CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	0 crisprs	RT,csa3,c2c10_CAS-V-U3,c2c4_V-U1	0	12
NZ_CP009902	Bacillus anthracis strain 2002013094 chromosome, complete genome	4 crisprs	DinG,cas14k,c2c9_V-U4,WYL,csa3,cas3,cas14j,DEDDh	0	10
NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	1 crisprs	NA	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 70745

Bacillus_phage(100.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042514082.1\|2314_2713_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000022108.1\|2909_3083_-	hypothetical protein	NA	NA	NA	NA
WP_000633828.1\|3735_4020_-	hypothetical protein	NA	NA	NA	NA
WP_003159767.1\|4720_5008_-	hypothetical protein	NA	NA	NA	NA
WP_003159853.1\|6149_6719_+	ATP-binding protein	NA	NA	NA	NA
WP_001259112.1\|6784_7711_-	hypothetical protein	NA	NA	NA	NA
WP_000796705.1\|7720_8704_-	hypothetical protein	NA	NA	NA	NA
WP_000581648.1\|9059_9839_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000124744.1\|9854_10439_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_144405303.1\|13153_14581_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000337109.1\|15445_16528_-	Abi family protein	NA	NA	NA	NA
WP_144405304.1\|18068_19442_+\|transposase	IS4-like element IS231S family transposase	NA	NA	NA	NA
WP_000435025.1\|21264_21447_-	hypothetical protein	NA	NA	NA	NA
WP_001978086.1\|22011_22209_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_080334562.1\|22235_22439_+	hypothetical protein	NA	NA	NA	NA
WP_001104326.1\|22683_22872_+	hypothetical protein	NA	NA	NA	NA
WP_001053154.1\|26382_26769_-	hypothetical protein	NA	NA	NA	NA
WP_042514084.1\|26959_28246_-	hypothetical protein	NA	NA	NA	NA
WP_002194758.1\|29953_30289_-	hypothetical protein	NA	NA	NA	NA
WP_000564672.1\|30889_31495_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000267220.1\|31686_31914_+	hypothetical protein	NA	NA	NA	NA
WP_000557418.1\|33152_34289_+	hypothetical protein	NA	NA	NA	NA
WP_001002930.1\|34999_35953_+	hypothetical protein	NA	NA	NA	NA
WP_042514085.1\|35972_37451_+	hypothetical protein	NA	NA	NA	NA
WP_001168874.1\|37467_37917_+	hypothetical protein	NA	NA	NA	NA
WP_001181740.1\|37942_38338_+	DUF4320 family protein	NA	NA	NA	NA
WP_003159838.1\|38561_39776_+	surface layer protein	NA	NA	NA	NA
WP_042514086.1\|39930_42282_+	hypothetical protein	NA	NA	NA	NA
WP_000353184.1\|42757_42943_-	hypothetical protein	NA	NA	NA	NA
WP_000804775.1\|43317_44178_+	Flp pilus assembly protein CpaB	NA	NA	NA	NA
WP_000375827.1\|44194_45013_+	AAA family ATPase	NA	NA	NA	NA
WP_000264597.1\|45029_46463_+	CpaF family protein	NA	NA	NA	NA
WP_042514087.1\|46455_47388_+	hypothetical protein	NA	NA	NA	NA
WP_000956355.1\|48299_48503_+	hypothetical protein	NA	NA	NA	NA
WP_000879955.1\|48569_48773_+	hypothetical protein	NA	NA	NA	NA
WP_000879954.1\|48845_49052_+	hypothetical protein	NA	NA	NA	NA
WP_002194762.1\|49123_49729_+	membrane protein	NA	NA	NA	NA
WP_042514088.1\|49799_50885_+	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_042514089.1\|52883_53429_+	hypothetical protein	NA	NA	NA	NA
WP_001088470.1\|53425_54049_+	hypothetical protein	NA	NA	NA	NA
WP_001108749.1\|55530_56844_+	DUF3854 domain-containing protein	NA	NA	NA	NA
WP_001053646.1\|56981_57878_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000502634.1\|57964_58234_-	hypothetical protein	NA	NA	NA	NA
WP_001169888.1\|58491_58677_+	hypothetical protein	NA	NA	NA	NA
WP_025986961.1\|58793_59213_+	hypothetical protein	NA	NA	NA	NA
WP_001233519.1\|59279_59630_+	PrgI family protein	NA	NA	NA	NA
WP_000891997.1\|59630_60545_+	hypothetical protein	NA	NA	NA	NA
WP_000765105.1\|60547_62647_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_042514090.1\|62677_66346_+	hypothetical protein	NA	NA	NA	NA
WP_000259859.1\|66367_66694_+	hypothetical protein	NA	NA	NA	NA
WP_042514091.1\|66776_68894_+	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	1.7e-15	39.1
WP_000720692.1\|68910_69492_+	hypothetical protein	NA	NA	NA	NA
WP_001242516.1\|69648_70032_+	hypothetical protein	NA	NA	NA	NA
WP_003159747.1\|70022_70328_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_000678363.1\|70457_70745_+	hypothetical protein	A0A1B1P7B4	Bacillus_phage	1.4e-34	72.6

DBSCAN-SWA_2

83723 : 84611

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000702222.1\|83723_84611_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	9.1e-80	53.3

DBSCAN-SWA_3

96451 : 96784

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001978036.1\|96451_96784_+	purine phosphoribosyltransferase family protein	A0A1V0SKE5	Klosneuvirus	8.3e-10	38.4

DBSCAN-SWA_4

104287 : 107988

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003165373.1\|104287_107266_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	8.8e-252	44.1
WP_000639133.1\|107406_107988_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.2e-27	39.1

DBSCAN-SWA_5

114943 : 117238

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042514097.1\|114943_117238_+	anthrax toxin protective antigen	A0A1V0E026	Clostridioides_phage	2.7e-75	33.7

DBSCAN-SWA_6

126430 : 127474

Bacillus_phage(100.0%)

integrase

attL 118774:118788|attR 129382:129396

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
118774:118788	attL	NA	NA	NA	NA
WP_001021546.1\|126430_127474_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	2.9e-08	24.0
WP_001021546.1\|126430_127474_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	2.9e-08	24.0
129382:129396	attR	NA	NA	NA	NA

DBSCAN-SWA_7

131450 : 132683

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000107153.1\|131450_132683_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	8.0e-66	58.9

DBSCAN-SWA_8

139164 : 140250

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000070475.1\|139164_140250_+	tyrosine recombinase XerS	A0A0K2CP59	Brevibacillus_phage	2.1e-09	28.8

DBSCAN-SWA_9

143481 : 144576

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000637338.1\|143481_144576_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.5e-95	49.6

DBSCAN-SWA_10

147931 : 154616

Klosneuvirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000520727.1\|147931_150595_-	type IA DNA topoisomerase	A0A1V0SIB2	Klosneuvirus	2.2e-12	20.7
WP_078030497.1\|151161_151614_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A142F1Q5	Bacillus_phage	3.5e-35	53.0
WP_000914414.1\|152832_153261_+	hypothetical protein	A0A0K2CZD8	Paenibacillus_phage	1.2e-21	39.2
WP_000453400.1\|153977_154616_-	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	5.3e-21	34.0

DBSCAN-SWA_11

159528 : 161337

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001099011.1\|159528_161337_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.3e-92	38.8

DBSCAN-SWA_12

178108 : 181147

Bacillus_phage(50.0%)

integrase

attL 160966:160980|attR 179868:179882

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
160966:160980	attL	NA	NA	NA	NA
WP_001006036.1\|178108_179056_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	7.8e-37	31.0
WP_001118290.1\|179650_181147_+	hypothetical protein	A0A0H3UZK2	Geobacillus_virus	1.7e-118	46.6
179868:179882	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009902

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009902_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009902_1

673837-674092

Orphan

Consensus_repeat	Method
TTCTCATGCGGAAGGTAAACATACA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009902_1

>merge|NZ_CP009902|1|673837-674092|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCACATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTTCTCTCATGCCGAAGGATCAAAAACGAAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTATTCTCATGCGGAAGGTAAACATACAATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTCTTCTCATGCGGAAGGTAATCATACA

>NZ_CP009902|1|1|673837-674092|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCA	CATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTT
CTCTCATGCCGAAGGATCAAAAACG	AAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTA
TTCTCATGCGGAAGGTAAACATACA	ATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTC
TTCTCATGCGGAAGGTAATCATACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009902.1\|WP_000872719.1\|672470_673211_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP009902.1\|WP_000043381.1\|678447_678846_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP009902.1\|WP_000428855.1\|668410_669256_+\|O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP009902.1\|WP_000651510.1\|664079_664760_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009902.1\|WP_001004884.1\|669392_670151_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009902.1\|WP_000427734.1\|670157_671093_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP009902.1\|WP_000360641.1\|678845_679739_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP009902.1\|WP_001087866.1\|665455_666145_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP009902.1\|WP_000612267.1\|682138_683383_-\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP009902.1\|WP_000350710.1\|685080_685764_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NZ_CP009902.1\|WP_000191105.1\|677688_678267_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP009902.1\|WP_000799204.1\|683463_685008_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP009902.1\|WP_001079110.1\|674788_675682_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP009902.1\|WP_001271203.1\|664772_665459_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009902.1\|WP_000654696.1\|671235_672396_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP009902.1\|WP_001081482.1\|676513_677152_-\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP009902.1\|WP_000673194.1\|675697_676495_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP009902.1\|WP_000069702.1\|667562_668288_+\|exosporium-leader-peptide-containing-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP009902.1\|WP_001180010.1\|677182_677542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009902.1\|WP_000676166.1\|663327_664065_-\|NTP-transferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133019

Protein	Function_ID	Function_description	E-value
NZ_CP009902.1\|WP_000872719.1\|672470_673211_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP009902.1\|WP_000043381.1\|678447_678846_+\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NZ_CP009902.1\|WP_000428855.1\|668410_669256_+\|O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.13671e-149
NZ_CP009902.1\|WP_000651510.1\|664079_664760_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	6.29242e-108
NZ_CP009902.1\|WP_001004884.1\|669392_670151_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.45028e-20
NZ_CP009902.1\|WP_000427734.1\|670157_671093_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.94506e-22
NZ_CP009902.1\|WP_000360641.1\|678845_679739_+\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	9.58817e-92
NZ_CP009902.1\|WP_001087866.1\|665455_666145_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.33577e-17
NZ_CP009902.1\|WP_000612267.1\|682138_683383_-\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	2.14667e-58
NZ_CP009902.1\|WP_000350710.1\|685080_685764_-\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	1.59388e-85
NZ_CP009902.1\|WP_000191105.1\|677688_678267_+\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NZ_CP009902.1\|WP_000799204.1\|683463_685008_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP009902.1\|WP_001079110.1\|674788_675682_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.12116e-100
NZ_CP009902.1\|WP_001271203.1\|664772_665459_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.87129e-112
NZ_CP009902.1\|WP_000654696.1\|671235_672396_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.59758e-99
NZ_CP009902.1\|WP_001081482.1\|676513_677152_-\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP009902.1\|WP_000673194.1\|675697_676495_-\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP009902.1\|WP_000069702.1\|667562_668288_+\|exosporium-leader-peptide-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.92395e-19
NZ_CP009902.1\|WP_000676166.1\|663327_664065_-\|NTP-transferase-domain-containing-protein	gnl\|CDD\|133019	cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase. This family is the short form of glucose-1-phosphate thymidylyltransferase. Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form. The homotetrameric, feedback inhibited short form is found in numerous bacterial species that produce dTDP-L-rhamnose. The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced.	8.19333e-130

>NZ_CP009902.1|WP_000872719.1|672470_673211_+|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHILDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP009902.1|WP_000654696.1|671235_672396_+|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLCILFAIGTVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGVIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGTITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFVTAVTLTYIFFTHTKFFKTHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIAIFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP009902.1|WP_000427734.1|670157_671093_+|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQDIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP009902.1|WP_001004884.1|669392_670151_+|class-I-SAM-dependent-methyltransferase
MNENKKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP009902.1|WP_000428855.1|668410_669256_+|O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP009902.1|WP_000069702.1|667562_668288_+|exosporium-leader-peptide-containing-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP009902.1|WP_001087866.1|665455_666145_-|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMEMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSSL
>NZ_CP009902.1|WP_001271203.1|664772_665459_-|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLAVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMASQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP009902.1|WP_000651510.1|664079_664760_-|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTFLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS
>NZ_CP009902.1|WP_000676166.1|663327_664065_-|NTP-transferase-domain-containing-protein
MKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVEEFTNQKEGAKVLLQSVDDPERFGVANIQNRKIIEIEEKPKEPKSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHVSLQRANALARDINFGKQFNGE
>NZ_CP009902.1|WP_001079110.1|674788_675682_-|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLPSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHLAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFAAMIPSDMQEVLRQT
>NZ_CP009902.1|WP_000673194.1|675697_676495_-|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP009902.1|WP_001081482.1|676513_677152_-|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP009902.1|WP_001180010.1|677182_677542_-|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP009902.1|WP_000191105.1|677688_678267_+|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP009902.1|WP_000043381.1|678447_678846_+|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP009902.1|WP_000360641.1|678845_679739_+|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSYDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPSLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP009902.1|WP_000612267.1|682138_683383_-|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSIAFSHIIYLPIETTTFEMLFSPVPFQREVLKREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCGYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIIKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP009902.1|WP_000799204.1|683463_685008_-|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP009902.1|WP_000350710.1|685080_685764_-|adaptor-protein-MecA
MDIERINDHTMKFFITYIDIEDRGFNREEIWYDRERSEELFWEMMDEARDHDDFFIDGPLWIQVQAVDKGIEVLVTKAELSKDGQKLELPIGVDKIIDIPLDEGIESLFQQELVEEVEEQAGTNFNEDGTFGFLIKFNDFEDVISLSHRLIFEDIKDELYSFEDRYYVYVEFDEVLHDEEEIDRILSIVLEYGEESTLTIHRVSEYGKQIVKEHALETIRNNFPAKT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009902_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009902_2

786500-786593

Orphan

Consensus_repeat	Method
TTTTACTATTTAACGTATTTAAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009902_2

>merge|NZ_CP009902|2|786500-786593|CRISPRCasFinder
TTTTACTATTTAACGTATTTAAACCGTCTGTTACTTTTCCGGATCCATCTTGTAATTTCCCTATACCGCTTTTGCTATTTAACGTATTTAAACC

>NZ_CP009902|2|2|786500-786593|CRISPRCasFinder
TTTTACTATTTAACGTATTTAAACC	GTCTGTTACTTTTCCGGATCCATCTTGTAATTTCCCTATACCGC
TTTTGCTATTTAACGTATTTAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009902.1\|WP_000984152.1\|790854_791694_+\|membrane-protein	unknown	unknown	unknown
NZ_CP009902.1\|WP_000453710.1\|794802_796155_+\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635
NZ_CP009902.1\|WP_000567010.1\|781575_781704_+\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NZ_CP009902.1\|WP_000184500.1\|790226_790625_-\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP009902.1\|WP_000726793.1\|797635_798571_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP009902.1\|WP_000252599.1\|798585_799632_-\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP009902.1\|WP_003170543.1\|791690_792044_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009902.1\|WP_001228080.1\|796194_797616_-\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP009902.1\|WP_000832626.1\|778979_779408_-\|lipoprotein	unknown	unknown	unknown
NZ_CP009902.1\|WP_001055163.1\|777285_778818_-\|fatty-acid--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|236072
NZ_CP009902.1\|WP_000140275.1\|784011_784317_-\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|378279
NZ_CP009902.1\|WP_000620028.1\|782994_783498_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009902.1\|WP_000963375.1\|787536_788109_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP009902.1\|WP_000279249.1\|792195_794562_-\|endonuclease	unknown	unknown	gnl\|CDD\|225249
NZ_CP009902.1\|WP_042514114.1\|781779_782757_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP009902.1\|WP_000897260.1\|779662_780652_-\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NZ_CP009902.1\|WP_003158412.1\|784353_784569_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009902.1\|WP_003170545.1\|788322_790221_-\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|310280
NZ_CP009902.1\|WP_001068232.1\|783631_783985_+\|PlcR-regulated-protein-PRP2	unknown	unknown	gnl\|CDD\|379617
NZ_CP009902.1\|WP_000784657.1\|780661_781396_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802

Protein	Function_ID	Function_description	E-value
NZ_CP009902.1\|WP_001228080.1\|796194_797616_-\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP009902.1\|WP_000567010.1\|781575_781704_+\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NZ_CP009902.1\|WP_000184500.1\|790226_790625_-\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	1.24316e-46
NZ_CP009902.1\|WP_000726793.1\|797635_798571_-\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP009902.1\|WP_000252599.1\|798585_799632_-\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP009902.1\|WP_001055163.1\|777285_778818_-\|fatty-acid--CoA-ligase-family-protein	gnl\|CDD\|236072	PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP009902.1\|WP_000140275.1\|784011_784317_-\|DUF2087-domain-containing-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	6.13433e-24
NZ_CP009902.1\|WP_000620028.1\|782994_783498_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.41273e-15
NZ_CP009902.1\|WP_000963375.1\|787536_788109_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.13636e-15
NZ_CP009902.1\|WP_000279249.1\|792195_794562_-\|endonuclease	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	6.06794e-71
NZ_CP009902.1\|WP_042514114.1\|781779_782757_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.73841e-113
NZ_CP009902.1\|WP_000897260.1\|779662_780652_-\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	4.02345e-137
NZ_CP009902.1\|WP_000453710.1\|794802_796155_+\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	0
NZ_CP009902.1\|WP_003170545.1\|788322_790221_-\|M56-family-metallopeptidase	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	4.41733e-47
NZ_CP009902.1\|WP_001068232.1\|783631_783985_+\|PlcR-regulated-protein-PRP2	gnl\|CDD\|379617	pfam14470, bPH_3, Bacterial PH domain. Proteins in this family are distantly related to PH domains.	8.25131e-17
NZ_CP009902.1\|WP_000784657.1\|780661_781396_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.45708e-85

>NZ_CP009902.1|WP_003158412.1|784353_784569_-|hypothetical-protein
MMKGNLTYYFILNPLIIFLVYALSPILFHKEKYINMKDALGILVVYYVLISGYCLMDVVSERMKKDSKDKQ
>NZ_CP009902.1|WP_000140275.1|784011_784317_-|DUF2087-domain-containing-protein
MTESEMKFRDATIRNFFDKEDRLKSIPGQKKKKLVLLEHLISKLNAANQYTEKEMNTFIKQYHDDFCTIRREFIVHGFMDREANMYHINGREVWTKWEELK
>NZ_CP009902.1|WP_001068232.1|783631_783985_+|PlcR-regulated-protein-PRP2
MNPILTTAKQLLHKEETILSTLNCSLTGYMITYNVPYPGMLLTTNRRLLFFSQYKNTLIAEFDYEKILSIETKRRIFDKKIIFYYEDEYITLGYITSSNIEEFIDLLRRKCKISTNS
>NZ_CP009902.1|WP_000620028.1|782994_783498_-|GNAT-family-N-acetyltransferase
MIRLAKETDAEAIMDIRKEIILSKTTTKFFIVSPKKLPNDTNAEREKIRKSNEKGNLYIVYEIDNKVVGFLLFNRYELDRLRHAGTMGIKEAYCNQGIGTKLIEFLIRWAKEQNGLEKICLGVVSVNDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYID
>NZ_CP009902.1|WP_042514114.1|781779_782757_-|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLEQGYRNLIFCRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAVGIISEAKRHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLV
>NZ_CP009902.1|WP_000567010.1|781575_781704_+|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NZ_CP009902.1|WP_000784657.1|780661_781396_-|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHRVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
>NZ_CP009902.1|WP_000897260.1|779662_780652_-|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCVKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTEPVTKALGKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEEMTTEEFRQLLLETIFEGETEIPTYELTEEDWKEIHKLSEERYRNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTTALEGVDIARYFGNITTEDFLHLFF
>NZ_CP009902.1|WP_000832626.1|778979_779408_-|lipoprotein
MKRVMYVVLLLSFVIGMTACNDETSSSRTLLSIGKPAKDNVIYFTHTDNKRKIQEIQDMFQNKKWKRNETFSTVNKTPDVVFSIDEDNTGLPALYVTVYFHEDGADVLNLYGEYTSFNKQELAMLREKMSAYYPKMIFGLVS
>NZ_CP009902.1|WP_001055163.1|777285_778818_-|fatty-acid--CoA-ligase-family-protein
MNLVQSLAETAKKKGDKPAYIFMDQSVSYDQLNKMVTRFSSNLAEMGIGKGDNVALVVGNSPHFLVGLYGTMKAGATVIPVNPIYTADEMHYILQNGDVKTIIVLDVLLPVIQSLTTRLPSLENIIICETSSDFNHTETEKMKTFTRMIGAGDLTYEGPELDEEDVAVILYTSGTTGKPKGAMLTHKNLYSNASDVASYLQYTADDRVVAALPMFHVFCLTVAVNAPIVNGATILMLPKFSPKEVFRICRTYEPTIFAGVPTMYNYLYLFEEASAEDVKTLRLCISGGASMPVALLQNFEKRFDVIVSEGYGLSEASPVTCFNPLDRPRKPGSIGTNIWHVENKIVNELGEEVPVGAVGELIVRGPNVMKGYYNAPEDTAATLKDGWLYTGDLAKMDEEGYFYIVDRKKDIVLVGGYNVYPREVEEVLYMHESVAEVVVIGVPDENLGEAVRAYVVLKQTNVTEEELMHYCTLHLAKYKVPKSIEFLTELPKNTTGKLLRRALREKAMQV
>NZ_CP009902.1|WP_000963375.1|787536_788109_-|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAENAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSVIQSYLKIAIDKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSN
>NZ_CP009902.1|WP_003170545.1|788322_790221_-|M56-family-metallopeptidase
MIDMLINVYLPHFFDWLIETSLMASILVGFILCIKILFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYRSSVSEVIPKNMPSTESKMNIESDRKVELESHAETVTKSGKPEVNVSTEQQITLSLYKIAMYVWLVGVFLLAVITFITNRRLYSYIKKQPDITDEQVVTVFNRCKQSMKMKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRNDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEHYSYQAPSLANLSRNKRTMKRRIVMIKKFQKKSYRLSLLGVIVIVAIASLSLFNVRATEGKEKQEDKVEQSKDAFQNAVDMLYGTEENAKKEYHYSARVYEEKTDYLYLAEKALTKDEFQQYIKLSKKIINIQKKGAPRDSDYESTVFREERLSKADRDKLYALYDQAKPFDDKVYESLNYTVKEAQQHVDFQIKKPTYTIEGYNLKDENVGYFIKRRPELIIELEYTNAKGNYTIYQSQVFGESKDPFSHQFVVPENIEQYELEGNQIFYATDHSDSNLQGMKMIVPAKGKNSAYQVVIINHSLERQGEAVFDKNVNKEELEKIMISMLK
>NZ_CP009902.1|WP_000184500.1|790226_790625_-|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWLKSPQTANEIIEELEDPMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRLLDEKTEENKRKD
>NZ_CP009902.1|WP_000984152.1|790854_791694_+|membrane-protein
MMRALRLNIKQAFCNRVSLIIMFSGFVLICIYHYYYVIRYLGDAASGPISTDIKWIGFRDNEMDVYLLLMPIIASLPFSTSYNSDKSDGFKQFVSKGINLFSYSITKYIVTFFCGGLLYTLPFILSLLFCKLTIPDGEMPAGSGIINVNGMFASLYEASPIIYITVYIGINFLFAGLMALLGLAASAWSQKDYMSLLFPFAATSIPYVLLNTVFPTIGGAPIHLYDPKQPLDGMSPYILTVQCAFFLFVSLLMYIRGVKRDRKKYRRRLQKRDRCRKTF
>NZ_CP009902.1|WP_003170543.1|791690_792044_-|hypothetical-protein
MQAQLNGKLMNQLAIFFSTIVMLQFIADVTGFTQNLDITYNLIHTAASYITFSLAVIFTLIGARRELSKYAIISLCLVVGIKAKGSLFYGDWLARRKRIVNKPLISKIVRKLEVYYT
>NZ_CP009902.1|WP_000279249.1|792195_794562_-|endonuclease
MAVKKLLSVFLSFILLLSFTGTLVQAEETTSMSVEKAIQVFKQQGKTKGTVEGYIVGYTQSPSKYTKDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRAAVNVKDHPENIGKKVSLTGTLELYFSSPGLKSVTAHKFQGEEQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIIVNENSVMKAIAEKEGLTSSPISTFSFVIVNNEPVRIHDIQGKSHLSPYNGKKVYNVEGVVTALDKNGFYIEDNQPDNDPATSEGMYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFETDLTTTEIKASRVAVIAKDQPLPAPIVLGENGVKIPDQIIDNDAFGLFDPNEDAIDFYESVEGMRVTMPTPKIIAPQKNGNLYVTVKNGGNKVVTKYGTPVLDENQLNPERLSVKVPRDYVAKVGDTFTGDIIGVVGYDYGSFRIAPITELPSVVDGGFKQIGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGTVNDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNLDGGAPGANIRVGFFYNPSRVKLATVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNLVVVANHLNSKIGDATPFGKVQPLVLKSEEKRVQLAQEVNNFVQGIQKKNTNAPVVVLGDMNDFEFAKPLKTLEGTILKNMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNTNIMKEHGRVSDHDPVLAQIDLKKAS
>NZ_CP009902.1|WP_000453710.1|794802_796155_+|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLENIATKVDELKIVYSDETSLIVELHMDNKVIPYELHIDETDDPEEYKLYNRQDSTIVDRSFEDAAYGTEIFTRTLFVGDVLNCFFQQLQFLWNLAPDLLFVIDSSAAMKVISRNYIEYHVENELLPDIPDLYVIHSVYEDDKEGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGIGDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPISAQNTFLGGMDDRDEYHQSPSVLLFKFDTSEEYIESFFKEHEEATGLMFYKTNSETARMAYNAKNTFGYFSNIFQIEQSNEEFRFLAKFGVSYEEGKSEHMWFEMQHITEEFIQGILINEPYFIEDMSEGNSYHLDFDDLTEWVIYAGDAVIKPNNLYMFIGE
>NZ_CP009902.1|WP_001228080.1|796194_797616_-|protoporphyrinogen-oxidase
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMHEGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNIPSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRPGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTVVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
>NZ_CP009902.1|WP_000726793.1|797635_798571_-|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEKRLNEVQDEVEYHMYLGLKHIEPFIEDAVKEMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKSIYSGMSDAEREKAVLIVSAHSLPEKIIAMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKYGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVVKKKESVM
>NZ_CP009902.1|WP_000252599.1|798585_799632_-|uroporphyrinogen-decarboxylase
MVRTINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALIDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMERIFAEVRTMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKAVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009902_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009902_3

3825279-3825380

Orphan

Consensus_repeat	Method
ACATTCTCAAAAGAAACCTAAATT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP009902_3

>merge|NZ_CP009902|3|3825279-3825380|CRISPRCasFinder
ACATTCTCAAAAGAAACCTAAATTGTCAAGGAAGGAAAGGAGACAATCCACGGCTACTTCGGGGCATGTAAATATACCACATTCTCAAAAGAAACCTAAACT

>NZ_CP009902|3|3|3825279-3825380|CRISPRCasFinder
ACATTCTCAAAAGAAACCTAAATT	GTCAAGGAAGGAAAGGAGACAATCCACGGCTACTTCGGGGCATGTAAATATACC
ACATTCTCAAAAGAAACCTAAACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009902.1\|WP_000544597.1\|3827708_3828218_-\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP009902.1\|WP_000275806.1\|3816055_3816655_+\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NZ_CP009902.1\|WP_000129215.1\|3834051_3834843_-\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP009902.1\|WP_000445390.1\|3821750_3823370_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP009902.1\|WP_000164886.1\|3818266_3819733_-\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP009902.1\|WP_000915210.1\|3830978_3832112_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP009902.1\|WP_000571881.1\|3820928_3821273_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009902.1\|WP_000417232.1\|3823985_3824639_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009902.1\|WP_001226321.1\|3825943_3826888_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP009902.1\|WP_000933357.1\|3823701_3823881_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP009902.1\|WP_000798801.1\|3830491_3830722_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009902.1\|WP_000473534.1\|3835058_3836600_+\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_CP009902.1\|WP_000137568.1\|3832147_3833935_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009902.1\|WP_000236549.1\|3826937_3827615_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP009902.1\|WP_000592013.1\|3816728_3816920_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NZ_CP009902.1\|WP_003157243.1\|3829147_3830392_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP009902.1\|WP_000351706.1\|3828210_3829062_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP009902.1\|WP_000646406.1\|3819911_3820910_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP009902.1\|WP_000813610.1\|3815393_3815921_+\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
NZ_CP009902.1\|WP_001102720.1\|3816916_3818011_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376220

Protein	Function_ID	Function_description	E-value
NZ_CP009902.1\|WP_000544597.1\|3827708_3828218_-\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	2.0675e-75
NZ_CP009902.1\|WP_000275806.1\|3816055_3816655_+\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.20741e-71
NZ_CP009902.1\|WP_000129215.1\|3834051_3834843_-\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	3.61808e-48
NZ_CP009902.1\|WP_000445390.1\|3821750_3823370_+\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	9.27661e-109
NZ_CP009902.1\|WP_000164886.1\|3818266_3819733_-\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP009902.1\|WP_000915210.1\|3830978_3832112_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.04975e-59
NZ_CP009902.1\|WP_000571881.1\|3820928_3821273_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.46799e-14
NZ_CP009902.1\|WP_001226321.1\|3825943_3826888_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	3.02275e-148
NZ_CP009902.1\|WP_000933357.1\|3823701_3823881_-\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.00840603
NZ_CP009902.1\|WP_000473534.1\|3835058_3836600_+\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_CP009902.1\|WP_000137568.1\|3832147_3833935_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009902.1\|WP_000236549.1\|3826937_3827615_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	2.04128e-21
NZ_CP009902.1\|WP_000592013.1\|3816728_3816920_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	3.30665e-06
NZ_CP009902.1\|WP_003157243.1\|3829147_3830392_+\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.22824e-96
NZ_CP009902.1\|WP_000351706.1\|3828210_3829062_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50852e-87
NZ_CP009902.1\|WP_000646406.1\|3819911_3820910_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	2.72364e-150
NZ_CP009902.1\|WP_000813610.1\|3815393_3815921_+\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	6.28806e-55
NZ_CP009902.1\|WP_001102720.1\|3816916_3818011_-\|hypothetical-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	2.48498e-18

>NZ_CP009902.1|WP_000417232.1|3823985_3824639_+|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSARSSVVMVWVVINFMILTPFLFPPTFTIYLYVILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFVLYIFTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>NZ_CP009902.1|WP_000933357.1|3823701_3823881_-|hypothetical-protein
MLNLIPSVTILDPIETPKPIQAPATVPIGPPKTVPTAAATPSLAPAKALTAVVPTPIAA
>NZ_CP009902.1|WP_000445390.1|3821750_3823370_+|FAD-dependent-monooxygenase
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKTLENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARILGGELSFYHELVSYEQNEQGVIATIRNRETEKESVIHCDYVIAADGAKSKIREQLGISAEGRGTIGGYYMNIYFEADVSEFMQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVEPEIVSVLPWKAAESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKAKPKLLETYHEERYPVAKLTTDYAISLLFRAANREEGSLNKMDGLAVTAGYHYSSDAIIDDAVTLHRMDIVQLNGRPGTRAPHFIGMYEEKEVSVLDLLGNDFVLLTGAENDSWAESAHTVSAKLGVNIKVYRVGLSGDFIAQENIFSELYGLSDGGAVLIRPDAFIGWRSEKEVVNLDVVLEEVMSNLLCDF
>NZ_CP009902.1|WP_000571881.1|3820928_3821273_-|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>NZ_CP009902.1|WP_000646406.1|3819911_3820910_-|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVQMLLKYEMPLILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFSKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>NZ_CP009902.1|WP_000164886.1|3818266_3819733_-|YdiU-family-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEVLKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYATEQEEYCVPPVPTNRPYRTFCGT
>NZ_CP009902.1|WP_001102720.1|3816916_3818011_-|hypothetical-protein
MNVQLQGNEQITKLFNDWYLAMLKQDVSQATNLKHEIEEKELNFEEDENLALYYSLLDFRYKVLVDSLSISKDCFDKIDSYLISSNHPLAYYYHFFKGIYATLTTDFNLASEHYEQAKLLLVNNTDNLEHAEFYYRMAIFHYHFYQPIESIEYATKAKAIFDKHTGYEVKVGLCKNTLGASFVYLKQYEQAEEQYNSAIHLLQKSNEKELILSVRNNLGWLYASQNLSTLAIRHLSEVTEKKPTHFKALFLQAREHSKLDETSIAEGLIQKGVKICTELNNEEYIYHFKILNELNNNVASEELETIILKGITFFDKELLYNYTQEYSEKLAVKFYSENNHIKASEYFHKALQAKEKTFEKGALK
>NZ_CP009902.1|WP_000592013.1|3816728_3816920_-|Phr-family-secreted-Rap-phosphatase-inhibitor
MIKKISSVFLGLSVFGILATGIHSSFTYQAGHADLPAPQRPDLVQSVDASKDYNSTTTAEKAL
>NZ_CP009902.1|WP_000275806.1|3816055_3816655_+|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDPNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVARRKLVVEELEKVGSEGSRGIAELMRK
>NZ_CP009902.1|WP_000813610.1|3815393_3815921_+|GrpB-family-protein
MKQRITIEEYNIKWESEFNKLQTLINDVMEDSILSIEHVGSTSIKGLAAKPVLDIDIVIEDYGFFPKVVTKLGAIGYYHQAEWSYKGREAFGRKDAFVPWDGESTDWMEHHLYVCDKESEELRRHIAFRDYLREYEDVAVEYGHLKEELARETKSRTSYSEGKTAFITNILEKIN
>NZ_CP009902.1|WP_001226321.1|3825943_3826888_+|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLKKIHSINKNIPLVQLLWYYPNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGDLIINESYMKMARQNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHTVLKEK
>NZ_CP009902.1|WP_000236549.1|3826937_3827615_-|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDVIFVFGGSHPGNWQAPLEAYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMENGVPKGAILFEKNSLHSIANVIEAKKIFDFTKINRLLFVCKNLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPEKEVHGLEEYVSYYYNLA
>NZ_CP009902.1|WP_000544597.1|3827708_3828218_-|DUF3916-domain-containing-protein
MHEKKIRGMKRKTNAMIKRIEEHTKMFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIQPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISIFPTPQLLRFQEVIYDEDTIDEKEIWFIGELS
>NZ_CP009902.1|WP_000351706.1|3828210_3829062_-|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHDVSFNPLPNSFNKVPTTFITRNDIFRSAALQKFMEVTHNA
>NZ_CP009902.1|WP_003157243.1|3829147_3830392_+|MFS-transporter
MEEDGGIIVLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFIGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVQEEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRVALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMSIHTITSGVLYSVSALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYAYAWLCIVVLLSISAVSLYRRNKKIKES
>NZ_CP009902.1|WP_000798801.1|3830491_3830722_-|hypothetical-protein
MKNTDKRNRLDDMMFHYRVTKNNIVLIEYYGKQIMILKGTAAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNERQ
>NZ_CP009902.1|WP_000915210.1|3830978_3832112_+|serine-hydrolase
MLKKWLIVFFIFAVFSGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANMKDKVFTTPRTKYRIGSITKTVVAIAIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKKTFVILFSNVQNGMNDTFNQEFRKMANDLIEGNGA
>NZ_CP009902.1|WP_000137568.1|3832147_3833935_-|oligoendopeptidase-F
MTELKDRLQVADKEKWNLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSVDENTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTSNDGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIETTKKNIQSLHTYNKLRKEKLNVDELRQYDLSVDLVQGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NZ_CP009902.1|WP_000129215.1|3834051_3834843_-|arylamine-N-acetyltransferase
MTDFQKQFFARLNIEEKQKVSFEDLSNIMYAMAQTVPFENLNVLEKNFKEISQENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATILKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKANAAQKIIVEHDGSPFNKVPLIVKLTEDGHASLTKDSLTIAKNGKKTKEKVTDVQYKKLLHSKFGITL
>NZ_CP009902.1|WP_000473534.1|3835058_3836600_+|alpha-amylase
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDGNHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009902_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009902_4

4372186-4372383

Orphan

Consensus_repeat	Method
AGGAATGAATATTCATTCCGAAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009902_4

>merge|NZ_CP009902|4|4372186-4372383|CRISPRCasFinder
AGGAATGAACATTCATTCCGATGAGGGTGTGAAAAAGAAAAGTAGGAGATGATCAATCTGTACAATTAAAGGAATGAATATTCATTCCGAAATCCATAGTTTAATAGAGCTAAAAAGTAAATTAATAGAACGAGAGGAATGAATGTTCATTCCGAAAAGGTGTTTTCAAAATAATAGGAATGAATATTCATTCCGTAA

>NZ_CP009902|4|4|4372186-4372383|CRISPRCasFinder
AGGAATGAACATTCATTCCGATG	AGGGTGTGAAAAAGAAAAGTAGGAGATGATCAATCTGTACAATTAA
AGGAATGAATATTCATTCCGAAA	TCCATAGTTTAATAGAGCTAAAAAGTAAATTAATAGAACGAG
AGGAATGAATGTTCATTCCGAAA	AGGTGTTTTCAAAATAAT
AGGAATGAATATTCATTCCGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009902.1\|WP_001228120.1\|4367579_4368680_+\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP009902.1\|WP_000808762.1\|4379237_4381211_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP009902.1\|WP_001107293.1\|4371598_4372165_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP009902.1\|WP_001273582.1\|4363934_4365011_+\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614
NZ_CP009902.1\|WP_000923442.1\|4384545_4385229_+\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|132880
NZ_CP009902.1\|WP_080001874.1\|4359590_4363103_+\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|238697
NZ_CP009902.1\|WP_000898754.1\|4357773_4358307_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|379237
NZ_CP009902.1\|WP_000346934.1\|4381270_4381942_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP009902.1\|WP_001093210.1\|4375869_4376718_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
NZ_CP009902.1\|WP_000637714.1\|4382052_4382715_-\|DUF3841-domain-containing-protein	unknown	unknown	gnl\|CDD\|378997
NZ_CP009902.1\|WP_000040245.1\|4372418_4375535_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP009902.1\|WP_000646309.1\|4385245_4385947_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393
NZ_CP009902.1\|WP_001106984.1\|4383919_4384180_+\|lipoprotein	unknown	unknown	gnl\|CDD\|236766
NZ_CP009902.1\|WP_000997708.1\|4359002_4359440_-\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP009902.1\|WP_000551418.1\|4382874_4383702_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP009902.1\|WP_000709765.1\|4358323_4358854_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP009902.1\|WP_001197243.1\|4366486_4367587_+\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP009902.1\|WP_000633862.1\|4377095_4378721_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP009902.1\|WP_000664622.1\|4368696_4369986_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP009902.1\|WP_001269395.1\|4365295_4366468_+\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518

Protein	Function_ID	Function_description	E-value
NZ_CP009902.1\|WP_001228120.1\|4367579_4368680_+\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	5.37504e-160
NZ_CP009902.1\|WP_000808762.1\|4379237_4381211_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP009902.1\|WP_001107293.1\|4371598_4372165_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.12259e-71
NZ_CP009902.1\|WP_001273582.1\|4363934_4365011_+\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP009902.1\|WP_000923442.1\|4384545_4385229_+\|DNA-alkylation-repair-protein	gnl\|CDD\|132880	cd06561, AlkD_like, A new structural DNA glycosylase. This domain represents a new and uncharacterized structural superfamily of DNA glycosylases that form an alpha-alpha superhelix fold that are not belong to the identified five structural DNA glycosylase superfamilies (UDG, AAG/MNPG, MutM/Fpg and helix-hairpin-helix). DNA glycosylases removing alkylated base residues have been identified in all organisms investigated and may be universally present in nature. DNA glycosylases catalyze the first step in Base Excision Repair (BER) pathway by cleaving damaged DNA bases within double strand DNA to produce an abasic site. The resulting abasic site is further processed by AP endonuclease, phosphodiesterase, DNA polymerases, and DNA ligase functions to restore the DNA to an undamaged state. All glycosylase examined to date utilize a similar strategy for binding DNA and base flipping despite their structural diversity.	3.93397e-27
NZ_CP009902.1\|WP_080001874.1\|4359590_4363103_+\|DUF4020-domain-containing-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	7.45598e-56
NZ_CP009902.1\|WP_000898754.1\|4357773_4358307_+\|acetyltransferase	gnl\|CDD\|379237	pfam13523, Acetyltransf_8, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	8.7669e-30
NZ_CP009902.1\|WP_000346934.1\|4381270_4381942_-\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.67512e-74
NZ_CP009902.1\|WP_001093210.1\|4375869_4376718_+\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	2.01186e-152
NZ_CP009902.1\|WP_000637714.1\|4382052_4382715_-\|DUF3841-domain-containing-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	6.87406e-32
NZ_CP009902.1\|WP_000040245.1\|4372418_4375535_+\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	7.12445e-76
NZ_CP009902.1\|WP_000646309.1\|4385245_4385947_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	2.05551e-10
NZ_CP009902.1\|WP_001106984.1\|4383919_4384180_+\|lipoprotein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.000712004
NZ_CP009902.1\|WP_000997708.1\|4359002_4359440_-\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	3.67802e-44
NZ_CP009902.1\|WP_000551418.1\|4382874_4383702_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.21079e-85
NZ_CP009902.1\|WP_000709765.1\|4358323_4358854_+\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.19855e-68
NZ_CP009902.1\|WP_001197243.1\|4366486_4367587_+\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP009902.1\|WP_000633862.1\|4377095_4378721_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP009902.1\|WP_000664622.1\|4368696_4369986_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP009902.1\|WP_001269395.1\|4365295_4366468_+\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0

>NZ_CP009902.1|WP_001107293.1|4371598_4372165_+|TetR-family-transcriptional-regulator
MAKNKQEDIFDAAIQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFTKSVLQLSELIKTDFPVNANIREQFSHTYNRLFEFARQNADAFLFTNSHCDSYFLDEHSNEIFEDFMGFFMDLIEDGIEKGFLRPLPPIALIIIVYQPIEKLIKVMETGQLEYTEELVKELEESCWNAIRII
>NZ_CP009902.1|WP_000664622.1|4368696_4369986_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGTTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFLSCVQGDTSIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLENVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>NZ_CP009902.1|WP_001228120.1|4367579_4368680_+|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHVTSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEKYQTYETI
>NZ_CP009902.1|WP_001197243.1|4366486_4367587_+|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>NZ_CP009902.1|WP_001269395.1|4365295_4366468_+|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIEMDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQIITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>NZ_CP009902.1|WP_001273582.1|4363934_4365011_+|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMEELKGFKNKLS
>NZ_CP009902.1|WP_080001874.1|4359590_4363103_+|DUF4020-domain-containing-protein
MTFLGKGESSVWITSEVEIPDELIDHLEKGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKTKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAMKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKLSPLLWRTICSYLNETKMKMDPLLFARWTLLLLETAEKDSKSIETISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSTFSFVEQIWNEKMKPHISYYAVPIMMMGIEKIRMLSLRQAALKKRDKENVEKEFQQNDLAFLIQIVKECLAYLCKNNEKKANYYITEMIEANSVLQNRIAIDAMNKNVFVSADEKMKWLLQEGILLDVTYKHEVFQLIKNHFALSLEKTKEEVIQIVLKDLAEERAFDVCFVLDLLFTCDSNSPSTAKGYELMKQKHPHFHSERYSVQKKEAAEQSITCNVTADGLLQLKDEEIMKQVQQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLAKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMIARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAKEQQKFWAAWLSIFLRERPKMGGITAREYVMLLRIILFMDEIVERGLLIICKSFSDVGGKGNQTELKQLFHEILEKTESIKMYKELYANVFFTLLQTLQEANLLKTEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVLENLQEEM
>NZ_CP009902.1|WP_000997708.1|4359002_4359440_-|YndM-family-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSSSRTRHHNDNIHINRRFAYGTEFAEEQNILDKDKKK
>NZ_CP009902.1|WP_000709765.1|4358323_4358854_+|cysteine-hydrolase
MKKALLVIDVQAGMYTAGMPVHNGEKFLETLQELIGECRSNDIPVIYVQHNGPKDHPLEKGTDGWKIHAAIAPLEGECVVEKTTPDSFHKTNLKEVLQDKGIDHVIISGMQTQYCVDTTTRRACSEGYKITLVSDAHSTFDTEVLRAEDIVKHHNVVFGAFADVVTLKDLKVTASK
>NZ_CP009902.1|WP_000898754.1|4357773_4358307_+|acetyltransferase
MLFQKDNVSVRYVVEEDAPIISKWLTDPEVLQYYEGRDDPQSVEMVLNHFIHNPNSPEKRCLIEFDDVPIGYIQMYPVDSESKTLYGYEESQNVWGMDQFIGEPTYWGKGIGTKFVKAAITYILSEMGAEAIAMDPKVNNERAIKCYEKCGFKKVKILKEHELHEGVLEDCWMMEYK
>NZ_CP009902.1|WP_000040245.1|4372418_4375535_+|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQLVSKDNTTILTQISIDKKHGEISKVSNNLHNKVKTKGVKTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFVALIIVFVISIPIVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTEKILKVKGVSEVYAPTRPTGERIKELYINKQADELNTGLGDANGGIKEINDGLTTAKDKMGSKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIESGLTSVNENISVLSNATSQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQTKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQVLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPIIQEINKTIDGTLKGTELNNAKKAIGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLILAYFASLGISEQISTHLLNVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGEPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLTLIQVASVVGVALLLLAIIVMPILLPALIGLTSKMKDYAKKLSKRK
>NZ_CP009902.1|WP_001093210.1|4375869_4376718_+|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAQLINDILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLLSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELPFDKNVELIADKWQDFAEIALEDDKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLFYVEQDDLEFSFRKALKERNPEWSTGIVDYYTNQGYGKEHNHSGVEGAIKVLEARRNLELEIFDMLKMKKEKINNTKYEIGSYRSMLKDKLTIQMVK
>NZ_CP009902.1|WP_000633862.1|4377095_4378721_+|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_CP009902.1|WP_000808762.1|4379237_4381211_+|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
>NZ_CP009902.1|WP_000346934.1|4381270_4381942_-|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFIKWAFIIIIIAGVVFFGKAKQKATDGSI
>NZ_CP009902.1|WP_000637714.1|4382052_4382715_-|DUF3841-domain-containing-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDSDDIYSYDWMVRVAKTKLPHYEGNYPIWVWEANNYPNRNHKAWGRKNSKMVILTLDVPKKWVLWSYFDYWCCAMTDGSTYLHTKNKCTLDEWYIYMDKKYGIIFNFDYLLSHPDWYLDKEDSLEKQGVIGKIPLSFVKKVRRFRAKEDTSIHTIRSDNWDNRKENRIKKMNRKLRKRNEKQKRVQKRLIRN
>NZ_CP009902.1|WP_000551418.1|4382874_4383702_-|polysaccharide-deacetylase
MHNGIRMTTLMKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWRYNKMPVDAASAKIVENVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM
>NZ_CP009902.1|WP_001106984.1|4383919_4384180_+|lipoprotein
MNYKKMLSIFMTSIFTVGLLIGCNPAPKDEKEPDPTEEPSEQRQEEKNEKQDPAKEQNNELNKKDEQEPDPTEEPSEEQKKKKENE
>NZ_CP009902.1|WP_000923442.1|4384545_4385229_+|DNA-alkylation-repair-protein
MLLEEVMQQLEEYGTEQNRKTYKNHGAKEPLFGVSFANLKLLKKKIKKDHDLAISLWETKNMDAMTLATMILDPKKVTTELLNKWVQEVDYYCLMDVLMTAICTSPIAIERMEEWTKSDDEWIGRAGWSLLANIAIKNKTLQDDSFSPYLEEIKENIHNEKNRKREAMNSALIAIGIRNEDLEQTAIEIAREIGKVQVDHGATSCKTPDAESYIKKARERAEKKKMK
>NZ_CP009902.1|WP_000646309.1|4385245_4385947_+|nucleotidyltransferase-domain-containing-protein
MKAMEAAQSIITSHFPDCDVALLGGSVARGEATKTSDLDIVIVDQSLTSCYRESFYSNGWPVEVFVHNFETYKTFFKMDCDRGRPSLPQLVSEGIVLKGENEIVEKLKREASDLLNKGPAKWTEEMMKQKRYFITDTLDDFIGASKREEELFIANLLADLLHEYVLRVNGKWLGNSKWFIRVLRKYDEQYADQFVAAFDHFYTTGEKSKLITFVEKTLEQYGGRMFEGFSIGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

236364 : 255580

Bacillus_phage(95.24%)

tail,holin,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015978826.1\|236364_237819_-	recombinase family protein	Q3HKZ2	Bacillus_phage	7.8e-278	100.0
WP_001983036.1\|237885_238749_-	helix-turn-helix domain-containing protein	Q2I8D8	Bacillus_phage	4.9e-155	100.0
WP_001983109.1\|238761_238881_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	7.5e-14	100.0
WP_001983129.1\|239044_239281_+	helix-turn-helix domain-containing protein	Q2I8D9	Bacillus_phage	9.0e-35	100.0
WP_015978829.1\|239314_239932_-	hypothetical protein	Q2LIA9	Bacillus_phage	1.7e-112	100.0
WP_038357138.1\|239873_241055_-	cell division protein FtsK	Q3HKZ7	Bacillus_phage	2.1e-228	100.0
WP_001982935.1\|241172_241355_-	hypothetical protein	Q2I8E2	Bacillus_phage	4.2e-24	100.0
WP_001982930.1\|241351_241660_-	hypothetical protein	Q2I8E3	Bacillus_phage	6.6e-54	100.0
WP_001237238.1\|241843_242056_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	2.7e-30	100.0
WP_001983050.1\|242048_242540_+	hypothetical protein	Q3HL01	Bacillus_phage	5.2e-77	100.0
WP_001982889.1\|242597_243299_-	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	3.5e-135	100.0
WP_001982921.1\|243298_243724_-\|holin	phage holin family protein	Q2I8E7	Bacillus_phage	5.7e-72	100.0
WP_001983145.1\|243762_247629_-	peptidase S74	Q2I8E8	Bacillus_phage	0.0e+00	99.9
WP_001983069.1\|247625_249116_-\|tail	phage tail protein	Q2LIH1	Bacillus_virus	6.1e-294	99.8
WP_015978818.1\|249130_252982_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	100.0
WP_001982918.1\|253204_253522_-	hypothetical protein	Q2I8F1	Bacillus_phage	5.8e-53	100.0
WP_001982989.1\|253571_254180_-\|tail	tail protein	Q2I8F2	Bacillus_phage	1.4e-108	100.0
WP_001983061.1\|254180_254540_-	DUF3168 domain-containing protein	Q2I8F3	Bacillus_phage	5.9e-62	100.0
WP_001983159.1\|254536_254977_-	phage protein, HK97 gp10 family	Q2I8F4	Bacillus_phage	4.2e-78	100.0
WP_001983098.1\|254969_255293_-\|head	phage head closure protein	Q2I8F5	Bacillus_phage	6.7e-57	100.0
WP_001983083.1\|255289_255580_-\|head,tail	phage gp6-like head-tail connector protein	Q2I8F6	Bacillus_phage	6.7e-48	100.0

DBSCAN-SWA_2

258704 : 317713

Bacillus_phage(100.0%)

portal,tail,head,protease,terminase,capsid,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015978824.1\|258704_260402_-\|terminase	terminase large subunit	Q2LID0	Bacillus_phage	0.0e+00	100.0
WP_001982984.1\|260398_260884_-\|terminase	phage terminase small subunit P27 family	Q2I8G1	Bacillus_phage	1.2e-81	100.0
WP_015978819.1\|260983_261367_-	HNH endonuclease	Q2I8B2	Bacillus_phage	1.1e-69	100.0
WP_001983006.1\|261366_261633_-	hypothetical protein	Q3HKW7	Bacillus_phage	8.3e-29	100.0
WP_001983112.1\|261634_261826_-	hypothetical protein	Q2I8B4	Bacillus_phage	4.3e-27	100.0
WP_001983081.1\|262024_262279_-	hypothetical protein	Q2LI82	Bacillus_phage	1.1e-43	100.0
WP_001982927.1\|262298_262490_-	hypothetical protein	Q3HKW9	Bacillus_phage	3.3e-27	100.0
WP_001982978.1\|262594_262999_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.2e-76	100.0
WP_001983087.1\|263003_263225_-	hypothetical protein	Q2LI85	Bacillus_phage	3.5e-33	100.0
WP_001983111.1\|263231_263456_-	hypothetical protein	Q3HKX2	Bacillus_phage	8.0e-33	100.0
WP_001982886.1\|263575_263971_-	sigma-70 family RNA polymerase sigma factor	A0A288WFT8	Bacillus_phage	2.0e-66	100.0
WP_001982982.1\|264144_264267_-	DUF3983 domain-containing protein	Q3HKX4	Bacillus_phage	6.9e-15	100.0
WP_015978820.1\|264419_264659_-	hypothetical protein	Q3HKX5	Bacillus_phage	4.1e-35	100.0
WP_000060543.1\|264651_264951_-	hypothetical protein	Q3HKX6	Bacillus_phage	4.3e-50	100.0
WP_001983092.1\|265860_266436_+	cupin domain-containing protein	Q2Q459	Bacillus_phage	4.1e-97	100.0
WP_001983158.1\|266874_268290_-	collagen-like protein	Q2Q460	Bacillus_phage	4.2e-79	100.0
WP_001983133.1\|268525_269068_-	hypothetical protein	Q3HKY2	Bacillus_phage	5.7e-101	100.0
WP_001983023.1\|269127_269604_-	hypothetical protein	Q3HKY3	Bacillus_phage	1.8e-95	100.0
WP_001982986.1\|269600_270347_-	sigma-70 family RNA polymerase sigma factor	Q2I8C6	Bacillus_phage	6.4e-135	100.0
WP_001982974.1\|270339_270573_-	hypothetical protein	Q3HKY5	Bacillus_phage	8.9e-35	100.0
WP_001983053.1\|270591_271503_-	ATP-binding protein	Q2I8C8	Bacillus_phage	3.4e-170	100.0
WP_001983130.1\|271518_272466_-	hypothetical protein	Q2LI99	Bacillus_phage	2.0e-149	100.0
WP_001983019.1\|272594_273248_-	hypothetical protein	Q2I8D0	Bacillus_phage	1.7e-120	100.0
WP_001983086.1\|273314_274130_-	hypothetical protein	Q3HL19	Bacillus_phage	1.3e-149	100.0
WP_001983125.1\|274572_274800_-	helix-turn-helix transcriptional regulator	Q2I8D4	Bacillus_phage	3.9e-35	100.0
WP_015980883.1\|274959_275316_+	helix-turn-helix transcriptional regulator	Q2I8D5	Bacillus_phage	3.9e-58	100.0
WP_015980882.1\|275656_276991_-	conserved phage protein	Q2I8D6	Bacillus_phage	3.1e-249	100.0
WP_015978826.1\|277093_278548_-	recombinase family protein	Q3HKZ2	Bacillus_phage	7.8e-278	100.0
WP_001983036.1\|278614_279478_-	helix-turn-helix domain-containing protein	Q2I8D8	Bacillus_phage	4.9e-155	100.0
WP_001983109.1\|279490_279610_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	7.5e-14	100.0
WP_001983129.1\|279773_280010_+	helix-turn-helix domain-containing protein	Q2I8D9	Bacillus_phage	9.0e-35	100.0
WP_015978829.1\|280043_280661_-	hypothetical protein	Q2LIA9	Bacillus_phage	1.7e-112	100.0
WP_001982935.1\|281898_282081_-	hypothetical protein	Q2I8E2	Bacillus_phage	4.2e-24	100.0
WP_001982930.1\|282077_282386_-	hypothetical protein	Q2I8E3	Bacillus_phage	6.6e-54	100.0
WP_001982889.1\|283321_284023_-	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	3.5e-135	100.0
WP_001982921.1\|284022_284448_-\|holin	phage holin family protein	Q2I8E7	Bacillus_phage	5.7e-72	100.0
WP_050541546.1\|288347_289787_-\|tail	phage tail protein	Q2I8E9	Bacillus_phage	1.6e-283	100.0
WP_001982918.1\|293921_294239_-	hypothetical protein	Q2I8F1	Bacillus_phage	5.8e-53	100.0
WP_001982989.1\|294288_294897_-\|tail	tail protein	Q2I8F2	Bacillus_phage	1.4e-108	100.0
WP_001983061.1\|294897_295257_-	DUF3168 domain-containing protein	Q2I8F3	Bacillus_phage	5.9e-62	100.0
WP_001983159.1\|295253_295694_-	phage protein, HK97 gp10 family	Q2I8F4	Bacillus_phage	4.2e-78	100.0
WP_001983098.1\|295686_296010_-\|head	phage head closure protein	Q2I8F5	Bacillus_phage	6.7e-57	100.0
WP_001983083.1\|296006_296297_-\|head,tail	phage gp6-like head-tail connector protein	Q2I8F6	Bacillus_phage	6.7e-48	100.0
WP_001983024.1\|296314_297493_-\|capsid	phage major capsid protein	Q2I8F7	Bacillus_phage	1.4e-213	100.0
WP_001982892.1\|297531_298152_-\|head,protease	HK97 family phage prohead protease	Q2I8F8	Bacillus_phage	4.8e-112	100.0
WP_001983089.1\|298114_299413_-\|portal	phage portal protein	Q2LIC9	Bacillus_phage	4.1e-246	100.0
WP_015978824.1\|299428_301126_-\|terminase	terminase large subunit	Q2LID0	Bacillus_phage	0.0e+00	100.0
WP_001982984.1\|301122_301608_-\|terminase	phage terminase small subunit P27 family	Q2I8G1	Bacillus_phage	1.2e-81	100.0
WP_015978819.1\|301708_302092_-	HNH endonuclease	Q2I8B2	Bacillus_phage	1.1e-69	100.0
WP_001983006.1\|302091_302358_-	hypothetical protein	Q3HKW7	Bacillus_phage	8.3e-29	100.0
WP_001983112.1\|302359_302551_-	hypothetical protein	Q2I8B4	Bacillus_phage	4.3e-27	100.0
WP_001983081.1\|302749_303004_-	hypothetical protein	Q2LI82	Bacillus_phage	1.1e-43	100.0
WP_001982927.1\|303023_303215_-	hypothetical protein	Q3HKW9	Bacillus_phage	3.3e-27	100.0
WP_001982978.1\|303319_303724_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.2e-76	100.0
WP_001983087.1\|303728_303950_-	hypothetical protein	Q2LI85	Bacillus_phage	3.5e-33	100.0
WP_001983111.1\|303956_304181_-	hypothetical protein	Q3HKX2	Bacillus_phage	8.0e-33	100.0
WP_001982886.1\|304300_304696_-	sigma-70 family RNA polymerase sigma factor	A0A288WFT8	Bacillus_phage	2.0e-66	100.0
WP_001982982.1\|304869_304992_-	DUF3983 domain-containing protein	Q3HKX4	Bacillus_phage	6.9e-15	100.0
WP_015978820.1\|305144_305384_-	hypothetical protein	Q3HKX5	Bacillus_phage	4.1e-35	100.0
WP_000060543.1\|305376_305676_-	hypothetical protein	Q3HKX6	Bacillus_phage	4.3e-50	100.0
WP_001983092.1\|306585_307161_+	cupin domain-containing protein	Q2Q459	Bacillus_phage	4.1e-97	100.0
WP_001983158.1\|307599_309015_-	collagen-like protein	Q2Q460	Bacillus_phage	4.2e-79	100.0
WP_001983133.1\|309250_309793_-	hypothetical protein	Q3HKY2	Bacillus_phage	5.7e-101	100.0
WP_001982986.1\|310322_311069_-	sigma-70 family RNA polymerase sigma factor	Q2I8C6	Bacillus_phage	6.4e-135	100.0
WP_001982974.1\|311061_311295_-	hypothetical protein	Q3HKY5	Bacillus_phage	8.9e-35	100.0
WP_001983053.1\|311313_312225_-	ATP-binding protein	Q2I8C8	Bacillus_phage	3.4e-170	100.0
WP_001983130.1\|312240_313188_-	hypothetical protein	Q2LI99	Bacillus_phage	2.0e-149	100.0
WP_001983019.1\|313316_313970_-	hypothetical protein	Q2I8D0	Bacillus_phage	1.7e-120	100.0
WP_001983086.1\|314036_314852_-	hypothetical protein	Q3HL19	Bacillus_phage	1.3e-149	100.0
WP_001983125.1\|315294_315522_-	helix-turn-helix transcriptional regulator	Q2I8D4	Bacillus_phage	3.9e-35	100.0
WP_015980883.1\|315681_316038_+	helix-turn-helix transcriptional regulator	Q2I8D5	Bacillus_phage	3.9e-58	100.0
WP_015980882.1\|316378_317713_-	conserved phage protein	Q2I8D6	Bacillus_phage	3.1e-249	100.0

DBSCAN-SWA_3

1365352 : 1405283

Bacillus_phage(64.44%)

portal,integrase,tRNA,tail,protease,head,terminase,capsid

attL 1383652:1383667|attR 1408863:1408878

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067313.1\|1365352_1366090_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_000050926.1\|1366469_1366805_+	hypothetical protein	A0A1C8E989	Bacillus_phage	3.6e-21	52.7
WP_000509854.1\|1366858_1367656_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.4e-109	68.7
WP_001031201.1\|1367655_1367862_-	hypothetical protein	D2XR32	Bacillus_phage	9.6e-33	98.5
WP_000818882.1\|1367870_1368110_-	peptidase	A0A1B1P7E0	Bacillus_phage	8.0e-31	86.1
WP_001193271.1\|1368204_1368684_-	hypothetical protein	A0A2H4J980	uncultured_Caudovirales_phage	1.1e-52	84.4
WP_000680532.1\|1368720_1370694_-	hypothetical protein	A0A2H4JG80	uncultured_Caudovirales_phage	2.4e-165	60.6
WP_000752641.1\|1370989_1374568_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_000059860.1\|1374582_1375392_-\|tail	phage tail family protein	A0A290FZP5	Caldibacillus_phage	3.6e-59	44.5
WP_000233050.1\|1375388_1379324_-	tape measure protein	D2XR25	Bacillus_phage	1.5e-153	73.0
WP_000415904.1\|1379565_1379928_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	2.5e-28	51.7
WP_000428979.1\|1379932_1380502_-\|tail	phage tail protein	A0A0U4JWV5	Exiguobacterium_phage	7.2e-54	58.0
WP_000175566.1\|1380502_1380832_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.1e-41	76.1
WP_000146467.1\|1380828_1381185_-	hypothetical protein	D2XR21	Bacillus_phage	6.5e-29	57.8
WP_000997870.1\|1381177_1381477_-\|head	phage head closure protein	NA	NA	NA	NA
WP_000600951.1\|1381473_1381746_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	1.4e-18	52.8
WP_001015363.1\|1381742_1382000_-	hypothetical protein	A6XMJ7	Bacillus_virus	1.1e-06	42.0
WP_001031422.1\|1382015_1383206_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	1.0e-09	24.7
WP_000361707.1\|1383224_1383806_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	7.9e-32	44.1
1383652:1383667	attL	NA	NA	NA	NA
WP_000522432.1\|1383762_1384986_-\|portal	phage portal protein	A0A0A8WJ25	Clostridium_phage	2.7e-138	60.8
WP_001265992.1\|1384999_1386688_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.1e-243	71.2
WP_000157079.1\|1386684_1387056_-	hypothetical protein	R9TQ46	Paenibacillus_phage	5.1e-24	54.1
WP_003158839.1\|1387300_1387468_-	helix-turn-helix domain-containing protein	A0A142F1N8	Bacillus_phage	1.6e-09	62.2
WP_001051275.1\|1387464_1387767_-	hypothetical protein	R9TNN2	Paenibacillus_phage	1.6e-31	63.9
WP_001012164.1\|1388355_1388898_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	5.0e-89	91.7
WP_000166181.1\|1388897_1389380_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.1e-71	83.1
WP_000803283.1\|1389693_1389816_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000358037.1\|1389820_1390009_-	hypothetical protein	G9J1S8	Bacillus_phage	1.5e-08	50.8
WP_000048714.1\|1390036_1390393_-	hypothetical protein	NA	NA	NA	NA
WP_000219385.1\|1390498_1390873_-	hypothetical protein	NA	NA	NA	NA
WP_000537039.1\|1390904_1391087_-	hypothetical protein	A0A218KC21	Bacillus_phage	2.2e-17	74.1
WP_000391264.1\|1391127_1391574_-	hypothetical protein	A0A0A7AQW7	Bacillus_phage	1.7e-58	72.3
WP_000860615.1\|1391573_1391978_-	hypothetical protein	D0R7I0	Paenibacillus_phage	1.3e-12	52.8
WP_000455714.1\|1392590_1393190_-	hypothetical protein	A0A0S2SXN5	Bacillus_phage	9.3e-44	45.6
WP_001022835.1\|1393390_1393675_-	hypothetical protein	G9B1P0	Bacillus_phage	4.9e-11	58.5
WP_001057640.1\|1393723_1393903_-	hypothetical protein	A0A1B1P8C9	Bacillus_phage	7.5e-26	93.2
WP_001024288.1\|1393940_1394405_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	7.2e-20	47.7
WP_000483329.1\|1394420_1394837_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	1.4e-14	43.0
WP_000811865.1\|1394848_1395103_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	2.0e-40	96.4
WP_000805172.1\|1395117_1395291_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	3.6e-25	96.5
WP_000337980.1\|1395315_1395510_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.3e-26	87.5
WP_001067133.1\|1396296_1397169_-	DnaD domain protein	A0A0S2GLI6	Bacillus_phage	1.8e-56	61.9
WP_000364231.1\|1397165_1397351_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	2.7e-18	70.7
WP_000969633.1\|1397380_1397548_-	hypothetical protein	A0A0U3B230	Bacillus_phage	2.0e-20	92.5
WP_000798614.1\|1397544_1397895_-	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	3.9e-50	79.3
WP_001072732.1\|1397939_1398671_-	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	1.5e-125	91.8
WP_001059685.1\|1398688_1398910_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000142636.1\|1399084_1399426_+	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	1.2e-16	41.2
WP_000721631.1\|1399755_1399902_-	hypothetical protein	NA	NA	NA	NA
WP_000266074.1\|1399942_1401094_-	hypothetical protein	A0A1B0T6A5	Bacillus_phage	2.5e-53	33.3
WP_001215552.1\|1401628_1401973_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	7.2e-33	61.3
WP_000679460.1\|1402718_1403843_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	1.2e-188	85.8
WP_000615205.1\|1403903_1405283_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.0e-85	38.3
1408863:1408878	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1545858 : 1554235

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088592.1\|1545858_1546446_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1
WP_001262436.1\|1546442_1547483_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000879029.1\|1547589_1549005_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_000055577.1\|1548989_1551209_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000666779.1\|1551192_1551876_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278820.1\|1551872_1552127_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170540.1\|1552119_1552839_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
WP_000625683.1\|1552927_1554235_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3

DBSCAN-SWA_5

1586014 : 1593957

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000719201.1\|1586014_1587520_-	aminopeptidase AmpS	W8CYF6	Bacillus_phage	1.6e-31	29.1
WP_000929883.1\|1587503_1588205_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_000833093.1\|1588349_1589675_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_000743900.1\|1590059_1591598_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.6e-21	31.2
WP_001029998.1\|1592005_1593634_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000917306.1\|1593672_1593957_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8

DBSCAN-SWA_6

2195058 : 2235708

Streptococcus_phage(21.43%)

portal,integrase,transposase,terminase,capsid,holin

attL 2194696:2194711|attR 2236009:2236024

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2194696:2194711	attL	NA	NA	NA	NA
WP_001250476.1\|2195058_2196216_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q331V1	Clostridium_botulinum_C_phage	2.0e-127	59.7
WP_000441062.1\|2196376_2198353_+	excinuclease ABC subunit B	NA	NA	NA	NA
WP_000045565.1\|2198358_2201235_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.2
WP_000394718.1\|2201294_2201744_+	DUF4275 family protein	NA	NA	NA	NA
WP_001267308.1\|2201858_2202239_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_001127244.1\|2202395_2203325_+	HPr(Ser) kinase/phosphatase	NA	NA	NA	NA
WP_000924244.1\|2203349_2204162_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_000700958.1\|2204229_2204880_+	pyrophosphatase PpaX	NA	NA	NA	NA
WP_001255085.1\|2204903_2205416_+	acyltransferase	NA	NA	NA	NA
WP_000517728.1\|2205555_2207067_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_001288072.1\|2207151_2208108_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.4e-89	53.9
WP_000455202.1\|2208270_2209077_+	DUF368 domain-containing protein	NA	NA	NA	NA
WP_001190081.1\|2209305_2209764_+	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_000138464.1\|2209784_2210666_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.6e-07	28.9
WP_000712177.1\|2210669_2211623_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.3e-63	43.5
WP_000006561.1\|2211712_2212663_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	6.6e-52	38.1
WP_000250307.1\|2212686_2212935_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_001049162.1\|2213258_2213840_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
WP_000018934.1\|2214081_2214951_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_000215915.1\|2214971_2215178_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_000575919.1\|2215189_2215540_-	stage V sporulation protein AE	NA	NA	NA	NA
WP_000938967.1\|2215536_2216553_-	stage V sporulation protein AD	NA	NA	NA	NA
WP_000095399.1\|2216553_2217030_-	stage V sporulation protein AC	NA	NA	NA	NA
WP_001228539.1\|2217060_2217546_-	hypothetical protein	NA	NA	NA	NA
WP_000216166.1\|2217639_2217846_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_000647981.1\|2218385_2219693_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_000869728.1\|2219702_2219948_+	glutaredoxin family protein	NA	NA	NA	NA
WP_001258187.1\|2220084_2221113_+	gapA transcriptional regulator CggR	NA	NA	NA	NA
WP_000161236.1\|2221139_2222144_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_001036337.1\|2222283_2223468_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_001231039.1\|2223500_2224256_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_001231152.1\|2224252_2225782_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_000103949.1\|2225812_2227108_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	6.4e-183	75.4
WP_000910235.1\|2227251_2228157_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	7.8e-18	27.1
WP_000348695.1\|2228279_2229146_+	hypothetical protein	NA	NA	NA	NA
WP_000168836.1\|2229213_2230194_-\|capsid	phage major capsid protein	A0A1I9KK60	Lactobacillus_phage	4.5e-11	26.4
WP_000163597.1\|2230280_2231894_-\|capsid	phage major capsid protein	A0A1G5SCB8	Enterococcus_phage	2.1e-45	37.6
WP_000522482.1\|2231865_2233176_-\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	1.8e-71	37.4
WP_003158948.1\|2233592_2234081_-	HNH endonuclease	A0A1G5SA96	Enterococcus_phage	5.5e-18	38.9
WP_001043701.1\|2233950_2235708_-\|terminase	terminase	W5RV59	Staphylococcus_phage	3.4e-54	25.3
2236009:2236024	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3297627 : 3373850

Bacillus_phage(92.45%)

portal,integrase,tRNA,head,protease,tail,terminase,capsid,holin

attL 3295821:3295837|attR 3340437:3340453

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3295821:3295837	attL	NA	NA	NA	NA
WP_000323197.1\|3297627_3298758_-\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	1.4e-64	39.1
WP_000844352.1\|3299090_3299279_+	hypothetical protein	NA	NA	NA	NA
WP_001091283.1\|3299505_3299850_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	9.5e-17	38.4
WP_001045401.1\|3300285_3301383_+	hypothetical protein	NA	NA	NA	NA
WP_000153814.1\|3301807_3302176_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
WP_000516834.1\|3302394_3302622_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000284332.1\|3302673_3302874_+	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_000190237.1\|3303305_3304052_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	1.8e-108	97.6
WP_003172191.1\|3304020_3304824_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	3.0e-146	99.3
WP_000332456.1\|3304839_3305034_+	hypothetical protein	A0A1B1P7U7	Bacillus_phage	4.9e-31	96.9
WP_000805161.1\|3305059_3305233_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	98.2
WP_000811862.1\|3305247_3305502_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	3.1e-41	97.6
WP_000124862.1\|3305514_3305802_+	hypothetical protein	A0A1B1P7W1	Bacillus_phage	1.5e-44	100.0
WP_000502161.1\|3305840_3306785_+	sigma-70 family RNA polymerase sigma factor	A0A0U3TKA0	Bacillus_phage	3.1e-171	99.4
WP_000360818.1\|3306793_3306937_+	Fur-regulated basic protein FbpA	A0A1B1P7V2	Bacillus_phage	2.1e-18	100.0
WP_000656565.1\|3306920_3307115_+	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.0e-28	98.4
WP_000776935.1\|3307181_3307628_+	dUTP diphosphatase	A0A1B1P7U8	Bacillus_phage	1.9e-70	90.5
WP_001263811.1\|3307653_3307884_+	hypothetical protein	Q2LI93	Bacillus_phage	9.7e-34	100.0
WP_000871846.1\|3308050_3308461_+	hypothetical protein	Q2LI92	Bacillus_phage	3.1e-75	100.0
WP_000938989.1\|3308507_3308927_-	FosB/FosD family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	1.5e-61	94.4
WP_000065132.1\|3309263_3309770_+	hypothetical protein	A0A0M4RU27	Bacillus_phage	3.5e-84	85.7
WP_000111532.1\|3310514_3310721_+	hypothetical protein	NA	NA	NA	NA
WP_000360763.1\|3310757_3311036_+	hypothetical protein	NA	NA	NA	NA
WP_000064524.1\|3311155_3311404_+	helix-turn-helix transcriptional regulator	A0A0S2MV80	Bacillus_phage	2.0e-37	95.1
WP_000657899.1\|3311421_3311778_+	hypothetical protein	NA	NA	NA	NA
WP_000937292.1\|3311811_3312141_+	hypothetical protein	NA	NA	NA	NA
WP_000125775.1\|3312158_3312281_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_001041477.1\|3312586_3313057_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	2.9e-48	62.5
WP_001028524.1\|3313053_3313596_+\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	3.3e-88	88.9
WP_000291405.1\|3313869_3314691_+	nucleotide-binding protein	NA	NA	NA	NA
WP_000166213.1\|3315078_3315294_+	hypothetical protein	NA	NA	NA	NA
WP_000049754.1\|3315286_3315649_+	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	3.0e-61	94.2
WP_000357495.1\|3315810_3316191_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
WP_000633619.1\|3316171_3317944_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.0
WP_000767173.1\|3317959_3319174_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	3.1e-219	92.6
WP_000517632.1\|3319151_3319907_+\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	8.5e-135	96.4
WP_000782638.1\|3319903_3321091_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	2.0e-207	94.4
WP_073806362.1\|3321068_3321368_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_000891190.1\|3321376_3321652_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	2.3e-42	97.8
WP_001069939.1\|3321638_3321986_+\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	4.8e-61	99.1
WP_000852724.1\|3321973_3322411_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	2.3e-76	98.6
WP_001211421.1\|3322407_3322767_+	hypothetical protein	A0A1B1P7S7	Bacillus_phage	1.8e-63	98.3
WP_000952020.1\|3322780_3323365_+\|tail	tail protein	A0A1B1P7S4	Bacillus_phage	5.2e-108	100.0
WP_033650210.1\|3323388_3323820_+	hypothetical protein	A0A1B1P7S9	Bacillus_phage	8.1e-50	74.8
WP_000938714.1\|3323837_3323978_+	hypothetical protein	A0A1B1P7R9	Bacillus_phage	3.8e-17	93.5
WP_000896622.1\|3323993_3329009_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	98.3
WP_000094087.1\|3329045_3330527_+\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	1.3e-259	86.6
WP_001260160.1\|3330523_3334609_+	hypothetical protein	A0A1B1P7E6	Bacillus_phage	0.0e+00	66.8
WP_000064510.1\|3334633_3334909_+	hypothetical protein	A0A1B1P7E8	Bacillus_phage	2.2e-32	77.4
WP_000822829.1\|3335064_3336033_+\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	1.5e-168	91.2
WP_000373868.1\|3336037_3336463_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	7.5e-72	99.3
WP_000405801.1\|3336462_3337167_+	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	1.4e-112	82.9
WP_000043394.1\|3337230_3337812_-	type IV secretory system conjugative DNA transfer family protein	H0USX9	Bacillus_phage	1.6e-101	92.7
WP_000044279.1\|3337817_3338000_-	hypothetical protein	A0A288WFV9	Bacillus_phage	1.3e-12	81.6
WP_000394503.1\|3338003_3338210_-	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	3.2e-20	72.1
WP_001267635.1\|3338393_3338696_+	hypothetical protein	Q2I8E3	Bacillus_phage	6.3e-49	97.0
WP_000170771.1\|3338698_3338881_+	hypothetical protein	A0A288WGN6	Bacillus_phage	1.8e-22	90.0
WP_000891437.1\|3338996_3340178_+	cell division protein FtsK	H0USY1	Bacillus_phage	9.7e-186	81.2
WP_001025814.1\|3340119_3340743_+	hypothetical protein	H0USY2	Bacillus_phage	1.1e-98	83.4
3340437:3340453	attR	NA	NA	NA	NA
WP_000473516.1\|3340775_3341372_-	hypothetical protein	A0A0U3TZ58	Bacillus_phage	1.4e-68	74.2
WP_000872145.1\|3341788_3342289_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_001984764.1\|3342350_3342524_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_000246476.1\|3342653_3343160_+	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	3.0e-11	34.7
WP_000506700.1\|3343194_3343668_-	N-acetyltransferase	NA	NA	NA	NA
WP_000782401.1\|3344042_3344933_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000403057.1\|3345012_3346629_+	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000481786.1\|3346999_3347932_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_000067081.1\|3347947_3348310_+	cell division protein FtsL	NA	NA	NA	NA
WP_000600092.1\|3348382_3350482_+	penicillin-binding protein	NA	NA	NA	NA
WP_001266229.1\|3350563_3352480_+	stage V sporulation protein D	NA	NA	NA	NA
WP_000766307.1\|3352688_3354164_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_000893056.1\|3354186_3355161_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_000860119.1\|3355161_3356514_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000753510.1\|3356604_3357696_+	stage V sporulation protein E	NA	NA	NA	NA
WP_001265416.1\|3357801_3358896_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000437058.1\|3358957_3359863_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_000798226.1\|3359961_3360759_+	cell division protein DivIB	NA	NA	NA	NA
WP_001087551.1\|3361131_3362439_+	cell division protein FtsA	NA	NA	NA	NA
WP_000888987.1\|3362478_3363633_+	cell division protein FtsZ	NA	NA	NA	NA
WP_000261986.1\|3363945_3364863_+	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000976948.1\|3364882_3365602_+	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000197753.1\|3365759_3366539_+	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_002054579.1\|3366707_3366992_+	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_001209022.1\|3367108_3367927_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_000218170.1\|3367923_3368598_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_000119134.1\|3368617_3369088_+	cell division protein SepF	NA	NA	NA	NA
WP_000450918.1\|3369094_3369358_+	YggT family protein	NA	NA	NA	NA
WP_000029721.1\|3369373_3370141_+	RNA-binding protein	NA	NA	NA	NA
WP_001131611.1\|3370230_3370737_+	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000455959.1\|3371084_3373850_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	1.0e-84	27.9

DBSCAN-SWA_8

3569879 : 3633744

Bacillus_phage(44.68%)

portal,integrase,tRNA,head,protease,tail,terminase,capsid,holin

attL 3558936:3558951|attR 3584913:3584928

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3558936:3558951	attL	NA	NA	NA	NA
WP_000504940.1\|3569879_3570833_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_000813896.1\|3570854_3571079_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_000092460.1\|3571159_3572911_-	Gly-Xaa-Xaa repeat protein	NA	NA	NA	NA
WP_000450309.1\|3573024_3573990_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000438188.1\|3574103_3575060_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	1.0e-52	44.0
WP_000312272.1\|3575329_3575953_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_000391400.1\|3576045_3577320_+	GTPase HflX	NA	NA	NA	NA
WP_000460300.1\|3577312_3578584_+	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_000656783.1\|3578759_3579149_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_000135328.1\|3579197_3580532_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_000135918.1\|3580646_3581792_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	2.0e-66	38.2
WP_000673782.1\|3582016_3582445_-	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.8e-34	55.1
WP_000060654.1\|3582467_3582881_-	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	5.1e-25	47.1
WP_000877760.1\|3583156_3583357_+	helix-turn-helix transcriptional regulator	A0A0C5AJQ3	Paenibacillus_phage	1.4e-09	52.6
WP_000572505.1\|3583353_3584082_+	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	3.1e-49	48.6
WP_000483549.1\|3584190_3584457_+	hypothetical protein	S5MC08	Brevibacillus_phage	1.1e-25	55.8
WP_000510717.1\|3584607_3584925_+	hypothetical protein	NA	NA	NA	NA
WP_000897921.1\|3584896_3585160_+	hypothetical protein	A0A0M5M3T1	Bacillus_phage	2.9e-10	61.1
3584913:3584928	attR	NA	NA	NA	NA
WP_000780694.1\|3585174_3585657_+	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	1.1e-34	48.1
WP_001002737.1\|3585653_3586325_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	1.0e-27	45.8
WP_000849734.1\|3586338_3586611_+	hypothetical protein	A0A0M4S680	Bacillus_phage	2.9e-37	82.0
WP_000067428.1\|3586607_3587366_+	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	3.6e-61	54.9
WP_001229821.1\|3587301_3588132_+	ATP-binding protein	U5PWH5	Bacillus_phage	5.8e-36	38.4
WP_000861091.1\|3588316_3588946_+	hypothetical protein	A0A0M4RU33	Bacillus_phage	7.5e-28	41.4
WP_000553935.1\|3588948_3589071_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_000615365.1\|3589165_3589738_+	dUTPase	A0A0A7AQI4	Bacillus_phage	3.4e-80	73.8
WP_000286272.1\|3589752_3590532_+	DNA methylase	A0A0K2CYZ1	Paenibacillus_phage	3.6e-64	49.0
WP_000382674.1\|3590763_3591522_+	FAD-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	1.0e-79	62.1
WP_000520475.1\|3591916_3592201_+	hypothetical protein	A6M999	Geobacillus_virus	1.8e-34	72.0
WP_001206929.1\|3592232_3592559_+	DUF1492 domain-containing protein	NA	NA	NA	NA
WP_000627707.1\|3592769_3593009_+	hypothetical protein	NA	NA	NA	NA
WP_000528049.1\|3593468_3594296_+	hypothetical protein	NA	NA	NA	NA
WP_000532045.1\|3594477_3594726_+	hypothetical protein	NA	NA	NA	NA
WP_001135463.1\|3595079_3597710_+	acyltransferase	NA	NA	NA	NA
WP_000955566.1\|3597730_3598315_+	hypothetical protein	NA	NA	NA	NA
WP_001153113.1\|3598863_3599367_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	7.3e-58	65.3
WP_000837595.1\|3599515_3600655_+	AIPR family protein	NA	NA	NA	NA
WP_000916035.1\|3600723_3600936_+	helix-turn-helix transcriptional regulator	A0A0A0RMC4	Bacillus_phage	8.4e-08	45.5
WP_000002822.1\|3600974_3601610_-	restriction endonuclease	NA	NA	NA	NA
WP_001075358.1\|3601750_3602083_+	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_000282940.1\|3602115_3603099_+	HNH endonuclease	NA	NA	NA	NA
WP_000512458.1\|3603213_3603990_+	hypothetical protein	NA	NA	NA	NA
WP_003159543.1\|3604558_3604837_+	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.5e-09	43.8
WP_001228882.1\|3604957_3605383_+	hypothetical protein	NA	NA	NA	NA
WP_000109237.1\|3605469_3605892_-	pilus biosynthesis protein HicB	A0A1L2JY34	Aeribacillus_phage	6.8e-41	59.1
WP_001051274.1\|3606657_3606954_+	HNH endonuclease	R9TNN2	Paenibacillus_phage	2.7e-28	61.5
WP_000985231.1\|3607119_3607491_+	hypothetical protein	A0A2H4JA84	uncultured_Caudovirales_phage	3.3e-15	50.0
WP_001222619.1\|3607487_3609176_+\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	7.7e-253	73.2
WP_000522228.1\|3609191_3610403_+\|portal	phage portal protein	J9QE83	Clostridium_phage	1.1e-139	60.7
WP_001043897.1\|3610368_3610953_+\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.0e-39	50.5
WP_000854835.1\|3610966_3612130_+\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	3.2e-80	54.7
WP_000015463.1\|3612166_3612457_+	hypothetical protein	A6XMJ7	Bacillus_virus	4.8e-06	36.6
WP_000979030.1\|3612459_3612732_+	DNA-packaging protein	R9TMB7	Paenibacillus_phage	6.5e-21	58.4
WP_000997895.1\|3612728_3613028_+\|head	phage head closure protein	R9TPZ2	Paenibacillus_phage	1.7e-09	38.3
WP_000065124.1\|3613020_3613377_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	2.7e-30	60.3
WP_000172077.1\|3613373_3613703_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	1.1e-46	81.7
WP_001293690.1\|3613703_3614297_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.3e-92	84.1
WP_000415945.1\|3614301_3614673_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	1.6e-46	74.8
WP_000897052.1\|3614893_3616141_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.5e-181	83.8
WP_000807257.1\|3616406_3618791_+	hypothetical protein	D2XR26	Bacillus_phage	2.1e-09	60.3
WP_000094113.1\|3618832_3620314_+\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	1.7e-240	79.5
WP_001260145.1\|3620310_3625044_+	hypothetical protein	I7ILV8	Bacillus_phage	7.1e-288	41.4
WP_000077308.1\|3625061_3625337_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P7E8	Bacillus_phage	6.8e-34	78.8
WP_000373879.1\|3625448_3625874_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	2.8e-71	99.3
WP_000405763.1\|3625873_3626806_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	8.2e-156	84.2
WP_000384930.1\|3627355_3627595_+	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	5.9e-34	96.2
WP_000119488.1\|3627763_3628096_-	hypothetical protein	A0A1C8E989	Bacillus_phage	4.1e-25	60.0
WP_000276346.1\|3628807_3629035_+	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	6.2e-25	84.3
WP_000448298.1\|3629399_3630488_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.0e-49	35.9
WP_000721300.1\|3630484_3630634_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_001102618.1\|3631370_3631694_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000032391.1\|3631686_3632229_+	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_000976115.1\|3632229_3633036_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000413738.1\|3633123_3633744_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2

DBSCAN-SWA_9

4929494 : 4936609

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009879021.1\|4929494_4930079_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	1.9e-81	77.0
WP_000571537.1\|4930056_4931247_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	1.2e-148	64.4
WP_000156980.1\|4931365_4931548_-	hypothetical protein	Q2I8E2	Bacillus_phage	2.4e-19	80.0
WP_001267637.1\|4931544_4931847_-	hypothetical protein	A0A288WG38	Bacillus_phage	3.1e-24	51.5
WP_000649834.1\|4932012_4932213_+	helix-turn-helix domain-containing protein	A0A288WG80	Bacillus_phage	9.0e-20	76.6
WP_000637733.1\|4932249_4932714_+	restriction endonuclease	Q331T5	Clostridium_botulinum_C_phage	1.2e-14	43.2
WP_000810464.1\|4932745_4933879_-	ATPase	NA	NA	NA	NA
WP_000669607.1\|4934071_4935223_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000249923.1\|4935403_4936609_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	1.4e-51	47.4

DBSCAN-SWA_10

5245982 : 5254709

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001258491.1\|5245982_5246855_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.9e-66	45.9
WP_003158174.1\|5246995_5247109_-	hypothetical protein	W8CYT3	Bacillus_phage	1.6e-05	95.8
WP_000818985.1\|5247225_5247945_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000823558.1\|5248140_5248728_+	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_001231493.1\|5248752_5249826_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-171	88.5
WP_014654523.1\|5249822_5250509_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.2e-117	93.0
WP_000453759.1\|5250588_5252349_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-268	96.3
WP_001194297.1\|5252589_5253354_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755551.1\|5253452_5254709_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.6e-11	31.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP009900

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009900_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009900_1

19154-19474

Orphan

Consensus_repeat	Method
AATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAA	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP009900_1

>merge|NZ_CP009900|1|19154-19474|PILER-CR
AATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAATTTTTCTTTTTCCATCTCTCTCTCTTCTATTATATTAAACGTACAATCTTTTAATTTACACATGTGTACATTTACACATGTGTAAATGTACACAACAAAAAAACTATAATCCCTATAAACACTGGTCTGAATCATTTCAACACGAAATTTGTGTAAATGTGTAAATGTGTAAATGTGTAAATGTGTAAAATATACATTGATGTTGGATTACTTAAGGTATATAATGGATTTATAGGTAATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAA

>NZ_CP009900|1|1|19154-19474|PILER-CR
AATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAA	TTTTTCTTTTTCCATCTCTCTCTCTTCTATTATATTAAACGTACAATCTTTT
AATTTACACATGTGTACATTTACACATGTGTAAATGTACACA	ACAAAAAAACTATAATCCCTATAAACACTGGTCTGAATCATTTCAACACGAAATTTGTGTAAATGT
GTAAATGTGTAAATGTGTAAATGTGTAAAATATACATTGATG	TTGGATTACTTAAGGTATATAATGGATTTATAGGTAATTTACACATGT
GTAAATGTGTAAATGTGTAAATGTGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009900.1\|WP_001099043.1\|17064_18603_-\|replication-initiation-protein-RepS	unknown	unknown	gnl\|CDD\|378031
NZ_CP009900.1\|WP_001092475.1\|10234_10564_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_001009354.1\|26767_27433_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP009900.1\|WP_001101889.1\|5473_5848_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000637482.1\|26407_26719_-\|heavy-metal-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|105987
NZ_CP009900.1\|WP_001259529.1\|20978_21212_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000064258.1\|20361_20748_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000604768.1\|28143_28608_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|377367
NZ_CP009900.1\|WP_003159967.1\|25494_25824_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_001050016.1\|14366_15584_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000331440.1\|10614_10851_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_042514079.1\|5867_10109_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000347298.1\|32575_32785_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000169642.1\|28984_29575_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP009900.1\|WP_000517796.1\|16097_16862_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_001208167.1\|13034_13337_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375153
NZ_CP009900.1\|WP_001015855.1\|11819_12008_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000061608.1\|11997_12528_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009900.1\|WP_000400406.1\|19502_20369_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP009900.1\|WP_003171333.1\|31588_32023_-\|undecaprenyl-diphosphatase	unknown	unknown	gnl\|CDD\|239480

Protein	Function_ID	Function_description	E-value
NZ_CP009900.1\|WP_001099043.1\|17064_18603_-\|replication-initiation-protein-RepS	gnl\|CDD\|378031	pfam08708, PriCT_1, Primase C terminal 1 (PriCT-1). This alpha helical domain is found at the C terminal of primases.	3.55392e-09
NZ_CP009900.1\|WP_000169642.1\|28984_29575_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.24865e-13
NZ_CP009900.1\|WP_000637482.1\|26407_26719_-\|heavy-metal-binding-domain-containing-protein	gnl\|CDD\|105987	PRK12856, PRK12856, hypothetical protein; Provisional.	2.10823e-48
NZ_CP009900.1\|WP_001009354.1\|26767_27433_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.03701e-10
NZ_CP009900.1\|WP_000400406.1\|19502_20369_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	4.13842e-44
NZ_CP009900.1\|WP_003171333.1\|31588_32023_-\|undecaprenyl-diphosphatase	gnl\|CDD\|239480	cd03385, PAP2_BcrC_like, PAP2_like proteins, BcrC_like subfamily. Several members of this family have been annotated as bacitracin transport permeases, as it was suspected that they form the permease component of an ABC transporter system. It was shown, however, that BcrC from Bacillus subtilis posesses undecaprenyl pyrophosphate (UPP) phospatase activity, and it is hypothesized that it competes with bacitracin for UPP, increasing the cell's resistance to bacitracin.	7.16549e-39
NZ_CP009900.1\|WP_000604768.1\|28143_28608_+\|DUF523-domain-containing-protein	gnl\|CDD\|377367	pfam04463, DUF523, Protein of unknown function (DUF523). Family of uncharacterized bacterial proteins.	5.51707e-58
NZ_CP009900.1\|WP_001208167.1\|13034_13337_-\|hypothetical-protein	gnl\|CDD\|375153	pfam17362, pXO2-34, Family of unknown function. This is a family of unknown function found in Bacilli.	8.56948e-35

>NZ_CP009900.1|WP_001099043.1|17064_18603_-|replication-initiation-protein-RepS
MNTVQKAIELILHKGLRKYKSKNSKAGLVSIANQEKFESKVLNGKKNKKGSIFITRKKEDLSAKFGTRGVVLSSEEAVLDHVGQASHWTPNVYNFGTYGQNGLRTIVGHTEKNLQQINCFVIDIDSKSFPMTAINDVALNAGFGVPTMILETTKGYQVYYVLDKAVYVSNNKNFIAIKSAKRISQNLREMFADSLPNVDLTCNHFGFFRMPSVQNIVMFFEENVYTFKELQEWSKRQDDNKGNEQFHNVIESPFAKNAPVEQPKQMDELWFKQVISCTNVSPKQTKAGRNNAIFTLSLACFQSQYAIKDTMDLMDQFNSNLEQPLEHTEVRGIVMSAYSGKYQAAHKDYIERLLQTYGMGQASAFRAPSVLWKKHKKQRKDRVRSHWHEWEADIITFLSMNSNNKPVLYFTQSELCEALNVPRSTLNTVLKKSTKIYKTVEGKGKTAKTGLSTLGMLIAFALKENGKRRESYLNYLQGLFPKTGNILEQAKTSNVMEEQETLYGILEGLPAG
>NZ_CP009900.1|WP_000517796.1|16097_16862_-|hypothetical-protein
MGKNYPIDRDSRGRYRHSYVFMRGANVEVKLLNHEELLKGKITTIEEYYCVLDVEGTSGSYQVTVNFSEVKYIKHEEFPTVEERSPKYSKGDKKTSFVFKIGEKIGCVFKDGKGIKGTLLSEDAYYLYVKSEKENYYTIMKGALSYIAHVKHEPLLLTNDFYTEEMKLADYKKPTEYVFSVGDTITVYFPSGKNVSGVVLDESKYWVLLQTEKRQITIFKGSYSYFKHETYETKAYLYVENRKLRKQLRSGDTN
>NZ_CP009900.1|WP_001050016.1|14366_15584_-|hypothetical-protein
MNLKQNENVESKKTLTKFLGSLIDTIDFQRRSQGDLAKEMGVAGGTLSKNLTGKTQFGFWTLVKLLNILYDDINKRQEMLYTFCSVTTSKINLRIAMEYANAKGDLGLLKLIVDREKNSPLAMNREWAYAYELVWMRSCGILQGKALLDELEERKKRKIIKTEEIKVLYGILTFYTMYDLEKFNSLFDYAEVMQPNIELITDEFVRTAYSGRIKEGLSYAYLMQDNIDKSREICHEILNFKDDKNCFSLLRASALVYLAESYTFESYERASWYINKSLETLELCQSERANRRKENVLNTYAFIKLVNRQGLDSISIYHPAEESFFEIVKGNFKKAEIILNNIKNENGSLKPIEYCYLGLATNDITLLEKSIELFECEGNRFYCKFPKKMLVNLSKNGTMCEGGAK
>NZ_CP009900.1|WP_001208167.1|13034_13337_-|hypothetical-protein
MREKEFSKSTHRLKVTKEMDIGTLLNRAHKVSTFDGKNLIVLDNGNLYDQAGRREVPVTNMFRYIKSVRNSDGIVIAKKNKPCGKLMQVIFERKAKQKVK
>NZ_CP009900.1|WP_000061608.1|11997_12528_-|hypothetical-protein
MSMEYQERYVRKVATILSSKTKHTTGCLIEGESDVCLEFQIELINALQDNHGLVYHLDFNDYTSETDCLAALKKARKQLRSNKQDGKTLFLSLASFERVEKKTMDAVKILIGSRSLGINLVVSANKRFVHLVGLTEYLVTMNKSDVVLSELYRYSTQKILASLKNENVSWGEANES
>NZ_CP009900.1|WP_001015855.1|11819_12008_-|hypothetical-protein
MNHKVEKILRTKSIHVDLFELDEKYDLGQKIDVCCNKMNVIHTFKVFNITLLRGNHWLVHLQ
>NZ_CP009900.1|WP_000331440.1|10614_10851_-|hypothetical-protein
MAYQVPKCDCGNNLMYMFDKLYHEEFKITKNGVPFKHRYDFCDILEDAWREKLGCTSCDNGYEVEYDKLGRFIRGVLL
>NZ_CP009900.1|WP_001092475.1|10234_10564_-|hypothetical-protein
MNTITIKFGEGTAAWKDMQEVVKILNDKGYSTQPYGDIGTVKLTKVIEEGMKVSTEEKIAEPDPAAMNKTKEGTFKRILVEANYPWELIKDWTEEDCEAELGAIERANK
>NZ_CP009900.1|WP_042514079.1|5867_10109_-|hypothetical-protein
MVLNFKKIFILVFTVILLLGSLADFVSIGYAENTTDQEKKTDDVTVLQEKSDIKSLGLAPNEVVVANGKKGSDLLDFEAFIKPSDIVDGTEPFDKSNEAGNDSSPNNGIVRTFDTVTYPLKVTINPKKHDKLKDIKLKITGTLENGITNKRVNAKFAVGGKEDLEKGIVSFDMVYTLKETGNSLMIPVTVEVQGAEHGIKLKPNIKIQVMSVEGKDILNEQIEQSFENISPVTTSGKVNVKARINQSYSTLNFRLYRAYNPNAAESNRSNVFGNTITFYIANLPYRNDLRGATFPNGKINYHFEFSGRVTWDDKSLAETVLDFESEDTPIKIFNYGDIDTEAKKIPQENTESFELGIENYMQVNPHVAFTARSYIPKDKWNADDIEKYTINSVWDSGKTEISKPEVGKEKVVYKASVKDYVIGSTFPTMHAHTTNVPSFSKNQKAFSTVAFLIHTPNEYRSLGKNNQINKPNNVYYDLKCIVDSYEDSKGNVISYNTSTSTTITERNTVNGSYSLQNAFFTPDGKELGTPNLGYSTVSKGDATTIVGQDVKMHADLNVHAVTEGGAIIVYKWNTDSFYLTKEAGERAARDIISRGYTSLLGTTISNSDKQKVYYGIARKNDNSFQAITQNKEEDYEWYTTYDEARKYGEIAAIKNDIQDMFSHGTIIERGIFFKVKTRKVGSVNEKGTPNIIATAADIFPTADRKTRYRVAENRAYNNYTEYDENGVMTKLQSPVKSSVNFETLGIMNGETSSEVTTNKTTYYSSDNVNVTVDNLVKLPGEMDFTYLDEKIEMRVKIPKGLDYVVGTAKYGDQYIEPKIEQQSDGSNHLIWYDTLTRSNKVLKKINFETRINPVLLPQGNQVGLEIQNVLSSSMDTRLEKFRTSSKNISIVKIGMVGVSETIKKVTGKKNSDYEIGVQPYTTVKDEAHVKALTHVPRNKDENGSAFHGVTFLKQLTMDNPNHKNVEIWLNNSFIESNNPNKIDLQSNGWYRYTGEQDLSKVVSILLYINDSLSSSDVAKMNLVYGTHKNGFGDQYVSKTVVNTSVDYKLSPISNQVRYTIVANANIGLRKIRIDTAPAESGLPVTVRLDKDIVYEDSSKDEITVNLYDKADNRLVGSKVYTIGELPEEIKFKVDRKFLKKKSKRNYEVRFEKINKESIFVAEGKNKVDTDGYTSSEETVKANSKESTELKYKGVIMTEREVGKEMEVFHETLTIPLKQLPKQKTGYGFELKTEASYNNELAVPYDIKVGALIDKKLIDSHLNYEQKEGNTYVPLEETNKNISSDKRNNDFTFELPHVNVEQKTGALFTDQQVKDKDSRIKNALKDGKRKLYAPIWADLGDYNIFVKSELPIGANKVNFEVTQPLHVYAFMYGTIGSDTLKDDEILVEPVDPRNPFSNGKPSGWSDEDVAWLKR
>NZ_CP009900.1|WP_001101889.1|5473_5848_-|hypothetical-protein
MNVLTYSSAKKQIIFMALYFVITGIVIRLIGYSLQGSLSAFTQAGIGDLLSGNFSVKDMFHFDFSFDMSQFDGFSLNMWGVFIKDKIHSVVNDMMPTTLGAINMLMLSKYLTLERAIKLGIKLY
>NZ_CP009900.1|WP_000400406.1|19502_20369_+|ParA-family-protein
MEHKRPLTITVANSKGGVGKSTIVRHLSYHLALKGYKVLTADMDPQANTTKTMILTRKRVNDEYFAFDKTLMRAVQDGSLENMQLNIIENLDLLPSHSDFENFESLLTSKFGHAETSDPNYHEIETNKINYFRNLLEPLKQNYDFIIIDSPPTASYYTKSSAMASDYVLVAFQTQSDSLDGANDYITRFLARLVEEYNAQLDVVGILPNQLHSAGKIDTTVLQDAKDIFGENNLFKNLIPYAKRIQSVPRIGLNVDQYWDKKLFNEVFEPFTDEFLERINKMEELRNE
>NZ_CP009900.1|WP_000064258.1|20361_20748_+|hypothetical-protein
MSNEQGKGMGFFGNKGKPASEKKDEKKTKLDLDYKPDLNPSTPYDPTLPVKATLVNGDKRGTLRIPLETKHEFDALLEISEYQYTYELLGEMLDTWMKKLTPEQLRLFHASLENIKRKAAIKEAKKKK
>NZ_CP009900.1|WP_001259529.1|20978_21212_+|hypothetical-protein
MRTLIIITLVVIGLVFFNVISLHTIGTLAAIIGVIIAIALGAYFLYRLALGFFALFATFIGVILVICLITYAVTNLV
>NZ_CP009900.1|WP_003159967.1|25494_25824_-|hypothetical-protein
MRGVVNQNVLHHIGYEVLQETFVLIRNVFSYSNQGEYSVTYVREIADALYNIPHSIQKQHDTFLEFEFKLLEETLMQMEFGKVAAQNIPHFRMYAARVQQLLRKRYKEV
>NZ_CP009900.1|WP_000637482.1|26407_26719_-|heavy-metal-binding-domain-containing-protein
MIVTTTAEIQGKEIIEYIDIVNGEAIMGANIVRDVFASVRDVVGGRAGAYESKLKEARDIAMDEMKELAKQKGANAIVGIDVDYAIIRAGMLMVAVSGTAVRI
>NZ_CP009900.1|WP_001009354.1|26767_27433_-|CPBP-family-intramembrane-metalloprotease
MNFIKTNTKEISMLIIYALFVPFQIGLFILLGISLLTNSNIVESEFALSAISLTIPAIVGIIFFRKEIIESFTYFKEKTILKIVSIPMVVLFTVIVEQIVMRFLATGQPENQEQLLETGAEIPLILTLLVFGILGPILEEIIFRHIILNRFSNYIGTAIASIISIIIFTLFHTSQLSDIAIYLPGAVILTAAYLISNRSLAYVIAIHVLNNSIAFIQLHMS
>NZ_CP009900.1|WP_000604768.1|28143_28608_+|DUF523-domain-containing-protein
MILVSSCLAGKPVRYNGTACLNDTIQKLIDEKKAIPVCPELLGGFVTPREPAEILGGDGYDVLEGKAKVMERSGNDVTELYINGAMKTLNLAQEMQASHVVLKEYSPSCGSKEIYSGEFVGKKVTGVGVTTALLESKGIKVISELELDQLINKI
>NZ_CP009900.1|WP_000169642.1|28984_29575_+|TetR/AcrR-family-transcriptional-regulator
MTKVDKVKEKIIETSLYLFNTNGITRTSIQDIMTATELPKGSIYRRFKNKEEIVLAAYDKSGEIMWSHFHKAMENKKTAIDKILAIFLVYQDAANNPPIAGGCPLLNSAIESTGVFPELQKAAAKGYDDTVMLMASLIKEGIEKQELKEDIDIISLASFLASSMEGAIMASRVSNDNIHHQYFIEQIKHHLYSYSK
>NZ_CP009900.1|WP_003171333.1|31588_32023_-|undecaprenyl-diphosphatase
MMIIQAVFAFMTAEIIGKLLGKLHLNYQPFAVLPDVNKLADHVVDNSFPSDHTILFFSICVSVKLVHKKAGLLLLVIAFCVGISRIWVGVHYPFDVATGALIGSISALFSYWIVPKIKFITQILNLYERVEQYVLPLKSKSKEL
>NZ_CP009900.1|WP_000347298.1|32575_32785_-|hypothetical-protein
MDFQDIIFLMMDIKIEIYQDEKDMEKTEVAVKTEKTAIPFKWENPLEDTYTKMGYSESSPISAGGTFMG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69555-69606	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	289-340	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66280-66331	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	174-225	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39240-39291	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35254-35305	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32655-32706	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34219-34270	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34560-34611	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64427-64478	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70212-70263	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34220-34271	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22497-22548	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35262-35313	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34219-34270	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34386-34437	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9737-9788	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34146-34197	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34154-34205	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34215-34266	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34219-34270	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34709-34760	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34219-34270	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41067-41118	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34219-34270	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56733-56784	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19196-19247	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53509-53560	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	61820-61871	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31401-31452	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68494-68545	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34218-34269	0	1.0
NZ_CP009900_1	1.1\|19196\|52\|NZ_CP009900\|PILER-CR	19196-19247	52	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34147-34198	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69370-69417	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35443-35490	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34749-34796	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70401-70448	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22686-22733	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9926-9973	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34335-34382	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34343-34390	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19385-19432	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31590-31637	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34336-34383	0	1.0
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	104-151	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66095-66142	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39055-39102	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	34191-34238	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32844-32891	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34408-34455	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64616-64663	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34409-34456	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35451-35498	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34408-34455	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34575-34622	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34404-34451	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34408-34455	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34898-34945	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34409-34456	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41256-41303	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34408-34455	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56922-56969	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53698-53745	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	62009-62056	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68683-68730	1	0.979
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34407-34454	1	0.979
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35343-35408	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32744-32809	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34308-34373	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34649-34714	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64516-64581	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70301-70366	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34309-34374	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22586-22651	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35351-35416	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34308-34373	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34475-34540	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9826-9891	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34235-34300	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34243-34308	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34304-34369	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34308-34373	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34798-34863	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41156-41221	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34308-34373	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56822-56887	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19285-19350	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53598-53663	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69452-69517	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	61909-61974	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31490-31555	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	186-251	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66177-66242	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68583-68648	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	71-136	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39137-39202	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34307-34372	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34236-34301	6	0.909
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	34091-34156	8	0.879
NZ_CP009900_1	1.2\|19290\|66\|NZ_CP009900\|PILER-CR	19290-19355	66	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34309-34374	8	0.879
NZ_CP009900_1	1.3\|19398\|48\|NZ_CP009900\|PILER-CR	19398-19445	48	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	1-36	13	0.729

1. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

2. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

3. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

4. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

5. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

6. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

7. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

8. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

9. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

10. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

11. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

12. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

13. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

14. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

15. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

16. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

17. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

18. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

19. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

20. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

21. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

22. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

23. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

24. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

25. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

26. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

27. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

28. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

29. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

30. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

31. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

32. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

33. spacer 1.1|19196|52|NZ_CP009900|PILER-CR matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

34. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

35. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

36. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

37. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

38. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

39. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

40. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

41. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

42. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

43. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

44. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
************************************************

45. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

46. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

47. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

48. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

49. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

50. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

51. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

52. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

53. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

54. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

55. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

56. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

57. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

58. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

59. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

60. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

61. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

62. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

63. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

64. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

65. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

66. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
********************.***************************

67. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

68. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

69. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

70. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

71. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

72. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

73. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

74. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

75. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

76. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

77. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

78. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

79. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

80. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

81. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

82. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

83. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

84. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

85. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

86. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

87. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

88. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

89. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

90. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

91. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

92. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

93. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

94. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

95. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

96. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

97. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

98. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.909

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

99. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 8, identity: 0.879

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acccaacaaaaaaactataatccctataaacactggtttgaatcatttcaacacgaaatt	Protospacer
** **********************************.**********************

100. spacer 1.2|19290|66|NZ_CP009900|PILER-CR matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 8, identity: 0.879

acacaac-aaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaat	CRISPR spacer
-cacaacaaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaat	Protospacer
 ****** ****************************************************

101. spacer 1.3|19398|48|NZ_CP009900|PILER-CR matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 13, identity: 0.729

atatacattgatgttggattacttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataat------------	Protospacer
********************.***************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009901

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009902

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP009900

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection