290. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

291. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

292. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

293. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

294. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

295. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

296. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

297. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

298. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

299. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

300. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

301. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

302. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

303. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

304. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

305. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

306. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

307. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

308. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

309. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

310. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

311. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.********************

312. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.********************

313. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *********************

314. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * **.**************.******

315. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * **.**************.******

316. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.********************

317. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

318. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

319. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

320. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

321. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

322. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

323. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

324. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

325. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

326. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

327. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

328. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

329. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

330. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

331. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

332. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

333. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

334. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

335. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

336. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

337. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

338. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.********************

339. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.********************

340. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *********************

341. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * **.**************.******

342. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * **.**************.******

343. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgctactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.********************

344. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

345. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

346. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

347. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

348. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

349. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

350. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

351. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

352. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

353. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

354. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

355. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

356. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

357. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

358. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

359. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

360. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

361. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

362. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gataccggtgccactggtgctcaaggc	Protospacer
* ***************  *******.

363. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

364. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gctaccggtgccactggacctcaaggt	CRISPR spacer
gctaccggtgctactggacctaccggt	Protospacer
***********.*********   ***

365. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

366. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * ********.**************

367. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.******

368. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

369. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

370. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.******

371. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcctctggtgcaactggtcctcaaggt	Protospacer
**. ******* ***** *********

372. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * ********.**************

373. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gatactggagccactggacctaaagga	Protospacer
* ****** ************ ****

374. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcagctggtgcaactggaccgcaaggt	Protospacer
** .******* ******** ******

375. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gctactggtgccactggacctcaaggt	CRISPR spacer
gcagctggtgcaactggaccgcaaggt	Protospacer
** .******* ******** ******

376. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacacaggggctactggtcct	Protospacer
 *****.******* ********* *.

377. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacacaggggctactggtcct	Protospacer
 *****.******* ********* *.

378. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacacaggtcctaccgggcct	Protospacer
*************** ****.**  *.

379. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacacaggggctactggtcct	Protospacer
 *****.******* ********* *.

380. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacacaggggctactggtcct	Protospacer
 *****.******* ********* *.

381. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacacaggtcctaccgggcct	Protospacer
*************** ****.**  *.

382. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacacaggggctactggtcct	Protospacer
 *****.******* ********* *.

383. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
aaaggtgacacaggggctactggtcct	Protospacer
 *****.******* ********* *.

384. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

caaggtaacacaggtgctactggtgcc	CRISPR spacer
caaggtaacacaggtcctaccgggcct	Protospacer
*************** ****.**  *.

385. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to NZ_CP035420 (Leisingera sp. NJS204 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

caaggaccagcgggtgctactggcgct	CRISPR spacer
cggcgaccagcgggtgctgctggtgct	Protospacer
*.. **************.****.***

386. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to NZ_CP014061 (Pseudomonas monteilii strain FDAARGOS_171 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caaggaccagcgggtgctactggcgct	CRISPR spacer
cgatcaccagcgggtgctcctggcgca	Protospacer
*.*  ************* *******

387. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to KU716094 (Mycobacterium phage Eidsmoe, complete genome) position: , mismatch: 5, identity: 0.815

caaggaccagcgggtgctactggcgct	CRISPR spacer
cagggaccagcgggcgctactggaccg	Protospacer
**.***********.********  *

388. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to MH371122 (Mycobacterium phage Priya, complete genome) position: , mismatch: 5, identity: 0.815

caaggaccagcgggtgctactggcgct	CRISPR spacer
cagggaccagcgggcgctactggaccg	Protospacer
**.***********.********  *

389. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to NC_023716 (Mycobacterium virus Alma, complete genome) position: , mismatch: 5, identity: 0.815

caaggaccagcgggtgctactggcgct	CRISPR spacer
cagggaccagcgggcgctactggaccg	Protospacer
**.***********.********  *

390. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 5, identity: 0.815

caaggaccagcgggtgctactggcgct	CRISPR spacer
cagggaccagcgggcgctactggaccg	Protospacer
**.***********.********  *

391. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

392. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

393. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

394. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

395. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

396. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

397. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

398. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

399. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

400. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

401. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

402. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

403. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

404. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

405. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

406. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

407. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

408. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

409. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

410. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

411. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

412. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

413. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

414. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

415. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

416. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

417. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

418. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

419. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

420. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

421. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

422. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

423. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

424. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

425. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

426. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

427. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

428. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

429. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

430. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

431. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

432. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

433. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

434. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

435. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

436. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

437. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

438. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

439. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

440. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

441. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

442. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

443. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

444. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

445. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

446. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

447. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

448. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

449. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

450. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

451. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

452. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

453. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

454. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

455. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

456. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

457. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

458. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

459. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

460. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

461. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

462. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

463. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

464. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

465. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

466. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

467. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

468. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

469. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

470. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

471. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

472. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

473. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

474. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

475. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

476. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

477. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

478. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

479. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

480. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

481. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

482. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

483. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

484. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

485. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

486. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

487. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

488. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

489. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

490. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

491. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
aacactggtgctactggtcctcagggt	Protospacer
. .*****.******** *********

492. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
aacactggtgctactggtcctcagggt	Protospacer
. .*****.******** *********

493. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.**************.**

494. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * *****.**************.**

495. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctacagga	Protospacer
******** ************  .**

496. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctacagga	Protospacer
******** ************  .**

497. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctacagga	Protospacer
******** ************  .**

498. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctacagga	Protospacer
******** ************  .**

499. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctacagga	Protospacer
******** ************  .**

500. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctacagga	Protospacer
******** ************  .**

501. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

502. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

503. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

504. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

505. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

506. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

507. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

508. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

509. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

510. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

511. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

512. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

513. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

514. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

515. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

516. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to NZ_AP018204 (Leptolyngbya boryana NIES-2135 plasmid plasmid1 DNA, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
ccgactggcactactggatctcagggc	Protospacer
 * ******.********.*******.

517. spacer 3.9|2239420|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcagggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * *****.**************.**

518. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

519. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

520. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

521. spacer 3.10|2239465|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

522. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

523. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

524. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

525. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** *********

526. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** *********

527. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

528. spacer 3.11|2239510|27|NZ_CP009641|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
ccgactggtgccactggcgctcaaggc	Protospacer
 * **************  *******.

529. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

530. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

531. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

532. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

533. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

534. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

535. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

536. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

537. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

538. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

539. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

540. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

541. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

542. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

543. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

544. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

545. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

546. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

547. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

548. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

549. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

550. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * *****.***********.*****.

551. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gctactggagctactggacctactgga	Protospacer
******** ************   **

552. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
aatactggagctactggtcctcaaggt	Protospacer
. ****** ******** ********.

553. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gtcgctggcgctgctggacctcgaggc	Protospacer
*...********.*********.****

554. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

555. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

556. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

557. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

558. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

559. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

560. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

561. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

562. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

563. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

564. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

565. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

566. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gatactggcgctactggacctaccgga	Protospacer
* *******************   **

567. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
ggtactggcgctactggacctaccgga	Protospacer
* *******************   **

568. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

gctactggcgctactggacctcaaggc	CRISPR spacer
gcggatggagctactggacctcaaggg	Protospacer
** . *** *****************

569. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.*****.

570. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.*****.

571. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggc	CRISPR spacer
gacgctggtgccgctggacctcgaggc	Protospacer
* ..********.*********.****

572. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.*****.

573. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggc	CRISPR spacer
tcaactggtgctactggaccccaaggt	Protospacer
 * ********.********.*****.

574. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggc	CRISPR spacer
gacgctggtgccgctggacctcgaggc	Protospacer
* ..********.*********.****

575. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

576. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

577. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

578. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** *********

579. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** *********

580. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

581. spacer 3.17|2239771|27|NZ_CP009641|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
ccgactggtgccactggcgctcaaggc	Protospacer
 * **************  *******.

582. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

583. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

584. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

585. spacer 3.18|2239816|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

586. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

587. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

588. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

589. spacer 3.19|2239861|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

590. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

591. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

592. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

593. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

594. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

595. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

596. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctaccggtgctactggacctaccggc	Protospacer
 ********************   **.

597. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .**.*********** *********

598. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .**.*********** *********

599. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP017924 (Ralstonia phage RP12 DNA, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccgaaaggtgatactggacctcaaggt	Protospacer
 * *  **** ****************

600. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to AP017925 (Ralstonia phage RP31 DNA, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccgaaaggtgatactggacctcaaggt	Protospacer
 * *  **** ****************

601. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

602. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

603. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

604. spacer 3.21|2239951|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

605. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

606. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

607. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

608. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

609. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

610. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctggtggtgctactggtcctcaaggt	Protospacer
 **. .*********** *********

611. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctaccggtgctactggacctaccggc	Protospacer
 ********************   **.

612. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .**.*********** *********

613. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .**.*********** *********

614. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP017924 (Ralstonia phage RP12 DNA, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccgaaaggtgatactggacctcaaggt	Protospacer
 * *  **** ****************

615. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to AP017925 (Ralstonia phage RP31 DNA, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgctactggacctcaaggt	CRISPR spacer
ccgaaaggtgatactggacctcaaggt	Protospacer
 * *  **** ****************

616. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

617. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
ccaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

618. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
tcaactggtgctactggacctcaagga	Protospacer
 * **.*****.**************

619. spacer 3.23|2240041|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctaccggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

620. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

621. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

622. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
acaactggagccactggtcctcaaggc	Protospacer
.* ***** ******** ********.

623. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** *********

624. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** *********

625. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
cctcaaggtgctactggacctcaaggt	Protospacer
 **   *****.***************

626. spacer 3.24|2240086|27|NZ_CP009641|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 5, identity: 0.815

gctactggtgccactggacctcaaggt	CRISPR spacer
ccgactggtgccactggcgctcaaggc	Protospacer
 * **************  *******.

627. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
tcaggtatcacaggtgctattggtggt	Protospacer
. ***** ***********.***** .

628. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to NC_041979 (Escherichia coli O157 typing phage 1, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

629. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MH571750 (Escherichia phage vB_EcoM-Ro111lw, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

630. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to NC_012749 (Enterobacteria phage WV8, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

631. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to EU877232 (Enterobacteria phage WV8, complete sequence) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

632. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
ttaggtaccactggtgctactggtgat	Protospacer
. ***** *** ************* .

633. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KP869113 (Escherichia coli O157 typing phage 15, partial genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

634. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KP869106 (Escherichia coli O157 typing phage 8, partial genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

635. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KP869109 (Escherichia coli O157 typing phage 11, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

636. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MK524176 (Escherichia phage PHB11, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

637. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
acaggtaacacagttgcttctggtggt	Protospacer
  *********** **** ****** .

638. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to JX560968 (Escherichia phage EC6, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

639. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to NC_028872 (Escherichia phage HY02, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

640. spacer 2.2|2238568|27|NZ_CP009641|CRT matches to KP869110 (Escherichia coli O157 typing phage 12, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

641. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
tcaggtatcacaggtgctattggtggt	Protospacer
. ***** ***********.***** .

642. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to NC_041979 (Escherichia coli O157 typing phage 1, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

643. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MH571750 (Escherichia phage vB_EcoM-Ro111lw, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

644. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to NC_012749 (Enterobacteria phage WV8, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

645. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to EU877232 (Enterobacteria phage WV8, complete sequence) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

646. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
ttaggtaccactggtgctactggtgat	Protospacer
. ***** *** ************* .

647. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KP869113 (Escherichia coli O157 typing phage 15, partial genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

648. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KP869106 (Escherichia coli O157 typing phage 8, partial genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

649. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KP869109 (Escherichia coli O157 typing phage 11, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

650. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MK524176 (Escherichia phage PHB11, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

651. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
acaggtaacacagttgcttctggtggt	Protospacer
  *********** **** ****** .

652. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to JX560968 (Escherichia phage EC6, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

653. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to NC_028872 (Escherichia phage HY02, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

654. spacer 2.3|2238613|27|NZ_CP009641|CRT matches to KP869110 (Escherichia coli O157 typing phage 12, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

655. spacer 2.6|2238730|27|NZ_CP009641|CRT matches to KU682439 (Stenotrophomonas phage vB_SmaS-DLP_6, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacgggcgctactggtgcc	CRISPR spacer
actggtaacacgggagctcctggtgct	Protospacer
   *********** *** *******.

656. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
tcaggtatcacaggtgctattggtggt	Protospacer
. ***** ***********.***** .

657. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to NC_041979 (Escherichia coli O157 typing phage 1, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

658. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MH571750 (Escherichia phage vB_EcoM-Ro111lw, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

659. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to NC_012749 (Enterobacteria phage WV8, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

660. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to EU877232 (Enterobacteria phage WV8, complete sequence) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

661. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
ttaggtaccactggtgctactggtgat	Protospacer
. ***** *** ************* .

662. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KP869113 (Escherichia coli O157 typing phage 15, partial genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

663. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KP869106 (Escherichia coli O157 typing phage 8, partial genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

664. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KP869109 (Escherichia coli O157 typing phage 11, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

665. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MK524176 (Escherichia phage PHB11, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

666. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
acaggtaacacagttgcttctggtggt	Protospacer
  *********** **** ****** .

667. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to JX560968 (Escherichia phage EC6, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agtggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

668. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to NC_028872 (Escherichia phage HY02, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

669. spacer 2.7|2238775|27|NZ_CP009641|CRT matches to KP869110 (Escherichia coli O157 typing phage 12, complete genome) position: , mismatch: 6, identity: 0.778

caaggtaacacaggtgctactggtgcc	CRISPR spacer
agcggtaacacaggtggtactggttct	Protospacer
 . ************* ******* *.

670. spacer 2.9|2238856|27|NZ_CP009641|CRT matches to MK613348 (Roseobacter phage CRP-6, complete genome) position: , mismatch: 6, identity: 0.778

caaggaccagcgggtgctactggcgct	CRISPR spacer
actggacctacgggtgctactggcgca	Protospacer
   ***** .****************

671. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

672. spacer 3.1|2239087|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

673. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

674. spacer 3.3|2239168|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

675. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

676. spacer 3.4|2239213|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

677. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

678. spacer 3.6|2239294|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

679. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

680. spacer 3.8|2239375|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

681. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

682. spacer 3.13|2239591|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

683. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

684. spacer 3.14|2239636|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggcgctactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .*****.******** ********.

685. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggtgccactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** ********.

686. spacer 3.15|2239681|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggtgccactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** ********.

687. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gctactggtgccactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** ********.

688. spacer 3.16|2239726|27|NZ_CP009641|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gctactggtgccactggacctcaaggc	CRISPR spacer
aacactggtgctactggtcctcaaggt	Protospacer
. .********.***** ********.

689. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctaccggtgctactggaccagttggc	Protospacer
 *******************    **.

690. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

gctaccggtgctactggacctcaaggt	CRISPR spacer
tttcaaggtgatactggacctcaaggt	Protospacer
 .*   **** ****************

691. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctaccggtgctactggaccagttggc	Protospacer
 *******************    **.

692. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctaccggtgctactggaccagttggc	Protospacer
 *******************    **.

693. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

gctaccggtgctactggacctcaaggt	CRISPR spacer
tttcaaggtgatactggacctcaaggt	Protospacer
 .*   **** ****************

694. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

gctaccggtgctactggacctcaaggt	CRISPR spacer
cctaccggtgctactggaccagttggc	Protospacer
 *******************    **.

695. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MK448998 (Streptococcus phage Javan636, complete genome) position: , mismatch: 7, identity: 0.741

gctaccggtgctactggacctcaaggt	CRISPR spacer
aaacaaggtgctactggacctcaagga	Protospacer
.     ********************

696. spacer 3.20|2239906|27|NZ_CP009641|CRT matches to MK448821 (Streptococcus phage Javan623, complete genome) position: , mismatch: 7, identity: 0.741

gctaccggtgctactggacctcaaggt	CRISPR spacer
aaacaaggtgctactggacctcaagga	Protospacer
.     ********************

697. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MK448998 (Streptococcus phage Javan636, complete genome) position: , mismatch: 7, identity: 0.741

gctaccggtgctactggacctcaaggt	CRISPR spacer
aaacaaggtgctactggacctcaagga	Protospacer
.     ********************

698. spacer 3.22|2239996|27|NZ_CP009641|CRT matches to MK448821 (Streptococcus phage Javan623, complete genome) position: , mismatch: 7, identity: 0.741

gctaccggtgctactggacctcaaggt	CRISPR spacer
aaacaaggtgctactggacctcaagga	Protospacer
.     ********************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

551560 : 560879

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755546.1\|551560_552823_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	6.8e-12	32.0
WP_001194301.1\|552921_553686_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453763.1\|553926_555687_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.4e-267	95.9
WP_000254054.1\|555766_556453_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-118	93.9
WP_001231497.1\|556449_557523_+	membrane protein	W8CYF6	Bacillus_phage	1.2e-169	87.4
WP_000823554.1\|557547_558135_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|558331_559051_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000103838.1\|559200_559872_+	O-methyltransferase	W8CYT3	Bacillus_phage	6.5e-62	86.9
WP_001258513.1\|560006_560879_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	2.7e-68	46.6

DBSCAN-SWA_2

1337657 : 1344863

Geobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001065246.1\|1337657_1339025_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	9.6e-20	38.1
WP_000720567.1\|1339462_1339981_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	9.5e-45	47.3
WP_001093444.1\|1340190_1340577_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655496.1\|1340642_1341350_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.0e-17	27.0
WP_000994639.1\|1341371_1341725_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288934.1\|1341738_1342143_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714659.1\|1342390_1343776_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	7.8e-78	59.9
WP_000820167.1\|1343778_1343991_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	7.3e-12	54.4
WP_000540634.1\|1344056_1344863_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.5e-109	69.7

DBSCAN-SWA_3

2909308 : 2975533

Bacillus_phage(40.0%)

protease,tRNA,integrase,bacteriocin,coat

attL 2927754:2927773|attR 2978469:2978488

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000125362.1\|2909308_2910448_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	42.1
WP_000354029.1\|2910460_2911513_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_000138162.1\|2911532_2911733_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_000344460.1\|2911729_2912731_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.2e-08	27.2
WP_000464508.1\|2912736_2913354_-	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
WP_000823597.1\|2913542_2914487_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000871185.1\|2914499_2915030_-	BofC protein	NA	NA	NA	NA
WP_001994754.1\|2915150_2916080_-	DMT family transporter	NA	NA	NA	NA
WP_000426920.1\|2916147_2916468_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000721239.1\|2916913_2917348_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001093533.1\|2917381_2918026_-	hypothetical protein	NA	NA	NA	NA
WP_001994739.1\|2918204_2920052_-\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA
WP_000025291.1\|2920426_2921533_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_001092246.1\|2921563_2922397_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_001138561.1\|2922416_2923946_-	L-aspartate oxidase	NA	NA	NA	NA
WP_000973794.1\|2924098_2925238_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	7.7e-31	28.9
WP_000812272.1\|2925240_2925783_+	transcription repressor NadR	NA	NA	NA	NA
WP_000510428.1\|2925864_2926512_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_000621721.1\|2926593_2927445_-	prephenate dehydratase	NA	NA	NA	NA
WP_001026353.1\|2927541_2929458_-	ABC transporter permease	NA	NA	NA	NA
2927754:2927773	attL	NA	NA	NA	NA
WP_001011372.1\|2929507_2931430_-	ABC transporter permease	NA	NA	NA	NA
WP_000114531.1\|2931404_2932181_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.2e-19	31.0
WP_000865391.1\|2932274_2933357_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_000276720.1\|2933346_2934054_-	response regulator transcription factor	NA	NA	NA	NA
WP_000496111.1\|2934193_2935480_-	GTPase ObgE	NA	NA	NA	NA
WP_001037006.1\|2935479_2936028_-	sporulation protein	NA	NA	NA	NA
WP_000944957.1\|2936091_2936382_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_001973720.1\|2936385_2936730_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|2936741_2937050_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_000855457.1\|2937219_2938608_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_000599073.1\|2938675_2939536_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_000797461.1\|2939528_2940275_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000503310.1\|2940408_2941206_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_000391517.1\|2941208_2941895_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_000975753.1\|2941930_2942476_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_001135493.1\|2942490_2943342_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000466737.1\|2943383_2944403_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_000366809.1\|2944837_2946259_+	hypothetical protein	NA	NA	NA	NA
WP_000907107.1\|2946218_2949260_+	hypothetical protein	NA	NA	NA	NA
WP_000913003.1\|2949289_2951053_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_001087615.1\|2951039_2951792_+	hypothetical protein	NA	NA	NA	NA
WP_000081956.1\|2953348_2954716_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000051680.1\|2954743_2956936_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	6.9e-44	27.7
WP_000849670.1\|2957145_2957322_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_001089676.1\|2957344_2957551_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_001212906.1\|2958459_2959581_+	DUF11 domain-containing protein	NA	NA	NA	NA
WP_001994729.1\|2959987_2961262_-	collagen-like protein	NA	NA	NA	NA
WP_001994714.1\|2962297_2962420_-	DNA repair protein	NA	NA	NA	NA
WP_001994722.1\|2963313_2965833_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_001994746.1\|2966671_2968054_-	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_001994733.1\|2968815_2970243_+	serine hydrolase	NA	NA	NA	NA
WP_042516397.1\|2970716_2971559_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_001994712.1\|2972070_2972607_-	hypothetical protein	NA	NA	NA	NA
WP_001994717.1\|2972737_2972983_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001994752.1\|2973202_2973952_-	hypothetical protein	NA	NA	NA	NA
WP_042516400.1\|2974198_2975533_-\|integrase	integrase	NA	NA	NA	NA
2978469:2978488	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3593199 : 3647776

Streptococcus_phage(30.0%)

holin,transposase,integrase

attL 3584895:3584911|attR 3636591:3636607

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3584895:3584911	attL	NA	NA	NA	NA
WP_000938795.1\|3593199_3595857_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_001026986.1\|3599090_3600410_-	hypothetical protein	NA	NA	NA	NA
WP_042516415.1\|3600916_3601786_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_080335331.1\|3602548_3602713_+\|transposase	transposase	NA	NA	NA	NA
WP_003291015.1\|3605508_3607692_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	4.9e-50	29.2
WP_000762778.1\|3607929_3608112_+	hypothetical protein	NA	NA	NA	NA
WP_001996263.1\|3608278_3609148_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_000907090.1\|3609332_3610325_-	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_000412934.1\|3610545_3612039_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.1e-82	40.4
WP_000774089.1\|3613138_3613318_+	hypothetical protein	NA	NA	NA	NA
WP_001123905.1\|3615683_3616151_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.4e-47	61.3
WP_000391103.1\|3616399_3618820_-	ribonuclease R	Q0GXV6	Lactococcus_phage	5.7e-92	41.4
WP_000761973.1\|3618962_3619703_-	carboxylesterase	NA	NA	NA	NA
WP_000557262.1\|3619864_3620098_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000078306.1\|3620192_3620885_-	LrgB family protein	NA	NA	NA	NA
WP_000673222.1\|3620881_3621250_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_001125041.1\|3621525_3622476_+	nucleoside hydrolase	NA	NA	NA	NA
WP_000103949.1\|3622526_3623822_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	6.4e-183	75.4
WP_001231156.1\|3623852_3625382_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_001231037.1\|3625378_3626134_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_001036338.1\|3626166_3627351_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_000161236.1\|3627490_3628495_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_001258187.1\|3628521_3629550_-	gapA transcriptional regulator CggR	NA	NA	NA	NA
WP_000869728.1\|3629686_3629932_-	glutaredoxin family protein	NA	NA	NA	NA
WP_000647969.1\|3629941_3631249_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_000216166.1\|3631788_3631995_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_001228547.1\|3632088_3632574_+	hypothetical protein	NA	NA	NA	NA
WP_000095399.1\|3632603_3633080_+	stage V sporulation protein AC	NA	NA	NA	NA
WP_000938963.1\|3633080_3634097_+	stage V sporulation protein AD	NA	NA	NA	NA
WP_000575924.1\|3634093_3634444_+	stage V sporulation protein AE	NA	NA	NA	NA
WP_000215914.1\|3634455_3634662_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_000018934.1\|3634682_3635552_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_001049162.1\|3635793_3636375_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
WP_000250307.1\|3636699_3636948_-	HPr family phosphocarrier protein	NA	NA	NA	NA
3636591:3636607	attR	NA	NA	NA	NA
WP_000006561.1\|3636971_3637922_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	6.6e-52	38.1
WP_000712177.1\|3638011_3638965_-	YvcK family protein	A1IMD5	Streptococcus_phage	1.3e-63	43.5
WP_000138464.1\|3638968_3639850_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.6e-07	28.9
WP_001190080.1\|3639870_3640329_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_000455203.1\|3640557_3641364_-	DUF368 domain-containing protein	NA	NA	NA	NA
WP_001288072.1\|3641526_3642483_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.4e-89	53.9
WP_000517726.1\|3642567_3644079_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_001255052.1\|3644218_3644731_-	acetyltransferase	NA	NA	NA	NA
WP_000700956.1\|3644754_3645405_-	pyrophosphatase PpaX	NA	NA	NA	NA
WP_000924246.1\|3645472_3646285_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_001127244.1\|3646309_3647239_-	HPr(Ser) kinase/phosphatase	NA	NA	NA	NA
WP_001267308.1\|3647395_3647776_-\|holin	phage holin family protein	NA	NA	NA	NA

DBSCAN-SWA_5

4327055 : 4335432

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625683.1\|4327055_4328363_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
WP_001170540.1\|4328451_4329171_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
WP_000278823.1\|4329163_4329418_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666792.1\|4329414_4330098_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055577.1\|4330081_4332301_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000879029.1\|4332285_4333701_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_001994851.1\|4333807_4334848_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	7.2e-68	45.9
WP_000088582.1\|4334844_4335432_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	5.9e-27	37.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP009639

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 8439

Bacillus_phage(100.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144405580.1\|353_1358_+	foldase	NA	NA	NA	NA
WP_001994467.1\|1566_2049_-	hypothetical protein	NA	NA	NA	NA
WP_001995810.1\|2017_4198_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_001995944.1\|4227_5610_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_001995894.1\|5626_6163_-	hypothetical protein	NA	NA	NA	NA
WP_001995794.1\|6539_7013_-	hypothetical protein	NA	NA	NA	NA
WP_001996052.1\|7044_8439_-	type II DNA-methyltransferase	A0A1P8CX13	Bacillus_phage	2.0e-17	27.0

DBSCAN-SWA_2

11771 : 12782

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995830.1\|11771_12782_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	4.1e-36	33.7

DBSCAN-SWA_3

23964 : 38382

Bacillus_phage(20.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995766.1\|23964_24318_-	hypothetical protein	A0A1B1P774	Bacillus_phage	4.5e-46	70.9
WP_001995983.1\|24430_24853_-	DUF3888 domain-containing protein	NA	NA	NA	NA
WP_001995939.1\|24903_25770_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_042516219.1\|25878_26370_-	hypothetical protein	NA	NA	NA	NA
WP_001995833.1\|26394_28881_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	4.0e-56	32.0
WP_001995961.1\|29009_30662_-	AAA family ATPase	G3MAX6	Bacillus_virus	5.2e-44	40.7
WP_001995871.1\|30860_31541_-	hypothetical protein	NA	NA	NA	NA
WP_001995952.1\|31573_31852_-	hypothetical protein	NA	NA	NA	NA
WP_001996028.1\|31817_32885_-	acyltransferase	NA	NA	NA	NA
WP_001995764.1\|33047_34388_+	C40 family peptidase	A0A2H4PI41	Streptomyces_phage	2.5e-20	41.5
WP_001995862.1\|34425_35058_-	hypothetical protein	NA	NA	NA	NA
WP_001995962.1\|35145_38382_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1V0DZX6	Clostridioides_phage	1.1e-24	47.6

DBSCAN-SWA_4

44371 : 46204

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000914978.1\|44371_46204_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-32	27.0

DBSCAN-SWA_5

81879 : 83217

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995921.1\|81879_83217_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	6.4e-93	44.8

DBSCAN-SWA_6

99758 : 105366

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996010.1\|99758_100535_+	DUF2726 domain-containing protein	A0A223G0T1	Staphylococcus_phage	8.4e-21	31.6
WP_001995905.1\|100895_101432_+	hypothetical protein	NA	NA	NA	NA
WP_001995843.1\|101498_102971_+	hypothetical protein	NA	NA	NA	NA
WP_001995736.1\|103089_103536_+	YopX protein	H0USU9	Bacillus_phage	1.7e-29	49.6
WP_001995749.1\|103532_103964_+	ATP-binding protein	NA	NA	NA	NA
WP_001996017.1\|103999_104290_+	hypothetical protein	NA	NA	NA	NA
WP_001996040.1\|104676_105366_+	hypothetical protein	A0A068EMK6	Bacillus_phage	1.3e-60	52.2

DBSCAN-SWA_7

111758 : 115923

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996005.1\|111758_112370_+	hypothetical protein	S6ATW0	Bacillus_phage	1.3e-05	31.6
WP_042516228.1\|112510_113488_+	hypothetical protein	R4JGN0	Bacillus_phage	3.7e-34	31.7
WP_042516229.1\|113658_115923_+	DNA translocase FtsK	R4JMR0	Bacillus_phage	2.4e-84	31.5

DBSCAN-SWA_8

121587 : 121842

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995910.1\|121587_121842_-	hypothetical protein	A0A218KBU4	Bacillus_phage	2.0e-11	41.5

DBSCAN-SWA_9

130202 : 130574

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996002.1\|130202_130574_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	2.1e-25	47.1

DBSCAN-SWA_10

135524 : 142968

Bacillus_phage(33.33%)

integrase

attL 135290:135306|attR 150130:150146

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
135290:135306	attL	NA	NA	NA	NA
WP_001995771.1\|135524_136793_+	DNA repair protein MucB	O64031	Bacillus_phage	6.9e-97	47.4
WP_017562367.1\|136940_137285_-	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_001994100.1\|137397_138225_-	collagen-like protein	NA	NA	NA	NA
WP_001082942.1\|138351_139059_-	hypothetical protein	NA	NA	NA	NA
WP_000205101.1\|139359_139740_-	hypothetical protein	NA	NA	NA	NA
WP_000824133.1\|139732_141838_-\|integrase	tyrosine-type recombinase/integrase	L7TK95	Rhizobium_phage	8.4e-07	27.0
WP_001265872.1\|141849_142968_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	2.3e-11	26.8
150130:150146	attR	NA	NA	NA	NA

DBSCAN-SWA_11

146427 : 148799

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996049.1\|146427_147822_+	HAMP domain-containing histidine kinase	A0A2K9L0Z8	Tupanvirus	2.0e-09	27.2
WP_001995958.1\|147793_148372_+	response regulator transcription factor	NA	NA	NA	NA
WP_001995811.1\|148598_148799_+	helix-turn-helix transcriptional regulator	A0A139ZPK3	Marinitoga_camini_virus	4.8e-05	44.3

DBSCAN-SWA_12

152612 : 154244

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995857.1\|152612_154244_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.5e-51	34.6

DBSCAN-SWA_13

157521 : 163079

Lactobacillus_phage(33.33%)

integrase

attL 148427:148441|attR 171572:171586

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
148427:148441	attL	NA	NA	NA	NA
WP_001994662.1\|157521_159387_-	hypothetical protein	A0A0A7NNI1	Lactobacillus_phage	8.1e-86	42.9
WP_001994655.1\|159465_159846_-	hypothetical protein	NA	NA	NA	NA
WP_001994650.1\|159842_161945_-\|integrase	tyrosine-type recombinase/integrase	L7TK95	Rhizobium_phage	8.4e-07	28.1
WP_001994656.1\|161963_163079_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIE1	Clostridium_phage	3.2e-13	26.4
171572:171586	attR	NA	NA	NA	NA

DBSCAN-SWA_14

167329 : 176391

Geobacillus_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995840.1\|167329_168361_+	hypothetical protein	A0A0H3UZB6	Geobacillus_virus	7.3e-12	28.5
WP_001996059.1\|168452_168845_+	hypothetical protein	NA	NA	NA	NA
WP_001995834.1\|168923_170879_+	hypothetical protein	A0A0H3UZB6	Geobacillus_virus	4.0e-19	25.9
WP_001995889.1\|170908_171568_+	hypothetical protein	NA	NA	NA	NA
WP_001995992.1\|171585_172827_+	glutathionylspermidine synthase family protein	A0A219Y9C1	Aeromonas_phage	5.8e-24	27.5
WP_001996055.1\|173022_173730_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001995760.1\|174330_175098_-	polysaccharide deacetylase family protein	A0A2K9L357	Tupanvirus	3.3e-09	25.9
WP_000383890.1\|175545_176391_+	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	1.8e-24	45.1

DBSCAN-SWA_15

181120 : 182275

Clostridium_phage(100.0%)

integrase

attL 170105:170119|attR 185459:185473

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
170105:170119	attL	NA	NA	NA	NA
WP_001265869.1\|181120_182275_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	2.6e-10	30.4
WP_001265869.1\|181120_182275_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	2.6e-10	30.4
185459:185473	attR	NA	NA	NA	NA

DBSCAN-SWA_16

186752 : 187622

Salisaeta_icosahedral_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995925.1\|186752_187622_+	RNA polymerase sigma factor RpoD/SigA	I1ZBD5	Salisaeta_icosahedral_phage	9.4e-13	26.4

DBSCAN-SWA_17

203594 : 205083

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995937.1\|203594_204578_+	DNA adenine methylase	A0A0E3I2Y7	Synechococcus_phage	1.3e-05	22.6
WP_001996019.1\|204612_205083_+	hypothetical protein	A0A291AX77	Salmonella_phage	4.6e-06	27.0

DBSCAN-SWA_18

210580 : 229574

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995788.1\|210580_210862_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.2e-14	65.6
WP_001996037.1\|210897_211191_+	hypothetical protein	NA	NA	NA	NA
WP_001995897.1\|211436_211625_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_001995765.1\|211649_212222_-	hypothetical protein	NA	NA	NA	NA
WP_001995918.1\|213031_214447_+	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	1.4e-122	46.2
WP_001995965.1\|214510_214723_+	hypothetical protein	NA	NA	NA	NA
WP_001996047.1\|214719_215142_+	hypothetical protein	A0A1B1P7B4	Bacillus_phage	2.2e-60	77.9
WP_001996033.1\|215312_215534_+	hypothetical protein	NA	NA	NA	NA
WP_001995887.1\|215838_216510_+	hypothetical protein	U5PS65	Bacillus_phage	7.7e-31	34.5
WP_001996027.1\|216500_216797_+	hypothetical protein	NA	NA	NA	NA
WP_001995769.1\|218149_219319_+	serine hydrolase	A0A1I9S919	Mycobacterium_phage	2.2e-20	27.6
WP_001996008.1\|219584_219833_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_042516243.1\|220187_220571_-	hypothetical protein	NA	NA	NA	NA
WP_001995883.1\|220686_221199_-	DUF1572 family protein	NA	NA	NA	NA
WP_001995726.1\|221246_221918_-	HAD family hydrolase	Q6VY93	Streptomyces_phage	6.6e-06	32.5
WP_001995975.1\|222239_222662_-	NUDIX hydrolase	NA	NA	NA	NA
WP_001995951.1\|222787_223357_-	hypothetical protein	NA	NA	NA	NA
WP_001996013.1\|223665_224580_-	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_001995722.1\|224847_225390_+	recombinase family protein	M9Q1K0	Clostridium_phage	6.2e-31	42.4
WP_001996058.1\|225435_228384_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	7.2e-81	26.5
WP_042516244.1\|228675_228882_+	hypothetical protein	NA	NA	NA	NA
WP_001995753.1\|228980_229334_+	hypothetical protein	NA	NA	NA	NA
WP_001995994.1\|229358_229574_+	hypothetical protein	A0A0A7AQI6	Bacillus_phage	3.9e-21	71.8

DBSCAN-SWA_19

242162 : 246628

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995648.1\|242162_244001_+	maturase	A0A0U4J920	Pseudomonas_phage	8.4e-27	36.1
WP_001995783.1\|245647_246628_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	8.4e-26	30.7

DBSCAN-SWA_20

250019 : 255548

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000412934.1\|250019_251513_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.1e-82	40.4
WP_000907090.1\|251733_252726_+	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_000762778.1\|252944_253127_-	hypothetical protein	NA	NA	NA	NA
WP_003291015.1\|253364_255548_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	4.9e-50	29.2

DBSCAN-SWA_21

276407 : 276806

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001995895.1\|276407_276806_+	hypothetical protein	A0A218KC39	Bacillus_phage	3.0e-14	41.2

DBSCAN-SWA_22

280304 : 281588

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001996016.1\|280304_281588_+	DNA cytosine methyltransferase	F2Y148	Organic_Lake_phycodnavirus	2.1e-45	32.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009637

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009638

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP009641

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP009639

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection