CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	1 crisprs	NA	3	0
NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	0 crisprs	csa3,RT,c2c4_V-U1	0	0
NZ_CP010322	Bacillus anthracis strain Canadian Bison isolate A0369 chromosome, complete genome	5 crisprs	WYL,csa3,DEDDh,cas14j,cas3,c2c9_V-U4,cas14k,DinG	1	10

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010322_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010322_1

437039-437236

Orphan

Consensus_repeat	Method
TTTCGGAATGAACATTCATTCCT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP010322_1

>merge|NZ_CP010322|1|437039-437236|CRISPRCasFinder
TTACGGAATGAATATTCATTCCTATTATTTTGAAAACACCTTTTCGGAATGAACATTCATTCCTCTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGATTTCGGAATGAATATTCATTCCTTTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCTCATCGGAATGAATGTTCATTCCT

>NZ_CP010322|1|1|437039-437236|CRISPRCasFinder
TTACGGAATGAATATTCATTCCT	ATTATTTTGAAAACACCT
TTTCGGAATGAACATTCATTCCT	CTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGA
TTTCGGAATGAATATTCATTCCT	TTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCT
CATCGGAATGAATGTTCATTCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010322.1\|WP_001093210.1\|432753_433602_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
NZ_CP010322.1\|WP_000637714.1\|426756_427419_+\|DUF3841-domain-containing-protein	unknown	unknown	gnl\|CDD\|378997
NZ_CP010322.1\|WP_001269395.1\|442953_444126_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP010322.1\|WP_000633874.1\|430750_432376_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP010322.1\|WP_094770179.1\|433887_434460_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP010322.1\|WP_000898754.1\|451112_451646_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|379237
NZ_CP010322.1\|WP_003169883.1\|434426_434579_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225272
NZ_CP010322.1\|WP_001228120.1\|440741_441842_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP010322.1\|WP_001100954.1\|438092_439250_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_CP010322.1\|WP_000346934.1\|427529_428201_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP010322.1\|WP_000551418.1\|425769_426597_+\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP010322.1\|WP_000997708.1\|449979_450417_+\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP010322.1\|WP_000664623.1\|439435_440725_-\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP010322.1\|WP_000808762.1\|428260_430234_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP010322.1\|WP_001107293.1\|437256_437823_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP010322.1\|WP_000040244.1\|434579_437003_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP010322.1\|WP_001106984.1\|425291_425552_-\|lipoprotein	unknown	unknown	gnl\|CDD\|236766
NZ_CP010322.1\|WP_000709765.1\|450565_451096_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP010322.1\|WP_001197243.1\|441834_442935_-\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP010322.1\|WP_001273582.1\|444410_445487_-\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614

Protein	Function_ID	Function_description	E-value
NZ_CP010322.1\|WP_001093210.1\|432753_433602_-\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	2.01186e-152
NZ_CP010322.1\|WP_000637714.1\|426756_427419_+\|DUF3841-domain-containing-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	6.87406e-32
NZ_CP010322.1\|WP_001269395.1\|442953_444126_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP010322.1\|WP_000633874.1\|430750_432376_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP010322.1\|WP_094770179.1\|433887_434460_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	9.58984e-34
NZ_CP010322.1\|WP_000898754.1\|451112_451646_-\|acetyltransferase	gnl\|CDD\|379237	pfam13523, Acetyltransf_8, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	8.7669e-30
NZ_CP010322.1\|WP_003169883.1\|434426_434579_-\|hypothetical-protein	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	0.000695577
NZ_CP010322.1\|WP_001228120.1\|440741_441842_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	5.37504e-160
NZ_CP010322.1\|WP_001100954.1\|438092_439250_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	4.70014e-72
NZ_CP010322.1\|WP_000346934.1\|427529_428201_+\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.67512e-74
NZ_CP010322.1\|WP_000551418.1\|425769_426597_+\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.21079e-85
NZ_CP010322.1\|WP_000997708.1\|449979_450417_+\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	3.67802e-44
NZ_CP010322.1\|WP_000664623.1\|439435_440725_-\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP010322.1\|WP_000808762.1\|428260_430234_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP010322.1\|WP_001107293.1\|437256_437823_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.12259e-71
NZ_CP010322.1\|WP_000040244.1\|434579_437003_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	1.55084e-81
NZ_CP010322.1\|WP_001106984.1\|425291_425552_-\|lipoprotein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.000712004
NZ_CP010322.1\|WP_000709765.1\|450565_451096_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.19855e-68
NZ_CP010322.1\|WP_001197243.1\|441834_442935_-\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP010322.1\|WP_001273582.1\|444410_445487_-\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0

>NZ_CP010322.1|WP_000040244.1|434579_437003_-|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQLVSKDNTTILTQISIDKKHGEISKVSNNLHNKVKTKGVKTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFVALIIVFVISIPIVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTEKILKVKGVSEVYAPTRPTGERIKELYINKQADELNTGLGDANGGIKEINDGLTTAKDKMGSKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIERGLTSVNENISVLSNATSQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQMKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQVLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTA
>NZ_CP010322.1|WP_003169883.1|434426_434579_-|hypothetical-protein
MTIILDVNPYSKEAMPIIQEINKTIDGTLKGTELNNAKKQLEGPQLETLT
>NZ_CP010322.1|WP_094770179.1|433887_434460_-|MMPL-family-transporter
MGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLILAYFASLGISEQISTHLLNVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGEPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLALIQVASVVGVALLLLAIIVMPILLPALIGLMSKMKDYAKKLSERK
>NZ_CP010322.1|WP_001093210.1|432753_433602_-|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAQLINDILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLLSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELPFDKNVELIADKWQDFAEIALEDDKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLFYVEQDDLEFSFRKALKERNPEWSTGIVDYYTNQGYGKEHNHSGVEGAIKVLEARRNLELEIFDMLKMKKEKINNTKYEIGSYRSMLKDKLTIQMVK
>NZ_CP010322.1|WP_000633874.1|430750_432376_-|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEGVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWHESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_CP010322.1|WP_000808762.1|428260_430234_-|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
>NZ_CP010322.1|WP_000346934.1|427529_428201_+|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFIKWAFIIIIIAGVVFFGKAKQKATDGSI
>NZ_CP010322.1|WP_000637714.1|426756_427419_+|DUF3841-domain-containing-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDSDDIYSYDWMVRVAKTKLPHYEGNYPIWVWEANNYPNRNHKAWGRKNSKMVILTLDVPKKWVLWSYFDYWCCAMTDGSTYLHTKNKCTLDEWYIYMDKKYGIIFNFDYLLSHPDWYLDKEDSLEKQGVIGKIPLSFVKKVRRFRAKEDTSIHTIRSDNWDNRKENRIKKMNRKLRKRNEKQKRVQKRLIRN
>NZ_CP010322.1|WP_000551418.1|425769_426597_+|polysaccharide-deacetylase
MHNGIRMTTLMKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWRYNKMPVDAASAKIVENVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM
>NZ_CP010322.1|WP_001106984.1|425291_425552_-|lipoprotein
MNYKKMLSIFMTSIFTVGLLIGCNPAPKDEKEPDPTEEPSEQRQEEKNEKQDPAKEQNNELNKKDEQEPDPTEEPSEEQKKKKENE
>NZ_CP010322.1|WP_001107293.1|437256_437823_-|TetR-family-transcriptional-regulator
MAKNKQEDIFDAAIQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFTKSVLQLSELIKTDFPVNANIREQFSHTYNRLFEFARQNADAFLFTNSHCDSYFLDEHSNEIFEDFMGFFMDLIEDGIEKGFLRPLPPIALIIIVYQPIEKLIKVMETGQLEYTEELVKELEESCWNAIRII
>NZ_CP010322.1|WP_001100954.1|438092_439250_-|GNAT-family-N-acetyltransferase
MNVIRLKEDKFREALRLSEYAFQYKVDEDRLQQQITKMKESHEVYGIMEGENLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVSFYRKYGWELCANLLVCHMTKSDLVMKKQVNGTVKRFNKESHPEEVEKLYETFAELFSGMLVRNEKWWLQAVYDDLTLAIYYDENQTAAGYMLYKIENYKMTVEEFVPLHNEARNGLWNFICQHDSMIKDLEMTVSENEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVILHITDSFAQWNNITVRIANHEITIIEEPIDKGIKLDINALSTILFGYRRPLELNELELISGSEEEIRAFESVVPVRKPFIYDFF
>NZ_CP010322.1|WP_000664623.1|439435_440725_-|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGTTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFLSCVQGDTSIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLENVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDRMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>NZ_CP010322.1|WP_001228120.1|440741_441842_-|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHVTSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEKYQTYETI
>NZ_CP010322.1|WP_001197243.1|441834_442935_-|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>NZ_CP010322.1|WP_001269395.1|442953_444126_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIEMDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQIITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>NZ_CP010322.1|WP_001273582.1|444410_445487_-|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMEELKGFKNKLS
>NZ_CP010322.1|WP_000997708.1|449979_450417_+|YndM-family-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSSSRTRHHNDNIHINRRFAYGTEFAEEQNILDKDKKK
>NZ_CP010322.1|WP_000709765.1|450565_451096_-|cysteine-hydrolase
MKKALLVIDVQAGMYTAGMPVHNGEKFLETLQELIGECRSNDIPVIYVQHNGPKDHPLEKGTDGWKIHAAIAPLEGECVVEKTTPDSFHKTNLKEVLQDKGIDHVIISGMQTQYCVDTTTRRACSEGYKITLVSDAHSTFDTEVLRAEDIVKHHNVVFGAFADVVTLKDLKVTASK
>NZ_CP010322.1|WP_000898754.1|451112_451646_-|acetyltransferase
MLFQKDNVSVRYVVEEDAPIISKWLTDPEVLQYYEGRDDPQSVEMVLNHFIHNPNSPEKRCLIEFDDVPIGYIQMYPVDSESKTLYGYEESQNVWGMDQFIGEPTYWGKGIGTKFVKAAITYILSEMGAEAIAMDPKVNNERAIKCYEKCGFKKVKILKEHELHEGVLEDCWMMEYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010322_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010322_2

815331-815465

Orphan

Consensus_repeat	Method
TTTTGGATCATCCGTTTTTGGTTCTTC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP010322_2

>merge|NZ_CP010322|2|815331-815465|CRISPRCasFinder
ATCTGGATTTTCCTGTTTTGGATCATCCGTCTTTGGCTCTTCTGGTTTCTCTTCTTTTGGATCATCCGTTTTTGGTTCTTCCGGTTTCTCTTGCTTTGGATCATCCGTTTTTGGTTCTTCTGGTTTTTCTTGTTT

>NZ_CP010322|2|2|815331-815465|CRISPRCasFinder
ATCTGGATTTTCCTGTTTTGGATCATC	CGTCTTTGGCTCTTCTGGTTTCTCTTC
TTTTGGATCATCCGTTTTTGGTTCTTC	CGGTTTCTCTTGCTTTGGATCATCCGT
TTTTGGTTCTTCTGGTTTTTCTTGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010322.1\|WP_000988166.1\|820361_821390_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP010322.1\|WP_000060302.1\|819802_820159_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_001101666.1\|807110_807686_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|376808
NZ_CP010322.1\|WP_000041416.1\|813270_814107_-\|DUF4430-domain-containing-protein	unknown	unknown	gnl\|CDD\|379618
NZ_CP010322.1\|WP_000171478.1\|808350_808608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_009879381.1\|807709_808147_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227059
NZ_CP010322.1\|WP_001100385.1\|826312_826624_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000710875.1\|824057_824534_-\|Cys-tRNA(Pro)-deacylase	unknown	unknown	gnl\|CDD\|237976
NZ_CP010322.1\|WP_000044896.1\|810061_810763_-\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|377783
NZ_CP010322.1\|WP_009879384.1\|810735_812397_-\|energy-coupling-factor-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213193
NZ_CP010322.1\|WP_000405915.1\|824873_826151_+\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237097
NZ_CP010322.1\|WP_000266052.1\|816289_816769_-\|RraA-family-protein	unknown	unknown	gnl\|CDD\|236487
NZ_CP010322.1\|WP_000779967.1\|809155_809878_-\|YwiC-like-family-protein	unknown	unknown	gnl\|CDD\|379525
NZ_CP010322.1\|WP_000659023.1\|821400_822525_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_CP010322.1\|WP_003161810.1\|812369_813248_-\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692
NZ_CP010322.1\|WP_000545001.1\|808931_809123_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_001176953.1\|816969_818400_+\|YfcC-family-protein	unknown	unknown	gnl\|CDD\|224207
NZ_CP010322.1\|WP_000672206.1\|818547_819375_-\|ribonuclease	unknown	unknown	gnl\|CDD\|225231
NZ_CP010322.1\|WP_001024063.1\|822865_823438_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	unknown	unknown	gnl\|CDD\|234691
NZ_CP010322.1\|WP_001004518.1\|806760_807114_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010322.1\|WP_001101666.1\|807110_807686_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	2.28944e-46
NZ_CP010322.1\|WP_000041416.1\|813270_814107_-\|DUF4430-domain-containing-protein	gnl\|CDD\|379618	pfam14478, DUF4430, Domain of unknown function (DUF4430). Although this family has overlaps with SLBB, the majority of its sequences are unique. Several family members, eg UniProtKB:A0RGA8, that do not overlap have an LPXTG-cell wall anchor at their C-terminus, a SSF_Family 10_polysaccharide_lyase or Glycosyltransferase structure associated with them in the middle region, as shown by InterPro, as well as this domain at the N-terminus.	4.43546e-16
NZ_CP010322.1\|WP_009879381.1\|807709_808147_-\|hypothetical-protein	gnl\|CDD\|227059	COG4715, COG4715, Uncharacterized conserved protein [Function unknown].	6.89994e-09
NZ_CP010322.1\|WP_000044896.1\|810061_810763_-\|ECF-transporter-S-component	gnl\|CDD\|377783	pfam07155, ECF-ribofla_trS, ECF-type riboflavin transporter, S component. This family is the substrate-binding component (S component) of the energy coupling-factor (ECF)-type riboflavin transporter. It is a transmembrane protein which binds riboflavin, and is responsible for riboflavin-uptake by cells.	3.41367e-05
NZ_CP010322.1\|WP_009879384.1\|810735_812397_-\|energy-coupling-factor-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213193	cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system. Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	2.04249e-94
NZ_CP010322.1\|WP_000405915.1\|824873_826151_+\|histidine--tRNA-ligase	gnl\|CDD\|237097	PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional.	0
NZ_CP010322.1\|WP_000988166.1\|820361_821390_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.59651e-12
NZ_CP010322.1\|WP_000779967.1\|809155_809878_-\|YwiC-like-family-protein	gnl\|CDD\|379525	pfam14256, YwiC, YwiC-like protein. The YwiC-like protein family includes the B. subtilis YwiC protein, which is functionally uncharacterized. This domain family is found in bacteria, and is approximately 130 amino acids in length. There is a single completely conserved residue G that may be functionally important.	3.27961e-44
NZ_CP010322.1\|WP_000710875.1\|824057_824534_-\|Cys-tRNA(Pro)-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	1.60418e-80
NZ_CP010322.1\|WP_003161810.1\|812369_813248_-\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	8.06543e-14
NZ_CP010322.1\|WP_000659023.1\|821400_822525_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	4.03552e-14
NZ_CP010322.1\|WP_000266052.1\|816289_816769_-\|RraA-family-protein	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	1.97986e-81
NZ_CP010322.1\|WP_000672206.1\|818547_819375_-\|ribonuclease	gnl\|CDD\|225231	COG2356, EndA, Endonuclease I [DNA replication, recombination, and repair].	2.59085e-58
NZ_CP010322.1\|WP_001176953.1\|816969_818400_+\|YfcC-family-protein	gnl\|CDD\|224207	COG1288, COG1288, Predicted membrane protein [Function unknown].	2.44876e-148
NZ_CP010322.1\|WP_001024063.1\|822865_823438_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	gnl\|CDD\|234691	PRK00220, PRK00220, glycerol-3-phosphate 1-O-acyltransferase PlsY.	8.70024e-63

>NZ_CP010322.1|WP_000041416.1|813270_814107_-|DUF4430-domain-containing-protein
MSKMKWFISLLLSLGLLAGCEEAAVKLEKKVEPKQEEVAKQEEKKDEAKPEEKPEEKQAEQEQNKQDEQKEKQEQKVEEKPKEEKPQAQLEVKKEEKQQEQPKEQPAVNKQPEQQKAQEEKQQQPKAQEVKEEAKVVNQPKETPKQEQKKKPEENNSVPTPPTPVPDPVPPVPDPVIPKPKQVTISVKGNEGYLLGAKKVDVQEGDTVYKVLQRTGLDVDAMGSKDGIYVKGINDLYEKDITATSGWKYRVNGAFPNHSAGVVTVKPGDTIEWVFVLK
>NZ_CP010322.1|WP_003161810.1|812369_813248_-|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MKISFSSLHPFVNFFYYIGVMILCMMCLHPLFLIGAILLIVILNVMQGNSEKVRKMLPSTIVFFVMVILFNSLFTHRGRTTLFWVGDSRIKLEAIMFGVVMGLLLVAIMFTFASYNDIISSHKFLYLFSRISPKVALLTMITVRFVPLFMRRLQKITLVQKTKGVQVDAGSIVERVKNGMQLLQVLLICSLEDALQTADSMQARGFGVTKRTTYIRYRMERRDWYTLSYLSILFIIAIICSTYGGGKLIIYPKVESILFQQYDGMMFIVFTMFISLPIIMEGREWIWWRMQK
>NZ_CP010322.1|WP_009879384.1|810735_812397_-|energy-coupling-factor-ABC-transporter-ATP-binding-protein
MDMVAHAEIKNLSFVYADENEKALQHISLSVQKGEFIALAGGSGSGKTTLLKHFKKELLPIGKRTGDTYYDGTLLENVPDLLSAQEIGMVFQNPENQLVMDTVIQELAFSLENIGLPSHIIQKRIAELISFLGFQDLLHQSVHTLSGGQKQLVNLAAVLVMQPKLLLLDEPTAQLDPIAAKEFLGLLKRINEELGITIVLSEHRLDEVIPLATRVICMNNGRIVYDGSPKTVVANMWEVEKFRPFIPQIPRLFLEWNAKDIPFTVREAQMKLNDFLAISYVSEPIVQSEKQEVILSAEHISFQYEKNNPLILRDLTVSIEKGKWVALVGKNGTGKSTLLTILAGLQKARRGKVKWNGKVIHKIDSKERFKSIGYVSQHPYYHFTFDTVWDEVYERARELYGEQGKEIAEHQLKKFWLYGLKERHPHDCSGGEQQLLALCTTLLSKPTLLLLDEPTKGLDPWKKERVGELFRKLQKEGTTIVMATHDIEFAAKYVDQCMMLFDGAVIMNDAPKEFFSGNFFYTTSINRFIRKELPYALTWEDVYEACQNDMLHS
>NZ_CP010322.1|WP_000044896.1|810061_810763_-|ECF-transporter-S-component
MSKRYVAFIICIFAVIIGTLLFTTLIMDGYYMLSSLFLLVVIMLPFYIRFERKAFVSREIVLVAVLAAIAAVSRVPFSILPSVQPTSFVIIVSAIVFGSETGFMIGATAAIVSNIFLGQGPWTPWQMFSWGMIGFIAGLLRNTFLMKKLWGRLLYGLFVGFLFGWIMNFWGLLGFIREATWETVISYYIASFYFDLSHAISNVVFLLLFSTSWITILTRFKKKYGILDEHNMV
>NZ_CP010322.1|WP_000779967.1|809155_809878_-|YwiC-like-family-protein
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKEYLHAAIVYFIIAFVFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALRNDISAIIVFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHILLMIIVFAINPWCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
>NZ_CP010322.1|WP_000545001.1|808931_809123_+|hypothetical-protein
MHENARGYVQDSFQSLQEAKQCLEAALQTVEKDFNRARIEQSLYAIEQAIQRCDYTVHILEQD
>NZ_CP010322.1|WP_000171478.1|808350_808608_-|hypothetical-protein
MTLEKYVKLRSTVYEYMIEQDKPISLLDIQEHIVSHHEGKFTKKMLHQFYLSRLLDELKLDGKITLADEYLYTEKGVFYKARKGS
>NZ_CP010322.1|WP_009879381.1|807709_808147_-|hypothetical-protein
MHRFGSQKGIKGRGVVMYAYLLHDITKWIPKYIMDKGYEYYEEGNVEDVEIQDKKIFAFVTGNAGDYEVIIDLEDFTESSCECPYENYCKHMAAVVYDIQGAGESTVKEKLKDLDKEELLTVLNRLLQSSKNIQIVEKMLKKGKL
>NZ_CP010322.1|WP_001101666.1|807110_807686_-|NAD(P)H-dependent-oxidoreductase
MNVLIVYAHPSPSSFNAAILKHVQKGLQETNHSVTVLDLYKEQFNPVLVFNEEKKRRDLVNEEETARYRALVEEADTLLFIYPIWWWGMPAILKGFIDRIFVAGFAYKYEGALPKGLLKGKKAWGINTLDSPLWYVALLYRSADWIIMKRGVLRFCGIRDIKRSVFQSVKTSKREKREKWLLQIEEKARTL
>NZ_CP010322.1|WP_001004518.1|806760_807114_-|hypothetical-protein
MNEMERIINCCQYDNELFRTYINCLIQLKKCSETFQQIQIQLRNDYLIRGIFEREVDEVVRGSKEYETYFLPKALQWNFLKNNQHLIEKVCGDFFAFEALYLTEIEWKTVINCVGNK
>NZ_CP010322.1|WP_000266052.1|816289_816769_-|RraA-family-protein
MWKTTDLCDEFENELQICRQPFRSFGKKEQFHGKIATVKVKDDNVLVKEGLQTLPEGTVLVVDGGASTNCALLGDNLAAIAEERKLAGIIVNGYVRDSSELKNINIGILALGTMPNRSVKEGKGERNISLQFGQVEWKPDEYVYVDEDGVIISDKSLHR
>NZ_CP010322.1|WP_001176953.1|816969_818400_+|YfcC-family-protein
MQLQTEVKKQPSKRKFKMPDAYVLLFFIALLCAIATYFVPAGEFKRVTNGTVTTTIPGSYHSVPQSPVGFVSFFTAIEKGMTLAAPIIFLILFTGGAIAILEKTGALDGLIYHVINKFRNQQLLFICIVAALFSILGTTGIIVNSVIGFIPIGIIVARTLKWDAIVGVAIIYLGTYAGFNATILSPSPLGISQKIAELPMFSGIGLRTAIYISFLLATILYINWYVKRLKKSNKGSILGDNWFPSNALSSGKEAQKTEVPWTIRHKLILLVSALSLIAFLIGAFRLHWTDAEMTATFSFIAITAGIIGGMKANDIASTFLAGCQNLIYGALIVGMARCISVILEQGKLLDTIVNQLAQSLEGQSPVFGVIGMYVSSAALHFLISSGTGESVIFIPILAPLADFMHITRQVTVQAVMLGEGVVNCLNPTSGVLMGVLAASGISYGKWIRFMAPLAFIWFIIGLIFLIVGVNIEWGPY
>NZ_CP010322.1|WP_000672206.1|818547_819375_-|ribonuclease
MKFRNTKLAMVTLSSFFILGSASLSFTNIIQGEVASASPQEITVKSYDDTYYNNAIGKTGLELKKELHNIIDDHTKLSYSAVWEALRDTDEDPNNKNNVILLYTGRSQGKLTNGSGVDNWNREHVWAKSHGDFGTTAGPGTDLHHLRATDVSVNSSRGNLDFDNGGVNHSEATECKYDSDSWEPRDSVKGDIARMLFYMAVRYEGDNGEIDLELNEKVNNNKDPYMGKLSVLLKWNEQDPVDDLERKRNEVIFTKYQHNRNPFIDHPEWVNKIWN
>NZ_CP010322.1|WP_000060302.1|819802_820159_-|hypothetical-protein
MSLTTGPIENVGNQPANANKVRVKILNRTAGPLTGVARVFRLDGSLVLIEQVNFNVNSNASTFATLSLVHPAFGQAFEYEVQIVPNQPGGLYSVYGLTAESVIITAQRVVNSELTQFL
>NZ_CP010322.1|WP_000988166.1|820361_821390_-|alpha/beta-hydrolase
MMTFDEYEVAIKSEFTLQGTITRPKAEGKYAAVVIIAGSGEIDRDGTIVPLKLEANIYKELAHVMSRLGVVTLRFDKRGVGKSDGEFLKTGMWDLVSDIESTITYLKEQPFVDPENIILAGHSEGCMLATVVNARTPVNGLILLTGAAESLEEAAKRQREIAYKELKEQKGIKGKLMRLLNVEKRGEKQMEKIKEKMMNTEKDTIKVGFKPMNAKWFREHFQHDIYKDLQQVTCPVLAIAGDKDIQADPERAKRIGDYVKGNSEVHVIKDMDHSLKVFKGEFKTLEFKKNYEEGARKPLHPELEEIIVNWLDTHFISQHAGSKIPGSILGESEEVGRKSNCL
>NZ_CP010322.1|WP_000659023.1|821400_822525_-|helix-turn-helix-transcriptional-regulator
MKEINIHKIIADKRKEKGITQEELAAYIGITKASVSKWETGQSYPDITFLPLLASYFNISIDELISYKPQMEQEDIKNLYHRLAEAFSEKPFDEVMMECRKIIKKYYSCFPLLIQIGILFINHHMLTEDTDRRIEILEEAMNLFSRVQEESDDVSLVKEAVSFQATCYLILNKPNEVLQLLGETIRPNVPEEDLIAQAYQMLGNTKKANEIMQISMYQHLIQLVATIPNYVVVNASSVEKVEVILNRAFMLIDIYEIETLHPNMTLKVYYAAAQVYCMQGNFERALKMLRKYAAVCAASFTVNSLHLHGDSYFDAIDEWFAEFPLGAKTVRNEEIIKRSMLQSIAENPVFAPMKDVREYKNIITSLKFKLDIKE
>NZ_CP010322.1|WP_001024063.1|822865_823438_-|glycerol-3-phosphate-1-O-acyltransferase-PlsY
MNILTLILSYLIGSISFALIVGKMFYKKDIRDYGSGNLGATNAYRVLGIKAGVIVAIADILKGTFACLLPLILSSTINPIVCGLLAILGHIFSVFASFKGGKAVATATGVFLFLSPLGVLVGFVVFVLTLLFTKYVSLSSMLAGIALFIYSLIFEDKVIIALSLLIIVSIIILHRQNIKRILNGTENKIV
>NZ_CP010322.1|WP_000710875.1|824057_824534_-|Cys-tRNA(Pro)-deacylase
MKKDKTNAMRILDKEKIEYSMMSYNPDDGKIDGVSVAEKIGREVREVYKTLIAQGNSKNYHVFIIPVDEELNLKAAAKAVSEKKIEMIPVKDITKVSGYIRGGCSPIGMKKLFSTCIDASAQSLETMIVSGGKIGIQIELKVDDLAKVTRAQFGEITK
>NZ_CP010322.1|WP_000405915.1|824873_826151_+|histidine--tRNA-ligase
MEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRYDLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQYNNRKLLNGILQAINIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTVLSCLQLSIADFKEAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKDGSITSSIGSGGRYDNIIGAFRGDDMSYPTVGISFGLDVIYTALSQKETISSTADVFIIPLGTELQCLQIAQQLRSTTSLKIELELAGRKLKRALNYANKENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSSLSNYL
>NZ_CP010322.1|WP_001100385.1|826312_826624_+|hypothetical-protein
MNVFIKVLKWTTGISHLILIPCYYLTPGLVDLYGIPPLTVITLHIITILLAKKEDMNTYPHYIGIIVTLVAFFPYIDIVLHMIAAIFLLLDAASTNTKKVYDS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010322_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010322_3

983665-983767

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP010322_3

>merge|NZ_CP010322|3|983665-983767|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NZ_CP010322|3|3|983665-983767|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010322.1\|WP_000351706.1\|979983_980835_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP010322.1\|WP_001172053.1\|993674_994022_-\|DUF4260-domain-containing-protein	unknown	unknown	gnl\|CDD\|379455
NZ_CP010322.1\|WP_000628693.1\|968674_969199_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695
NZ_CP010322.1\|WP_000275806.1\|992389_992989_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NZ_CP010322.1\|WP_000798801.1\|978323_978554_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_001095162.1\|969205_971107_-\|mannonate-oxidoreductase	unknown	unknown	gnl\|CDD\|234750
NZ_CP010322.1\|WP_000236552.1\|981430_982108_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP010322.1\|WP_000417232.1\|984405_985059_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000813610.1\|993123_993651_-\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
NZ_CP010322.1\|WP_000544597.1\|980827_981337_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP010322.1\|WP_000445390.1\|985674_987294_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP010322.1\|WP_000473534.1\|972443_973985_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_CP010322.1\|WP_001291979.1\|971719_972349_+\|exosporium-leader-peptide-containing-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000164886.1\|989311_990778_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP010322.1\|WP_000646397.1\|988134_989133_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP010322.1\|WP_000592013.1\|992124_992316_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NZ_CP010322.1\|WP_001226321.1\|982157_983102_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP010322.1\|WP_003157243.1\|978653_979898_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP010322.1\|WP_000571881.1\|987771_988116_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP010322.1\|WP_000933357.1\|985163_985343_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030

Protein	Function_ID	Function_description	E-value
NZ_CP010322.1\|WP_000351706.1\|979983_980835_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50852e-87
NZ_CP010322.1\|WP_000628693.1\|968674_969199_-\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	1.98572e-53
NZ_CP010322.1\|WP_000275806.1\|992389_992989_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.20741e-71
NZ_CP010322.1\|WP_001095162.1\|969205_971107_-\|mannonate-oxidoreductase	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	4.85764e-160
NZ_CP010322.1\|WP_000933357.1\|985163_985343_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.00840603
NZ_CP010322.1\|WP_001172053.1\|993674_994022_-\|DUF4260-domain-containing-protein	gnl\|CDD\|379455	pfam14079, DUF4260, Domain of unknown function (DUF4260). This family of integral membrane proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 114 and 126 amino acids in length. There is a conserved GLK sequence motif.	2.33749e-49
NZ_CP010322.1\|WP_000813610.1\|993123_993651_-\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	6.28806e-55
NZ_CP010322.1\|WP_000544597.1\|980827_981337_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	2.0675e-75
NZ_CP010322.1\|WP_000445390.1\|985674_987294_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	9.27661e-109
NZ_CP010322.1\|WP_000473534.1\|972443_973985_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_CP010322.1\|WP_000236552.1\|981430_982108_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	6.43775e-21
NZ_CP010322.1\|WP_000164886.1\|989311_990778_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP010322.1\|WP_000646397.1\|988134_989133_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	6.42217e-150
NZ_CP010322.1\|WP_001226321.1\|982157_983102_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	3.02275e-148
NZ_CP010322.1\|WP_003157243.1\|978653_979898_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.22824e-96
NZ_CP010322.1\|WP_000571881.1\|987771_988116_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.46799e-14
NZ_CP010322.1\|WP_000592013.1\|992124_992316_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	3.30665e-06

>NZ_CP010322.1|WP_001226321.1|982157_983102_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLKKIHSINKNIPLVQLLWYYPNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGDLIINESYMKMARQNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHTVLKEK
>NZ_CP010322.1|WP_000236552.1|981430_982108_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDVIFVFGGSHPGNWQAPLETYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMENGVPKGAILFEKNSLHSIANVIEAKKIFDFTKINRLLFVCKNLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPEKEVHGLEEYVSYYYNLA
>NZ_CP010322.1|WP_000544597.1|980827_981337_+|DUF3916-domain-containing-protein
MHEKKIRGMKRKTNAMIKRIEEHTKMFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIQPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISIFPTPQLLRFQEVIYDEDTIDEKEIWFIGELS
>NZ_CP010322.1|WP_000351706.1|979983_980835_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHDVSFNPLPNSFNKVPTTFITRNDIFRSAALQKFMEVTHNA
>NZ_CP010322.1|WP_003157243.1|978653_979898_-|MFS-transporter
MEEDGGIIVLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFIGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVQEEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRVALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMSIHTITSGVLYSVSALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYAYAWLCIVVLLSISAVSLYRRNKKIKES
>NZ_CP010322.1|WP_000798801.1|978323_978554_+|hypothetical-protein
MKNTDKRNRLDDMMFHYRVTKNNIVLIEYYGKQIMILKGTAAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNERQ
>NZ_CP010322.1|WP_000473534.1|972443_973985_-|alpha-amylase
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDGNHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
>NZ_CP010322.1|WP_001291979.1|971719_972349_+|exosporium-leader-peptide-containing-protein
MSEKYIILHGTALEPNLIGPTLPPIPPFTFPNGPTGITGPTGATGFTGIGITGPTGVTGPTGIGITGPTGATGLGILPVFGTITTDVGIGFSVIVNTNINFTLPGPVSGTTLNPVDNSIIINTTGVYSVSFSIVFVIQAISSSILNLTINDSIQFAIESRIGGGPGVRATSARTDLLSLNQGDVLRVRIREATGDIIYSNASLVVSKVD
>NZ_CP010322.1|WP_001095162.1|969205_971107_-|mannonate-oxidoreductase
MNTMTFEKLQYNELKDIVKFYCVSGLGKELINKLEPSTSIKVVRNRLNETTEARAILDAEGHVPFFGISNIASTIQKLEKGMILDPEELVSVSDFLRGCRKIKKFMLDKEFFAPVLASYANSMTEYKSIEEEINFSIKGNSIDSAASKELKRIRNNIDSVDGKIKERLTKFLNSSANKKYIQEFFISKKDDRYTIPIKSSYKNQVAGSIVEASAKGSTVFIEPHTVTKLNAELASLKAEEAMEEYQILATLSGMVVENIYHIKINMELISQYDMVFAKAKFSKSIDGIEPKLNDHGHIHLVNCKHPLLSGKVVPLNFEIGQNYRSLIITGPNAGGKTIVLKTIGLLTLATMSGLHIAGDKETEIAIFENVFVDIGDNQSIENALSTFSSHMKNLSEIMRMSNNNTLLLFDEIGSGTEPNEGAALAISILEEFYLAGCITVASTHYGEIKRFSEMHDDFMNAAMQFNSETLEPLYKLVIGKSGESNALWIANKMNVRERVLKRAKAYMGNKEYTLEKVNESKIRKPKFLQEKRENHYEYKIGDRVNLLDHDDFGIIYKEKDNFYNVVVYYNGEFIEVNVKRITLEVAAKELYPEGYDLNTLFVDYKERKMQHDIERGSKKALRKIQKEMRKNRG
>NZ_CP010322.1|WP_000628693.1|968674_969199_-|N-acetyltransferase
MITIRQEQKNDYRKTEEVVKEAFLHEEFSDKKEHELVKRIRECDAFVPELSIVAVDEAIVGHIMLSKIKIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLGHPEYYPKFGFKKAIEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYSSAFAE
>NZ_CP010322.1|WP_000417232.1|984405_985059_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSARSSVVMVWVVINFMILTPFLFPPTFTIYLYVILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFVLYIFTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>NZ_CP010322.1|WP_000933357.1|985163_985343_+|hypothetical-protein
MLNLIPSVTILDPIETPKPIQAPATVPIGPPKTVPTAAATPSLAPAKALTAVVPTPIAA
>NZ_CP010322.1|WP_000445390.1|985674_987294_-|FAD-dependent-monooxygenase
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKTLENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARILGGELSFYHELVSYEQNEQGVIATIRNRETEKESVIHCDYVIAADGAKSKIREQLGISAEGRGTIGGYYMNIYFEADVSEFMQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVEPEIVSVLPWKAAESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKAKPKLLETYHEERYPVAKLTTDYAISLLFRAANREEGSLNKMDGLAVTAGYHYSSDAIIDDAVTLHRMDIVQLNGRPGTRAPHFIGMYEEKEVSVLDLLGNDFVLLTGAENDSWAESAHTVSAKLGVNIKVYRVGLSGDFIAQENIFSELYGLSDGGAVLIRPDAFIGWRSEKEVVNLDVVLEEVMSNLLCDF
>NZ_CP010322.1|WP_000571881.1|987771_988116_+|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>NZ_CP010322.1|WP_000646397.1|988134_989133_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGPDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFSKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>NZ_CP010322.1|WP_000164886.1|989311_990778_+|YdiU-family-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEVLKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYATEQEEYCVPPVPTNRPYRTFCGT
>NZ_CP010322.1|WP_000592013.1|992124_992316_+|Phr-family-secreted-Rap-phosphatase-inhibitor
MIKKISSVFLGLSVFGILATGIHSSFTYQAGHADLPAPQRPDLVQSVDASKDYNSTTTAEKAL
>NZ_CP010322.1|WP_000275806.1|992389_992989_-|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDPNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVARRKLVVEELEKVGSEGSRGIAELMRK
>NZ_CP010322.1|WP_000813610.1|993123_993651_-|GrpB-family-protein
MKQRITIEEYNIKWESEFNKLQTLINDVMEDSILSIEHVGSTSIKGLAAKPVLDIDIVIEDYGFFPKVVTKLGAIGYYHQAEWSYKGREAFGRKDAFVPWDGESTDWMEHHLYVCDKESEELRRHIAFRDYLREYEDVAVEYGHLKEELARETKSRTSYSEGKTAFITNILEKIN
>NZ_CP010322.1|WP_001172053.1|993674_994022_-|DUF4260-domain-containing-protein
MQKRIVHFEGLVVFVATIYMYSLYEFSWIIFLIFLLAPDLSMLAYGINNHIGANIYNLFHTYIISILIVIIGVYFKVDTVIMIGLIWTAHIGMDRMFGYGLKYETEFKGTHIQRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010322_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010322_4

4010230-4010323

Orphan

Consensus_repeat	Method
GGTTTAAATACGTTAAATAGCAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010322_4

>merge|NZ_CP010322|4|4010230-4010323|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAAGCGGTATAGGGAAATTACAAGATGGATCCGGAAAAGTAACAGACGGTTTAAATACGTTAAATAGTAAAA

>NZ_CP010322|4|4|4010230-4010323|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAA	GCGGTATAGGGAAATTACAAGATGGATCCGGAAAAGTAACAGAC
GGTTTAAATACGTTAAATAGTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010322.1\|WP_000140275.1\|4012505_4012811_+\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|378279
NZ_CP010322.1\|WP_001068232.1\|4012837_4013191_-\|PlcR-regulated-protein-PRP2	unknown	unknown	gnl\|CDD\|379617
NZ_CP010322.1\|WP_000984150.1\|4005128_4005968_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000252599.1\|3997190_3998237_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP010322.1\|WP_000453710.1\|4000667_4002020_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635
NZ_CP010322.1\|WP_000832626.1\|4017414_4017843_+\|lipoprotein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000279249.1\|4002260_4004627_+\|endonuclease	unknown	unknown	gnl\|CDD\|225249
NZ_CP010322.1\|WP_001228080.1\|3999206_4000628_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP010322.1\|WP_001055163.1\|4018004_4019537_+\|fatty-acid--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|236072
NZ_CP010322.1\|WP_003170545.1\|4006601_4008500_+\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|310280
NZ_CP010322.1\|WP_000620028.1\|4013324_4013828_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP010322.1\|WP_003170543.1\|4004778_4005132_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000184500.1\|4006197_4006596_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP010322.1\|WP_000567010.1\|4015118_4015247_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NZ_CP010322.1\|WP_000897260.1\|4016170_4017160_+\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NZ_CP010322.1\|WP_000726793.1\|3998251_3999187_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP010322.1\|WP_003158412.1\|4012253_4012469_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000784654.1\|4015426_4016161_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NZ_CP010322.1\|WP_000103719.1\|4014065_4015043_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP010322.1\|WP_000963385.1\|4008713_4009286_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228

Protein	Function_ID	Function_description	E-value
NZ_CP010322.1\|WP_000140275.1\|4012505_4012811_+\|DUF2087-domain-containing-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	6.13433e-24
NZ_CP010322.1\|WP_001068232.1\|4012837_4013191_-\|PlcR-regulated-protein-PRP2	gnl\|CDD\|379617	pfam14470, bPH_3, Bacterial PH domain. Proteins in this family are distantly related to PH domains.	8.25131e-17
NZ_CP010322.1\|WP_000252599.1\|3997190_3998237_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP010322.1\|WP_000453710.1\|4000667_4002020_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	0
NZ_CP010322.1\|WP_000279249.1\|4002260_4004627_+\|endonuclease	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	6.06794e-71
NZ_CP010322.1\|WP_001228080.1\|3999206_4000628_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP010322.1\|WP_001055163.1\|4018004_4019537_+\|fatty-acid--CoA-ligase-family-protein	gnl\|CDD\|236072	PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP010322.1\|WP_003170545.1\|4006601_4008500_+\|M56-family-metallopeptidase	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	4.41733e-47
NZ_CP010322.1\|WP_000726793.1\|3998251_3999187_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP010322.1\|WP_000184500.1\|4006197_4006596_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	1.24316e-46
NZ_CP010322.1\|WP_000567010.1\|4015118_4015247_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NZ_CP010322.1\|WP_000897260.1\|4016170_4017160_+\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	4.02345e-137
NZ_CP010322.1\|WP_000620028.1\|4013324_4013828_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.41273e-15
NZ_CP010322.1\|WP_000784654.1\|4015426_4016161_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.04117e-87
NZ_CP010322.1\|WP_000103719.1\|4014065_4015043_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.85756e-113
NZ_CP010322.1\|WP_000963385.1\|4008713_4009286_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.01953e-15

>NZ_CP010322.1|WP_000963385.1|4008713_4009286_+|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKYFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAENAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSVIQSYLKIAIDKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSN
>NZ_CP010322.1|WP_003170545.1|4006601_4008500_+|M56-family-metallopeptidase
MIDMLINVYLPHFFDWLIETSLMASILVGFILCIKILFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYRSSVSEVIPKNMPSTESKMNIESDRKVELESHAETVTKSGKPEVNVSTEQQITLSLYKIAMYVWLVGVFLLAVITFITNRRLYSYIKKQPDITDEQVVTVFNRCKQSMKMKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRNDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEHYSYQAPSLANLSRNKRTMKRRIVMIKKFQKKSYRLSLLGVIVIVAIASLSLFNVRATEGKEKQEDKVEQSKDAFQNAVDMLYGTEENAKKEYHYSARVYEEKTDYLYLAEKALTKDEFQQYIKLSKKIINIQKKGAPRDSDYESTVFREERLSKADRDKLYALYDQAKPFDDKVYESLNYTVKEAQQHVDFQIKKPTYTIEGYNLKDENVGYFIKRRPELIIELEYTNAKGNYTIYQSQVFGESKDPFSHQFVVPENIEQYELEGNQIFYATDHSDSNLQGMKMIVPAKGKNSAYQVVIINHSLERQGEAVFDKNVNKEELEKIMISMLK
>NZ_CP010322.1|WP_000184500.1|4006197_4006596_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWLKSPQTANEIIEELEDPMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRLLDEKTEENKRKD
>NZ_CP010322.1|WP_000984150.1|4005128_4005968_-|hypothetical-protein
MMRALRLNIKQAFCNRVSLIIMFSGFVLICIYHYYYVIRYLGDAASGPISTDIKWIGFRDNEMDVYLLLMPIIASLPFSTSYNSDKSDGFKQFVSKGINLFSYSITKYIVTFFCGGLLYTLPFILSLLFCKLTIPDGEMPAGSGIINVNGMFASLYEASPIIYITVYIEINFLFAGLMALLGLAASAWSQKDYMSLLFPFAATSIPYVLLNTVFPTIGGAPIHLYDPKQPLDGMSPYILTVQCAFFLFVSLLMYIRGVKRDRKKYRRRLQKRDRCRKTF
>NZ_CP010322.1|WP_003170543.1|4004778_4005132_+|hypothetical-protein
MQAQLNGKLMNQLAIFFSTIVMLQFIADVTGFTQNLDITYNLIHTAASYITFSLAVIFTLIGARRELSKYAIISLCLVVGIKAKGSLFYGDWLARRKRIVNKPLISKIVRKLEVYYT
>NZ_CP010322.1|WP_000279249.1|4002260_4004627_+|endonuclease
MAVKKLLSVFLSFILLLSFTGTLVQAEETTSMSVEKAIQVFKQQGKTKGTVEGYIVGYTQSPSKYTKDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRAAVNVKDHPENIGKKVSLTGTLELYFSSPGLKSVTAHKFQGEEQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIIVNENSVMKAIAEKEGLTSSPISTFSFVIVNNEPVRIHDIQGKSHLSPYNGKKVYNVEGVVTALDKNGFYIEDNQPDNDPATSEGMYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFETDLTTTEIKASRVAVIAKDQPLPAPIVLGENGVKIPDQIIDNDAFGLFDPNEDAIDFYESVEGMRVTMPTPKIIAPQKNGNLYVTVKNGGNKVVTKYGTPVLDENQLNPERLSVKVPRDYVAKVGDTFTGDIIGVVGYDYGSFRIAPITELPSVVDGGFKQIGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGTVNDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNLDGGAPGANIRVGFFYNPSRVKLATVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNLVVVANHLNSKIGDATPFGKVQPLVLKSEEKRVQLAQEVNNFVQGIQKKNTNAPVVVLGDMNDFEFAKPLKTLEGTILKNMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNTNIMKEHGRVSDHDPVLAQIDLKKAS
>NZ_CP010322.1|WP_000453710.1|4000667_4002020_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLENIATKVDELKIVYSDETSLIVELHMDNKVIPYELHIDETDDPEEYKLYNRQDSTIVDRSFEDAAYGTEIFTRTLFVGDVLNCFFQQLQFLWNLAPDLLFVIDSSAAMKVISRNYIEYHVENELLPDIPDLYVIHSVYEDDKEGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGIGDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPISAQNTFLGGMDDRDEYHQSPSVLLFKFDTSEEYIESFFKEHEEATGLMFYKTNSETARMAYNAKNTFGYFSNIFQIEQSNEEFRFLAKFGVSYEEGKSEHMWFEMQHITEEFIQGILINEPYFIEDMSEGNSYHLDFDDLTEWVIYAGDAVIKPNNLYMFIGE
>NZ_CP010322.1|WP_001228080.1|3999206_4000628_+|protoporphyrinogen-oxidase
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMHEGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNIPSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRPGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTVVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
>NZ_CP010322.1|WP_000726793.1|3998251_3999187_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEKRLNEVQDEVEYHMYLGLKHIEPFIEDAVKEMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKSIYSGMSDAEREKAVLIVSAHSLPEKIIAMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKYGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVVKKKESVM
>NZ_CP010322.1|WP_000252599.1|3997190_3998237_+|uroporphyrinogen-decarboxylase
MVRTINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALIDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMERIFAEVRTMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKAVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK
>NZ_CP010322.1|WP_003158412.1|4012253_4012469_+|hypothetical-protein
MMKGNLTYYFILNPLIIFLVYALSPILFHKEKYINMKDALGILVVYYVLISGYCLMDVVSERMKKDSKDKQ
>NZ_CP010322.1|WP_000140275.1|4012505_4012811_+|DUF2087-domain-containing-protein
MTESEMKFRDATIRNFFDKEDRLKSIPGQKKKKLVLLEHLISKLNAANQYTEKEMNTFIKQYHDDFCTIRREFIVHGFMDREANMYHINGREVWTKWEELK
>NZ_CP010322.1|WP_001068232.1|4012837_4013191_-|PlcR-regulated-protein-PRP2
MNPILTTAKQLLHKEETILSTLNCSLTGYMITYNVPYPGMLLTTNRRLLFFSQYKNTLIAEFDYEKILSIETKRRIFDKKIIFYYEDEYITLGYITSSNIEEFIDLLRRKCKISTNS
>NZ_CP010322.1|WP_000620028.1|4013324_4013828_+|GNAT-family-N-acetyltransferase
MIRLAKETDAEAIMDIRKEIILSKTTTKFFIVSPKKLPNDTNAEREKIRKSNEKGNLYIVYEIDNKVVGFLLFNRYELDRLRHAGTMGIKEAYCNQGIGTKLIEFLIRWAKEQNGLEKICLGVVSVNDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYID
>NZ_CP010322.1|WP_000103719.1|4014065_4015043_+|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLEQGYRNLIFCRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAAGIISEAKRHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLV
>NZ_CP010322.1|WP_000567010.1|4015118_4015247_-|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NZ_CP010322.1|WP_000784654.1|4015426_4016161_+|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
>NZ_CP010322.1|WP_000897260.1|4016170_4017160_+|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCVKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTEPVTKALGKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEEMTTEEFRQLLLETIFEGETEIPTYELTEEDWKEIHKLSEERYRNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTTALEGVDIARYFGNITTEDFLHLFF
>NZ_CP010322.1|WP_000832626.1|4017414_4017843_+|lipoprotein
MKRVMYVVLLLSFVIGMTACNDETSSSRTLLSIGKPAKDNVIYFTHTDNKRKIQEIQDMFQNKKWKRNETFSTVNKTPDVVFSIDEDNTGLPALYVTVYFHEDGADVLNLYGEYTSFNKQELAMLREKMSAYYPKMIFGLVS
>NZ_CP010322.1|WP_001055163.1|4018004_4019537_+|fatty-acid--CoA-ligase-family-protein
MNLVQSLAETAKKKGDKPAYIFMDQSVSYDQLNKMVTRFSSNLAEMGIGKGDNVALVVGNSPHFLVGLYGTMKAGATVIPVNPIYTADEMHYILQNGDVKTIIVLDVLLPVIQSLTTRLPSLENIIICETSSDFNHTETEKMKTFTRMIGAGDLTYEGPELDEEDVAVILYTSGTTGKPKGAMLTHKNLYSNASDVASYLQYTADDRVVAALPMFHVFCLTVAVNAPIVNGATILMLPKFSPKEVFRICRTYEPTIFAGVPTMYNYLYLFEEASAEDVKTLRLCISGGASMPVALLQNFEKRFDVIVSEGYGLSEASPVTCFNPLDRPRKPGSIGTNIWHVENKIVNELGEEVPVGAVGELIVRGPNVMKGYYNAPEDTAATLKDGWLYTGDLAKMDEEGYFYIVDRKKDIVLVGGYNVYPREVEEVLYMHESVAEVVVIGVPDENLGEAVRAYVVLKQTNVTEEELMHYCTLHLAKYKVPKSIEFLTELPKNTTGKLLRRALREKAMQV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010322_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010322_5

4122738-4122846

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010322_5

>merge|NZ_CP010322|5|4122738-4122846|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>NZ_CP010322|5|5|4122738-4122846|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010322.1\|WP_000191105.1\|4118562_4119141_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP010322.1\|WP_000799204.1\|4111819_4113364_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP010322.1\|WP_001081482.1\|4119677_4120316_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP010322.1\|WP_000427734.1\|4125734_4126670_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP010322.1\|WP_042512038.1\|4120334_4121132_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP010322.1\|WP_001180010.1\|4119287_4119647_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010322.1\|WP_000872719.1\|4123617_4124358_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP010322.1\|WP_000428856.1\|4127571_4128417_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP010322.1\|WP_000043389.1\|4117983_4118382_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP010322.1\|WP_001079110.1\|4121147_4122041_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP010322.1\|WP_000350710.1\|4111063_4111747_+\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NZ_CP010322.1\|WP_000651510.1\|4132129_4132810_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP010322.1\|WP_001012321.1\|4126676_4127444_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP010322.1\|WP_001087866.1\|4130744_4131434_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP010322.1\|WP_000003398.1\|4114741_4116568_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP010322.1\|WP_000069709.1\|4128539_4129328_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP010322.1\|WP_001271203.1\|4131430_4132117_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP010322.1\|WP_000932923.1\|4129493_4130651_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP010322.1\|WP_000676166.1\|4132824_4133562_+\|NTP-transferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133019
NZ_CP010322.1\|WP_000360662.1\|4117090_4117984_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699

Protein	Function_ID	Function_description	E-value
NZ_CP010322.1\|WP_000191105.1\|4118562_4119141_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NZ_CP010322.1\|WP_000799204.1\|4111819_4113364_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP010322.1\|WP_001081482.1\|4119677_4120316_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP010322.1\|WP_000427734.1\|4125734_4126670_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.94506e-22
NZ_CP010322.1\|WP_042512038.1\|4120334_4121132_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP010322.1\|WP_000872719.1\|4123617_4124358_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP010322.1\|WP_000428856.1\|4127571_4128417_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	7.45097e-148
NZ_CP010322.1\|WP_000043389.1\|4117983_4118382_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	3.57374e-69
NZ_CP010322.1\|WP_001079110.1\|4121147_4122041_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.12116e-100
NZ_CP010322.1\|WP_000350710.1\|4111063_4111747_+\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	1.59388e-85
NZ_CP010322.1\|WP_000651510.1\|4132129_4132810_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	6.29242e-108
NZ_CP010322.1\|WP_001012321.1\|4126676_4127444_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.59471e-20
NZ_CP010322.1\|WP_001087866.1\|4130744_4131434_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.33577e-17
NZ_CP010322.1\|WP_000003398.1\|4114741_4116568_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP010322.1\|WP_000069709.1\|4128539_4129328_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	2.52342e-19
NZ_CP010322.1\|WP_001271203.1\|4131430_4132117_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.87129e-112
NZ_CP010322.1\|WP_000932923.1\|4129493_4130651_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.23257e-54
NZ_CP010322.1\|WP_000676166.1\|4132824_4133562_+\|NTP-transferase-domain-containing-protein	gnl\|CDD\|133019	cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase. This family is the short form of glucose-1-phosphate thymidylyltransferase. Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form. The homotetrameric, feedback inhibited short form is found in numerous bacterial species that produce dTDP-L-rhamnose. The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced.	8.19333e-130
NZ_CP010322.1\|WP_000360662.1\|4117090_4117984_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	1.47887e-91

>NZ_CP010322.1|WP_001079110.1|4121147_4122041_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLPSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHLAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFAAMIPSDMQEVLRQT
>NZ_CP010322.1|WP_042512038.1|4120334_4121132_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGNKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP010322.1|WP_001081482.1|4119677_4120316_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP010322.1|WP_001180010.1|4119287_4119647_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP010322.1|WP_000191105.1|4118562_4119141_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP010322.1|WP_000043389.1|4117983_4118382_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP010322.1|WP_000360662.1|4117090_4117984_-|DsbA-family-protein
MDKQEAKHINMPSPSACEYKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSYDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPSLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP010322.1|WP_000003398.1|4114741_4116568_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSTSSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP010322.1|WP_000799204.1|4111819_4113364_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP010322.1|WP_000350710.1|4111063_4111747_+|adaptor-protein-MecA
MDIERINDHTMKFFITYIDIEDRGFNREEIWYDRERSEELFWEMMDEARDHDDFFIDGPLWIQVQAVDKGIEVLVTKAELSKDGQKLELPIGVDKIIDIPLDEGIESLFQQELVEEVEEQAGTNFNEDGTFGFLIKFNDFEDVISLSHRLIFEDIKDELYSFEDRYYVYVEFDEVLHDEEEIDRILSIVLEYGEESTLTIHRVSEYGKQIVKEHALETIRNNFPAKT
>NZ_CP010322.1|WP_000872719.1|4123617_4124358_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHILDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP010322.1|WP_000427734.1|4125734_4126670_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQDIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP010322.1|WP_001012321.1|4126676_4127444_-|class-I-SAM-dependent-methyltransferase
MNFWNENKKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP010322.1|WP_000428856.1|4127571_4128417_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRVGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP010322.1|WP_000069709.1|4128539_4129328_-|hypothetical-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP010322.1|WP_000932923.1|4129493_4130651_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQDAVAAGEELSPRDLFYYANECMDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGLWEKAVESCVKSFRYAIPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSIFDQQKNRYRLFFLEIAYQDSNSNRLTI
>NZ_CP010322.1|WP_001087866.1|4130744_4131434_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMEMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSSL
>NZ_CP010322.1|WP_001271203.1|4131430_4132117_+|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLAVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMASQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP010322.1|WP_000651510.1|4132129_4132810_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTFLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS
>NZ_CP010322.1|WP_000676166.1|4132824_4133562_+|NTP-transferase-domain-containing-protein
MKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVEEFTNQKEGAKVLLQSVDDPERFGVANIQNRKIIEIEEKPKEPKSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHVSLQRANALARDINFGKQFNGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	KJ094023	Listeria phage LP-101, complete genome	3876-3902	4	0.852
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NC_022766	Bacillus phage Glittering, complete genome	9024-9050	5	0.815
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	1229260-1229286	6	0.778
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	438058-438084	6	0.778
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	127169-127195	6	0.778
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	1227597-1227623	6	0.778
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	850854-850880	6	0.778
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	513839-513865	6	0.778
NZ_CP010322_2	2.1\|815358\|27\|NZ_CP010322\|CRISPRCasFinder	815358-815384	27	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	498252-498278	6	0.778

1. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to KJ094023 (Listeria phage LP-101, complete genome) position: , mismatch: 4, identity: 0.852

cgtctttggctcttctggtttctcttc	CRISPR spacer
catttctggctcttctggtttcttttc	Protospacer
*.*.*.*****************.***

2. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NC_022766 (Bacillus phage Glittering, complete genome) position: , mismatch: 5, identity: 0.815

cgtctttggctcttctggtttctcttc	CRISPR spacer
gttcaatggctcttctggtttctcatc	Protospacer
  **  ****************** **

3. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

4. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

5. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctgt	Protospacer
*.   ******************** .

6. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

7. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

8. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

9. spacer 2.1|815358|27|NZ_CP010322|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctgt	Protospacer
*.   ******************** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1149339 : 1200103

Bacillus_phage(33.33%)

capsid,holin,protease,tail,terminase,head,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000872358.1\|1149339_1149705_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_000578959.1\|1149701_1150379_+	LrgB family protein	NA	NA	NA	NA
WP_042512006.1\|1150391_1150805_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000624202.1\|1150946_1151147_+	DUF3903 domain-containing protein	NA	NA	NA	NA
WP_000644411.1\|1152328_1152475_-	BC1881 family protein	NA	NA	NA	NA
WP_003156899.1\|1152639_1154367_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	8.1e-40	55.0
WP_025388430.1\|1154582_1155131_-	hypothetical protein	NA	NA	NA	NA
WP_000386809.1\|1155155_1156175_-	NERD domain-containing protein	A0A1L2JY40	Aeribacillus_phage	4.3e-25	27.2
WP_000136731.1\|1156293_1158057_-	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.2e-27	25.9
WP_000862474.1\|1158056_1159808_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.1e-47	28.5
WP_001123317.1\|1159931_1160153_-	YneF family protein	NA	NA	NA	NA
WP_000860645.1\|1160231_1160672_-	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_000019755.1\|1160828_1162829_-	transketolase	NA	NA	NA	NA
WP_000166240.1\|1163228_1164341_-	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	2.0e-79	44.7
WP_000047908.1\|1164639_1165443_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_001000752.1\|1165442_1166237_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_000569256.1\|1166233_1167007_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.6e-11	27.5
WP_000913375.1\|1167090_1168029_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000948565.1\|1169836_1170076_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_000991465.1\|1170121_1170778_-	recombinase family protein	NA	NA	NA	NA
WP_000413738.1\|1170919_1171540_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
WP_000976114.1\|1171627_1172434_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000032394.1\|1172434_1172977_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_001102618.1\|1172969_1173293_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000721300.1\|1174029_1174179_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_000448299.1\|1174175_1175264_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.0e-49	35.9
WP_000276346.1\|1175628_1175856_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	6.2e-25	84.3
WP_000119488.1\|1176567_1176900_+	hypothetical protein	A0A1C8E989	Bacillus_phage	4.1e-25	60.0
WP_000384930.1\|1177068_1177308_-	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	5.9e-34	96.2
WP_000405763.1\|1177857_1178790_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	8.2e-156	84.2
WP_000373878.1\|1178789_1179215_-\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	1.8e-70	98.6
WP_000077308.1\|1179326_1179602_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P7E8	Bacillus_phage	6.8e-34	78.8
WP_000012948.1\|1179619_1181626_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	5.6e-101	48.0
WP_001260144.1\|1181701_1184353_-	hypothetical protein	H0USX5	Bacillus_phage	5.8e-223	73.8
WP_000807257.1\|1185871_1188256_-	hypothetical protein	D2XR26	Bacillus_phage	2.1e-09	60.3
WP_000897052.1\|1188521_1189769_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.5e-181	83.8
WP_000415949.1\|1189989_1190361_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	4.7e-46	73.9
WP_001293690.1\|1190365_1190959_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.3e-92	84.1
WP_000172077.1\|1190959_1191289_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	1.1e-46	81.7
WP_000065124.1\|1191285_1191642_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	2.7e-30	60.3
WP_000997895.1\|1191634_1191934_-\|head	phage head closure protein	R9TPZ2	Paenibacillus_phage	1.7e-09	38.3
WP_000979030.1\|1191930_1192203_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	6.5e-21	58.4
WP_000015463.1\|1192205_1192496_-	hypothetical protein	A6XMJ7	Bacillus_virus	4.8e-06	36.6
WP_000854835.1\|1192532_1193696_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	3.2e-80	54.7
WP_001043897.1\|1193709_1194294_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.0e-39	50.5
WP_000522228.1\|1194259_1195471_-\|portal	phage portal protein	J9QE83	Clostridium_phage	1.1e-139	60.7
WP_001222618.1\|1195486_1197175_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.9e-251	73.0
WP_000985231.1\|1197171_1197543_-	hypothetical protein	A0A2H4JA84	uncultured_Caudovirales_phage	3.3e-15	50.0
WP_001051274.1\|1197708_1198005_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	2.7e-28	61.5
WP_000109237.1\|1198769_1199192_+	pilus biosynthesis protein HicB	A0A1L2JY34	Aeribacillus_phage	6.8e-41	59.1
WP_001228882.1\|1199278_1199704_-	hypothetical protein	NA	NA	NA	NA
WP_003159543.1\|1199824_1200103_-	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.5e-09	43.8

DBSCAN-SWA_2

1212441 : 1223995

Bacillus_phage(66.67%)

integrase

attL 1206534:1206550|attR 1230330:1230346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1206534:1206550	attL	NA	NA	NA	NA
WP_000520475.1\|1212441_1212726_-	hypothetical protein	A6M999	Geobacillus_virus	1.8e-34	72.0
WP_000382673.1\|1213120_1213879_-	FAD-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	1.0e-79	62.1
WP_000286272.1\|1214110_1214890_-	DNA methylase	A0A0K2CYZ1	Paenibacillus_phage	3.6e-64	49.0
WP_000615365.1\|1214904_1215477_-	dUTPase	A0A0A7AQI4	Bacillus_phage	3.4e-80	73.8
WP_000553935.1\|1215571_1215694_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_000861089.1\|1215696_1216326_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	1.3e-27	41.9
WP_001229822.1\|1216510_1217341_-	ATP-binding protein	U5PWH5	Bacillus_phage	1.7e-35	38.4
WP_000067428.1\|1217276_1218035_-	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	3.6e-61	54.9
WP_000849734.1\|1218031_1218304_-	hypothetical protein	A0A0M4S680	Bacillus_phage	2.9e-37	82.0
WP_001002737.1\|1218317_1218989_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	1.0e-27	45.8
WP_000780695.1\|1218985_1219468_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	1.1e-34	48.1
WP_000897921.1\|1219482_1219746_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	2.9e-10	61.1
WP_000510717.1\|1219717_1220035_-	hypothetical protein	NA	NA	NA	NA
WP_000483549.1\|1220185_1220452_-	hypothetical protein	S5MC08	Brevibacillus_phage	1.1e-25	55.8
WP_000572505.1\|1220560_1221289_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	3.1e-49	48.6
WP_000877760.1\|1221285_1221486_-	helix-turn-helix transcriptional regulator	A0A0C5AJQ3	Paenibacillus_phage	1.4e-09	52.6
WP_000060654.1\|1221761_1222175_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	5.1e-25	47.1
WP_000673782.1\|1222197_1222626_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.8e-34	55.1
WP_003169928.1\|1222850_1223321_+\|integrase	integrase	A0A0S2SXS9	Bacillus_phage	3.5e-38	55.2
WP_003171984.1\|1223365_1223995_+\|integrase	site-specific integrase	A0A0S2SXP1	Bacillus_phage	2.1e-54	60.3
1230330:1230346	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1430409 : 1506601

Bacillus_phage(92.31%)

capsid,holin,protease,tRNA,tail,terminase,head,portal,integrase

attL 1463807:1463823|attR 1508392:1508408

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000455959.1\|1430409_1433175_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	1.0e-84	27.9
WP_001131611.1\|1433522_1434029_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000029720.1\|1434118_1434886_-	RNA-binding protein	NA	NA	NA	NA
WP_000450918.1\|1434901_1435165_-	YggT family protein	NA	NA	NA	NA
WP_000119134.1\|1435171_1435642_-	cell division protein SepF	NA	NA	NA	NA
WP_000218170.1\|1435661_1436336_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001209023.1\|1436332_1437151_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_002054579.1\|1437267_1437552_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000197753.1\|1437720_1438500_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_000976948.1\|1438657_1439377_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000261986.1\|1439396_1440314_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888988.1\|1440626_1441787_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087554.1\|1441826_1443128_-	cell division protein FtsA	NA	NA	NA	NA
WP_000798221.1\|1443500_1444298_-	cell division protein DivIB	NA	NA	NA	NA
WP_000437058.1\|1444396_1445302_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001265416.1\|1445363_1446458_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753510.1\|1446563_1447655_-	stage V sporulation protein E	NA	NA	NA	NA
WP_000860119.1\|1447745_1449098_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000893056.1\|1449098_1450073_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_000766304.1\|1450095_1451571_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_001266229.1\|1451779_1453696_-	stage V sporulation protein D	NA	NA	NA	NA
WP_000600091.1\|1453777_1455877_-	penicillin-binding protein	NA	NA	NA	NA
WP_000067081.1\|1455949_1456312_-	cell division protein FtsL	NA	NA	NA	NA
WP_000481786.1\|1456327_1457260_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_000403057.1\|1457630_1459247_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000782401.1\|1459326_1460217_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000506700.1\|1460591_1461065_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246476.1\|1461099_1461606_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	3.0e-11	34.7
WP_001984764.1\|1461735_1461909_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_000872145.1\|1461970_1462471_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_000473516.1\|1462887_1463484_+	hypothetical protein	A0A0U3TZ58	Bacillus_phage	1.4e-68	74.2
WP_001025814.1\|1463516_1464140_-	hypothetical protein	H0USY2	Bacillus_phage	1.1e-98	83.4
1463807:1463823	attL	NA	NA	NA	NA
WP_000891435.1\|1464081_1465263_-	cell division protein FtsK	H0USY1	Bacillus_phage	2.5e-186	81.4
WP_000170771.1\|1465378_1465561_-	hypothetical protein	A0A288WGN6	Bacillus_phage	1.8e-22	90.0
WP_001267635.1\|1465563_1465866_-	hypothetical protein	Q2I8E3	Bacillus_phage	6.3e-49	97.0
WP_000394503.1\|1466049_1466256_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	3.2e-20	72.1
WP_000044279.1\|1466259_1466442_+	hypothetical protein	A0A288WFV9	Bacillus_phage	1.3e-12	81.6
WP_000043395.1\|1466447_1467029_+	type IV secretory system conjugative DNA transfer family protein	H0USX9	Bacillus_phage	7.3e-102	93.2
WP_000405801.1\|1467092_1467797_-	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	1.4e-112	82.9
WP_000373868.1\|1467796_1468222_-\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	7.5e-72	99.3
WP_000822829.1\|1468226_1469195_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	1.5e-168	91.2
WP_000064510.1\|1469350_1469626_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	2.2e-32	77.4
WP_003168956.1\|1469650_1471756_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	4.5e-186	59.0
WP_001260159.1\|1471752_1473735_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	4.5e-268	76.9
WP_000094081.1\|1473731_1475213_-\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	4.4e-260	86.8
WP_000938714.1\|1480279_1480420_-	hypothetical protein	A0A1B1P7R9	Bacillus_phage	3.8e-17	93.5
WP_001157374.1\|1480421_1480832_-	hypothetical protein	A0A1B1P7S9	Bacillus_phage	2.6e-45	80.2
WP_000952019.1\|1480891_1481476_-\|tail	tail protein	A0A1B1P7S4	Bacillus_phage	7.5e-107	99.5
WP_001211423.1\|1481489_1481849_-	hypothetical protein	A0A1B1P7S7	Bacillus_phage	2.8e-64	99.2
WP_000852724.1\|1481845_1482283_-	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	2.3e-76	98.6
WP_001069939.1\|1482270_1482618_-\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	4.8e-61	99.1
WP_000891190.1\|1482604_1482880_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	2.3e-42	97.8
WP_073806362.1\|1482888_1483188_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_000782638.1\|1483165_1484353_-\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	2.0e-207	94.4
WP_000517633.1\|1484349_1485105_-\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	2.1e-133	95.6
WP_000767173.1\|1485082_1486297_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	3.1e-219	92.6
WP_000633619.1\|1486312_1488085_-\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.0
WP_000357495.1\|1488065_1488446_-\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
WP_000049754.1\|1488607_1488970_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	3.0e-61	94.2
WP_000166213.1\|1488962_1489178_-	hypothetical protein	NA	NA	NA	NA
WP_000291405.1\|1489565_1490387_-	nucleotide-binding protein	NA	NA	NA	NA
WP_001028524.1\|1490660_1491203_-\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	3.3e-88	88.9
WP_001041477.1\|1491199_1491670_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	2.9e-48	62.5
WP_000125775.1\|1491975_1492098_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000937292.1\|1492115_1492445_-	hypothetical protein	NA	NA	NA	NA
WP_000657899.1\|1492478_1492835_-	hypothetical protein	NA	NA	NA	NA
WP_000064524.1\|1492852_1493101_-	helix-turn-helix transcriptional regulator	A0A0S2MV80	Bacillus_phage	2.0e-37	95.1
WP_000360763.1\|1493220_1493499_-	hypothetical protein	NA	NA	NA	NA
WP_000111532.1\|1493535_1493742_-	hypothetical protein	NA	NA	NA	NA
WP_000065132.1\|1494487_1494994_-	hypothetical protein	A0A0M4RU27	Bacillus_phage	3.5e-84	85.7
WP_000938987.1\|1495330_1495750_+	fosfomycin resistance bacillithiol transferase FosB2	Q2LI91	Bacillus_phage	4.0e-62	95.2
WP_001263811.1\|1496374_1496605_-	hypothetical protein	Q2LI93	Bacillus_phage	9.7e-34	100.0
WP_000776935.1\|1496630_1497077_-	dUTP diphosphatase	A0A1B1P7U8	Bacillus_phage	1.9e-70	90.5
WP_000656565.1\|1497143_1497338_-	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.0e-28	98.4
WP_000360818.1\|1497321_1497465_-	Fur-regulated basic protein FbpA	A0A1B1P7V2	Bacillus_phage	2.1e-18	100.0
WP_000502161.1\|1497473_1498418_-	sigma-70 family RNA polymerase sigma factor	A0A0U3TKA0	Bacillus_phage	3.1e-171	99.4
WP_000124862.1\|1498456_1498744_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	1.5e-44	100.0
WP_000811862.1\|1498756_1499011_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	3.1e-41	97.6
WP_000805161.1\|1499025_1499199_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	98.2
WP_000332457.1\|1499224_1499419_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.4e-30	95.3
WP_003172191.1\|1499434_1500238_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	3.0e-146	99.3
WP_000190234.1\|1500206_1500923_-	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	1.6e-106	93.1
WP_000284332.1\|1501354_1501555_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_000516834.1\|1501606_1501834_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000153814.1\|1502053_1502422_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
WP_001045400.1\|1502845_1503943_-	hypothetical protein	NA	NA	NA	NA
WP_001091283.1\|1504378_1504723_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	9.5e-17	38.4
WP_000844352.1\|1504949_1505138_-	hypothetical protein	NA	NA	NA	NA
WP_000323197.1\|1505470_1506601_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	1.4e-64	39.1
1508392:1508408	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2534491 : 2576724

Staphylococcus_phage(26.67%)

capsid,holin,protease,tRNA,terminase,head,portal,integrase

attL 2524868:2524883|attR 2579175:2579190

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2524868:2524883	attL	NA	NA	NA	NA
WP_001021109.1\|2534491_2535751_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	2.0e-88	42.4
WP_001057089.1\|2536115_2537033_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_000573649.1\|2537421_2537817_-	SET domain-containing protein	NA	NA	NA	NA
WP_000455036.1\|2537983_2539486_-	DUF4077 domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.3e-08	27.0
WP_000734853.1\|2539511_2540570_-	endonuclease	NA	NA	NA	NA
WP_003159489.1\|2540860_2541295_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000568602.1\|2541291_2541648_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000980962.1\|2541675_2541915_-	DUF3947 family protein	NA	NA	NA	NA
WP_003159494.1\|2541993_2542209_-	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_000076824.1\|2542366_2542882_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_000834704.1\|2543025_2543430_-	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_000635749.1\|2543479_2544442_-	NERD domain-containing protein	NA	NA	NA	NA
WP_001036602.1\|2544877_2545843_+	DUF4822 domain-containing protein	NA	NA	NA	NA
WP_000590068.1\|2546067_2546820_-	siderophore ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_000631132.1\|2546816_2547881_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_000042061.1\|2547877_2548894_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.3e-58	37.1
WP_000753441.1\|2548913_2549927_-	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001250248.1\|2550341_2551019_-	response regulator transcription factor	NA	NA	NA	NA
WP_001123905.1\|2551907_2552375_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.4e-47	61.3
WP_000391091.1\|2552623_2555050_-	ribonuclease R	Q0GXV6	Lactococcus_phage	9.8e-92	41.2
WP_000761977.1\|2555192_2555933_-	carboxylesterase	NA	NA	NA	NA
WP_000557262.1\|2556094_2556328_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000078306.1\|2556422_2557115_-	LrgB family protein	NA	NA	NA	NA
WP_000673222.1\|2557111_2557480_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_001125043.1\|2557755_2558706_+	nucleoside hydrolase	NA	NA	NA	NA
WP_000422852.1\|2559193_2559706_-	hypothetical protein	NA	NA	NA	NA
WP_000711928.1\|2559863_2560322_-	hypothetical protein	NA	NA	NA	NA
WP_000639551.1\|2560738_2561548_-	endonuclease	B3GVX7	Streptococcus_phage	1.4e-13	41.9
WP_000142503.1\|2561722_2562352_-	hypothetical protein	NA	NA	NA	NA
WP_000817546.1\|2562539_2562890_-	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_001003949.1\|2563034_2563511_+	hypothetical protein	NA	NA	NA	NA
WP_000660592.1\|2563749_2563962_-	hypothetical protein	NA	NA	NA	NA
WP_001008127.1\|2563967_2564213_-	helix-turn-helix domain-containing protein	A0A290FZJ4	Caldibacillus_phage	3.9e-09	39.5
WP_000823894.1\|2564209_2564455_-	hypothetical protein	NA	NA	NA	NA
WP_000502531.1\|2564607_2564811_+	hypothetical protein	NA	NA	NA	NA
WP_000811954.1\|2564829_2565567_+	hypothetical protein	NA	NA	NA	NA
WP_001001289.1\|2565977_2566169_+	hypothetical protein	NA	NA	NA	NA
WP_000900865.1\|2566265_2566853_+	hypothetical protein	NA	NA	NA	NA
WP_003159006.1\|2566845_2568417_+\|terminase	terminase	W5RV59	Staphylococcus_phage	1.5e-48	25.4
WP_003158948.1\|2568471_2568960_+	HNH endonuclease	A0A1G5SA96	Enterococcus_phage	5.5e-18	38.9
WP_000522484.1\|2569376_2570687_+\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	1.8e-71	37.7
WP_003159003.1\|2570658_2571156_+\|head,protease	HK97 family phage prohead protease	A0A060AB24	Staphylococcus_phage	5.2e-40	52.5
WP_003159030.1\|2571215_2572256_+\|capsid	phage major capsid protein	A0A1G5SCB8	Enterococcus_phage	1.3e-45	37.6
WP_000168836.1\|2572342_2573323_+\|capsid	phage major capsid protein	A0A1I9KK60	Lactobacillus_phage	4.5e-11	26.4
WP_000348695.1\|2573390_2574257_-	hypothetical protein	NA	NA	NA	NA
WP_000910235.1\|2574379_2575285_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	7.8e-18	27.1
WP_000103949.1\|2575428_2576724_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	6.4e-183	75.4
2579175:2579190	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3204006 : 3211955

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|3204006_3204291_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001030000.1\|3204329_3205964_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.5e-157	58.0
WP_000743900.1\|3206371_3207910_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.6e-21	31.2
WP_000833093.1\|3208294_3209620_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_000929883.1\|3209764_3210466_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_000719201.1\|3210449_3211955_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	1.6e-31	29.1

DBSCAN-SWA_6

3242973 : 3251350

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625683.1\|3242973_3244281_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
WP_001170540.1\|3244369_3245089_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
WP_000278820.1\|3245081_3245336_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|3245332_3246016_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055577.1\|3245999_3248219_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000879029.1\|3248203_3249619_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_001262436.1\|3249725_3250766_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000088592.1\|3250762_3251350_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1

DBSCAN-SWA_7

3391860 : 3422530

Bacillus_phage(67.5%)

capsid,protease,terminase,tail,head,integrase

attL 3396202:3396217|attR 3410866:3410881

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000615205.1\|3391860_3393240_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.0e-85	38.3
WP_000679460.1\|3393300_3394425_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	1.2e-188	85.8
WP_001215552.1\|3395140_3395485_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	7.2e-33	61.3
WP_000266075.1\|3396019_3397195_+	hypothetical protein	A0A1B0T6A5	Bacillus_phage	6.3e-52	33.0
3396202:3396217	attL	NA	NA	NA	NA
WP_000721631.1\|3397212_3397359_+	hypothetical protein	NA	NA	NA	NA
WP_000142636.1\|3397688_3398030_-	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	1.2e-16	41.2
WP_001059685.1\|3398204_3398426_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001072732.1\|3398443_3399175_+	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	1.5e-125	91.8
WP_000798614.1\|3399219_3399570_+	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	3.9e-50	79.3
WP_000969633.1\|3399566_3399734_+	hypothetical protein	A0A0U3B230	Bacillus_phage	2.0e-20	92.5
WP_000364231.1\|3399763_3399949_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	2.7e-18	70.7
WP_001067134.1\|3399945_3400818_+	DnaD domain protein	A0A0S2GLI6	Bacillus_phage	1.0e-51	61.7
WP_003160855.1\|3400786_3401590_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	1.1e-145	99.2
WP_000337980.1\|3401605_3401800_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.3e-26	87.5
WP_000805172.1\|3401824_3401998_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	3.6e-25	96.5
WP_000811865.1\|3402012_3402267_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	2.0e-40	96.4
WP_000483329.1\|3402278_3402695_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	1.4e-14	43.0
WP_001024288.1\|3402710_3403175_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	7.2e-20	47.7
WP_001057640.1\|3403212_3403392_+	hypothetical protein	A0A1B1P8C9	Bacillus_phage	7.5e-26	93.2
WP_001022835.1\|3403440_3403725_+	hypothetical protein	G9B1P0	Bacillus_phage	4.9e-11	58.5
WP_000455714.1\|3403924_3404524_+	hypothetical protein	A0A0S2SXN5	Bacillus_phage	9.3e-44	45.6
WP_000860615.1\|3405136_3405541_+	hypothetical protein	D0R7I0	Paenibacillus_phage	1.3e-12	52.8
WP_000391264.1\|3405540_3405987_+	hypothetical protein	A0A0A7AQW7	Bacillus_phage	1.7e-58	72.3
WP_000537039.1\|3406027_3406210_+	hypothetical protein	A0A218KC21	Bacillus_phage	2.2e-17	74.1
WP_000219385.1\|3406241_3406616_+	hypothetical protein	NA	NA	NA	NA
WP_000048714.1\|3406721_3407078_+	hypothetical protein	NA	NA	NA	NA
WP_000358037.1\|3407105_3407294_+	hypothetical protein	G9J1S8	Bacillus_phage	1.5e-08	50.8
WP_000803283.1\|3407298_3407421_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000166181.1\|3407734_3408217_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.1e-71	83.1
WP_001012163.1\|3408216_3408510_+\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	1.8e-40	86.6
WP_000323577.1\|3408537_3408759_+\|integrase	tyrosine-type recombinase/integrase	A0A0S2GLG4	Bacillus_phage	1.4e-34	100.0
WP_001051275.1\|3409347_3409650_+	hypothetical protein	R9TNN2	Paenibacillus_phage	1.6e-31	63.9
WP_003158839.1\|3409646_3409814_+	helix-turn-helix domain-containing protein	A0A142F1N8	Bacillus_phage	1.6e-09	62.2
WP_000157079.1\|3410057_3410429_+	hypothetical protein	R9TQ46	Paenibacillus_phage	5.1e-24	54.1
WP_001265992.1\|3410425_3412114_+\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.1e-243	71.2
3410866:3410881	attR	NA	NA	NA	NA
WP_000361707.1\|3413306_3413888_+\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	7.9e-32	44.1
WP_001031422.1\|3413906_3415097_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	1.0e-09	24.7
WP_001015363.1\|3415112_3415370_+	hypothetical protein	A6XMJ7	Bacillus_virus	1.1e-06	42.0
WP_000600951.1\|3415366_3415639_+	DNA-packaging protein	R9TMB7	Paenibacillus_phage	1.4e-18	52.8
WP_000997870.1\|3415635_3415935_+\|head	phage head closure protein	NA	NA	NA	NA
WP_000146467.1\|3415927_3416284_+	hypothetical protein	D2XR21	Bacillus_phage	6.5e-29	57.8
WP_000175566.1\|3416280_3416610_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.1e-41	76.1
WP_000428979.1\|3416610_3417180_+\|tail	phage tail protein	A0A0U4JWV5	Exiguobacterium_phage	7.2e-54	58.0
WP_000750962.1\|3417184_3417547_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.6e-28	50.8
WP_000233050.1\|3417788_3421724_+	tape measure protein	D2XR25	Bacillus_phage	1.5e-153	73.0
WP_000059860.1\|3421720_3422530_+\|tail	phage tail family protein	A0A290FZP5	Caldibacillus_phage	3.6e-59	44.5

DBSCAN-SWA_8

3426418 : 3430644

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000680533.1\|3426418_3428392_+	hypothetical protein	A0A2H4JG80	uncultured_Caudovirales_phage	2.4e-165	60.6
WP_001193271.1\|3428428_3428908_+	hypothetical protein	A0A2H4J980	uncultured_Caudovirales_phage	1.1e-52	84.4
WP_000818882.1\|3429002_3429242_+	peptidase	A0A1B1P7E0	Bacillus_phage	8.0e-31	86.1
WP_110925518.1\|3429254_3429458_+	hypothetical protein	D2XR32	Bacillus_phage	1.3e-29	100.0
WP_000509854.1\|3429457_3430255_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.4e-109	68.7
WP_000050925.1\|3430308_3430644_-	hypothetical protein	A0A1C8E989	Bacillus_phage	6.2e-21	52.7

DBSCAN-SWA_9

4783887 : 4792620

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755532.1\|4783887_4785150_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	4.4e-11	31.5
WP_001194297.1\|4785248_4786013_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_014654523.1\|4788093_4788780_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.2e-117	93.0
WP_001231513.1\|4788776_4789850_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	2.3e-170	88.2
WP_000823558.1\|4789874_4790462_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|4790657_4791377_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_003158174.1\|4791493_4791607_+	hypothetical protein	W8CYT3	Bacillus_phage	1.6e-05	95.8
WP_001258491.1\|4791747_4792620_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.9e-66	45.9

DBSCAN-SWA_10

5101798 : 5108922

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000249923.1\|5101798_5103004_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	1.4e-51	47.4
WP_000669607.1\|5103185_5104337_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000810464.1\|5104537_5105671_+	ATPase	NA	NA	NA	NA
WP_000637733.1\|5105702_5106167_-	restriction endonuclease	Q331T5	Clostridium_botulinum_C_phage	1.2e-14	43.2
WP_000649834.1\|5106203_5106404_-	helix-turn-helix domain-containing protein	A0A288WG80	Bacillus_phage	9.0e-20	76.6
WP_001267637.1\|5106569_5106872_+	hypothetical protein	A0A288WG38	Bacillus_phage	3.1e-24	51.5
WP_000156980.1\|5106868_5107051_+	hypothetical protein	Q2I8E2	Bacillus_phage	2.4e-19	80.0
WP_000571537.1\|5107169_5108360_+	cell division protein FtsK	A0A288WFS1	Bacillus_phage	1.2e-148	64.4
WP_009879021.1\|5108337_5108922_+	hypothetical protein	A0A288WFQ7	Bacillus_phage	1.9e-81	77.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010320

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010320_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010320_1

66052-66373

Orphan

Consensus_repeat	Method
TTTTACACATTTACACATTTACACATTTACACATGTGTAAATT	CRT

3 spacers

The CRISPR arrays of NZ_CP010320_1

>merge|NZ_CP010320|1|66052-66373|CRT
TTTTACACATTTACACATTTACACATTTACACATGTGTAAATTACCTATAAATCCATTATATACCTTAAGCAATCCAACATCAATGTATATTTTACACATTTACACATTTACACATTTACACATTTACACAAATTTCGTGTTGAAATGATTCAGACCAGTGTTTATAGGGATTATAGTTTTTTTGTTGTGTACATTTACACATGTGTAAATGTACACATGTGTAAATTAAAAGATTGTACGTTTAATATAATAGAAGAGAGAGAGATGGAAAAAGAAAAATTTACACATTTACACATTTACACATTTACACATGTGTAAATT

>NZ_CP010320|1|1|66052-66373|CRT
TTTTACACATTTACACATTTACACATTTACACATGTGTAAATT	ACCTATAAATCCATTATATACCTTAAGCAATCCAACATCAATGTATA
TTTTACACATTTACACATTTACACATTTACACATTTACACAAA	TTTCGTGTTGAAATGATTCAGACCAGTGTTTATAGGGATTATAGTTTTTTTG
TTGTGTACATTTACACATGTGTAAATGTACACATGTGTAAATT	AAAAGATTGTACGTTTAATATAATAGAAGAGAGAGAGATGGAAAAAGAAAA
ATTTACACATTTACACATTTACACATTTACACATGTGTAAATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010320.1\|WP_001259529.1\|64334_64568_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_001099042.1\|66924_68463_+\|replication-initiation-protein-RepS	unknown	unknown	gnl\|CDD\|378031
NZ_CP010320.1\|WP_000331440.1\|74672_74909_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_000400406.1\|65153_66020_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP010320.1\|WP_000637483.1\|58829_59141_+\|heavy-metal-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|105987
NZ_CP010320.1\|WP_000517796.1\|68665_69430_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_003171333.1\|53563_53998_+\|undecaprenyl-diphosphatase	unknown	unknown	gnl\|CDD\|239480
NZ_CP010320.1\|WP_001092475.1\|74959_75289_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_001092802.1\|61530_63126_-\|amidase	unknown	unknown	gnl\|CDD\|119407
NZ_CP010320.1\|WP_001208167.1\|72185_72488_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375153
NZ_CP010320.1\|WP_000604768.1\|56940_57405_-\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|377367
NZ_CP010320.1\|WP_001015855.1\|73514_73703_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_000061608.1\|72994_73525_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_000064258.1\|64774_65161_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_000335298.1\|73799_74288_+\|DUF5512-family-protein	unknown	unknown	gnl\|CDD\|340346
NZ_CP010320.1\|WP_001009354.1\|58115_58781_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP010320.1\|WP_003159967.1\|59723_60053_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_000169642.1\|55973_56564_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP010320.1\|WP_009879813.1\|75414_78183_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010320.1\|WP_000249505.1\|71127_71310_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010320.1\|WP_001099042.1\|66924_68463_+\|replication-initiation-protein-RepS	gnl\|CDD\|378031	pfam08708, PriCT_1, Primase C terminal 1 (PriCT-1). This alpha helical domain is found at the C terminal of primases.	3.78357e-09
NZ_CP010320.1\|WP_000400406.1\|65153_66020_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	4.13842e-44
NZ_CP010320.1\|WP_000637483.1\|58829_59141_+\|heavy-metal-binding-domain-containing-protein	gnl\|CDD\|105987	PRK12856, PRK12856, hypothetical protein; Provisional.	9.6017e-48
NZ_CP010320.1\|WP_001009354.1\|58115_58781_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.03701e-10
NZ_CP010320.1\|WP_003171333.1\|53563_53998_+\|undecaprenyl-diphosphatase	gnl\|CDD\|239480	cd03385, PAP2_BcrC_like, PAP2_like proteins, BcrC_like subfamily. Several members of this family have been annotated as bacitracin transport permeases, as it was suspected that they form the permease component of an ABC transporter system. It was shown, however, that BcrC from Bacillus subtilis posesses undecaprenyl pyrophosphate (UPP) phospatase activity, and it is hypothesized that it competes with bacitracin for UPP, increasing the cell's resistance to bacitracin.	7.16549e-39
NZ_CP010320.1\|WP_000169642.1\|55973_56564_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.24865e-13
NZ_CP010320.1\|WP_001092802.1\|61530_63126_-\|amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	8.58823e-60
NZ_CP010320.1\|WP_001208167.1\|72185_72488_+\|hypothetical-protein	gnl\|CDD\|375153	pfam17362, pXO2-34, Family of unknown function. This is a family of unknown function found in Bacilli.	8.56948e-35
NZ_CP010320.1\|WP_000604768.1\|56940_57405_-\|DUF523-domain-containing-protein	gnl\|CDD\|377367	pfam04463, DUF523, Protein of unknown function (DUF523). Family of uncharacterized bacterial proteins.	5.51707e-58
NZ_CP010320.1\|WP_000335298.1\|73799_74288_+\|DUF5512-family-protein	gnl\|CDD\|340346	pfam17631, DUF5512, Family of unknown function (DUF5512). This is a family of unknown function found in Bacillus.	2.236e-90

>NZ_CP010320.1|WP_000400406.1|65153_66020_-|ParA-family-protein
MEHKRPLTITVANSKGGVGKSTIVRHLSYHLALKGYKVLTADMDPQANTTKTMILTRKRVNDEYFAFDKTLMRAVQDGSLENMQLNIIENLDLLPSHSDFENFESLLTSKFGHAETSDPNYHEIETNKINYFRNLLEPLKQNYDFIIIDSPPTASYYTKSSAMASDYVLVAFQTQSDSLDGANDYITRFLARLVEEYNAQLDVVGILPNQLHSAGKIDTTVLQDAKDIFGENNLFKNLIPYAKRIQSVPRIGLNVDQYWDKKLFNEVFEPFTDEFLERINKMEELRNE
>NZ_CP010320.1|WP_000064258.1|64774_65161_-|hypothetical-protein
MSNEQGKGMGFFGNKGKPASEKKDEKKTKLDLDYKPDLNPSTPYDPTLPVKATLVNGDKRGTLRIPLETKHEFDALLEISEYQYTYELLGEMLDTWMKKLTPEQLRLFHASLENIKRKAAIKEAKKKK
>NZ_CP010320.1|WP_001259529.1|64334_64568_-|hypothetical-protein
MRTLIIITLVVIGLVFFNVISLHTIGTLAAIIGVIIAIALGAYFLYRLALGFFALFATFIGVILVICLITYAVTNLV
>NZ_CP010320.1|WP_001092802.1|61530_63126_-|amidase
MNTKGIIAKLTAGALIANLLICPANTSAEKKTFTDVPNWAQQSVNYLMKKALDGKPDGTFSPSEKIDRGSAAKLMAMVLGLQINKQAKPSFQDAKNHWASPYIAAVEKAGVIYGDGSGNFNPSKDIDRASMASMLVEAYKLNNRIIGDLPTQFEDLKGHWGAKLANALVALGISKGTGDGWKPNGIVTRAEAVQFIAQTDMKKADTSKRMYMNRHFITYHQPSLSSGVTSNQHAPQIIVVKEQRADGWIKIVTNIGDKWTPLYEKRETIHSTFTTYPEASHSSKVLGTHSPQTVTVIEEKGSWIRIRTNAGFQWLDKNQLTLPKKQNNFLEGKTIIIDPGHGGIDGGHKGIYMNESPVVYDTAVRVQKLFAQKTPFTALLTRDAYSRPGKNATDSLGKRVEFAKKNKGDIFVSIHANGFNGNAHGTETFYYKAPTQKSNPYVNDSRILAEKIQKRLITALQTRDRGVKIGNLYVLRENTMPSVLTELGFVDNKADGKKLDSPEWRQRAAEAIYAGILDYYEWKGHNMSAYY
>NZ_CP010320.1|WP_003159967.1|59723_60053_+|hypothetical-protein
MRGVVNQNVLHHIGYEVLQETFVLIRNVFSYSNQGEYSVTYVREIADALYNIPHSIQKQHDTFLEFEFKLLEETLMQMEFGKVAAQNIPHFRMYAARVQQLLRKRYKEV
>NZ_CP010320.1|WP_000637483.1|58829_59141_+|heavy-metal-binding-domain-containing-protein
MIVTTTAEIQGKEIIEYIDIVNGEAIMGANIVRDVFASVRDVVGGRAGAYESKLKEARDIAMDEMKELAKQKGVNAIVGIDVDYAIIRAGMLMVAVSGTAVRI
>NZ_CP010320.1|WP_001009354.1|58115_58781_+|CPBP-family-intramembrane-metalloprotease
MNFIKTNTKEISMLIIYALFVPFQIGLFILLGISLLTNSNIVESEFALSAISLTIPAIVGIIFFRKEIIESFTYFKEKTILKIVSIPMVVLFTVIVEQIVMRFLATGQPENQEQLLETGAEIPLILTLLVFGILGPILEEIIFRHIILNRFSNYIGTAIASIISIIIFTLFHTSQLSDIAIYLPGAVILTAAYLISNRSLAYVIAIHVLNNSIAFIQLHMS
>NZ_CP010320.1|WP_000604768.1|56940_57405_-|DUF523-domain-containing-protein
MILVSSCLAGKPVRYNGTACLNDTIQKLIDEKKAIPVCPELLGGFVTPREPAEILGGDGYDVLEGKAKVMERSGNDVTELYINGAMKTLNLAQEMQASHVVLKEYSPSCGSKEIYSGEFVGKKVTGVGVTTALLESKGIKVISELELDQLINKI
>NZ_CP010320.1|WP_000169642.1|55973_56564_-|TetR/AcrR-family-transcriptional-regulator
MTKVDKVKEKIIETSLYLFNTNGITRTSIQDIMTATELPKGSIYRRFKNKEEIVLAAYDKSGEIMWSHFHKAMENKKTAIDKILAIFLVYQDAANNPPIAGGCPLLNSAIESTGVFPELQKAAAKGYDDTVMLMASLIKEGIEKQELKEDIDIISLASFLASSMEGAIMASRVSNDNIHHQYFIEQIKHHLYSYSK
>NZ_CP010320.1|WP_003171333.1|53563_53998_+|undecaprenyl-diphosphatase
MMIIQAVFAFMTAEIIGKLLGKLHLNYQPFAVLPDVNKLADHVVDNSFPSDHTILFFSICVSVKLVHKKAGLLLLVIAFCVGISRIWVGVHYPFDVATGALIGSISALFSYWIVPKIKFITQILNLYERVEQYVLPLKSKSKEL
>NZ_CP010320.1|WP_001099042.1|66924_68463_+|replication-initiation-protein-RepS
MNTVQKAIELILHKGLRKYKSKNSKAGLVSIANQEKFESKVLNGKKNKKGSIFITRKKEDLRAKFGTRGVVLSSEEAVLDHVGQASHWTPNVYNFGTYGQNGLRTIVGHTEKNLQQINCFVIDIDSKSFPMTAINDVALNAGFGVPTMILETTKGYQVYYVLDKAVYVSNNKNFIAIKSAKRISQNLREMFADSLPNVDLTCNHFGFFRMPSVQNIVMFFEENVYTFKELQEWSKRQDDNKGNEQFHNVIESPFAKNAPVEQPKQMDELWFKQVISCTNVSPKQTKAGRNNAIFTLSLACFQSQYAIKDTMDLMDQFNSNLEQPLEHTEVRGIVMSAYSGKYQAAHKDYIERLLQTYGMGQASAFRAPSVLWKKHKKQRKDRVRSHWHEWEADIITFLSMNSNNKPVLYFTQSELCEALNVPRSTLNTVLKKSTKIYKTVEGKGKTAKTGLSTLGMLIAFALKENGKRRESYLNYLQGLFPKTGNILEQAKTSNVMEEQETLYGILEGLPAG
>NZ_CP010320.1|WP_000517796.1|68665_69430_+|hypothetical-protein
MGKNYPIDRDSRGRYRHSYVFMRGANVEVKLLNHEELLKGKITTIEEYYCVLDVEGTSGSYQVTVNFSEVKYIKHEEFPTVEERSPKYSKGDKKTSFVFKIGEKIGCVFKDGKGIKGTLLSEDAYYLYVKSEKENYYTIMKGALSYIAHVKHEPLLLTNDFYTEEMKLADYKKPTEYVFSVGDTITVYFPSGKNVSGVVLDESKYWVLLQTEKRQITIFKGSYSYFKHETYETKAYLYVENRKLRKQLRSGDTN
>NZ_CP010320.1|WP_000249505.1|71127_71310_+|hypothetical-protein
MVQCVRVVQNEKIIFVVTSIALVAGIMFATASNKDQSNNIVKKDSEKLVAKMVGPGGGMG
>NZ_CP010320.1|WP_001208167.1|72185_72488_+|hypothetical-protein
MREKEFSKSTHRLKVTKEMDIGTLLNRAHKVSTFDGKNLIVLDNGNLYDQAGRREVPVTNMFRYIKSVRNSDGIVIAKKNKPCGKLMQVIFERKAKQKVK
>NZ_CP010320.1|WP_000061608.1|72994_73525_+|hypothetical-protein
MSMEYQERYVRKVATILSSKTKHTTGCLIEGESDVCLEFQIELINALQDNHGLVYHLDFNDYTSETDCLAALKKARKQLRSNKQDGKTLFLSLASFERVEKKTMDAVKILIGSRSLGINLVVSANKRFVHLVGLTEYLVTMNKSDVVLSELYRYSTQKILASLKNENVSWGEANES
>NZ_CP010320.1|WP_001015855.1|73514_73703_+|hypothetical-protein
MNHKVEKILRTKSIHVDLFELDEKYDLGQKIDVCCNKMNVIHTFKVFNITLLRGNHWLVHLQ
>NZ_CP010320.1|WP_000335298.1|73799_74288_+|DUF5512-family-protein
MCKRFKFLLAVSALFISITVVLAGCGGSSVPYKKDDTYKDSKDNFITITAENEWRVKGSQNSEANYKVESTEYKGDSHSVVAISVKEKINGSDPLLVVNDYHYYILSPRENGFSLTPIGTSHPNSAQWKEFQEGFKGANDKEEFLKKEVANVNKQNIFKKTN
>NZ_CP010320.1|WP_000331440.1|74672_74909_+|hypothetical-protein
MAYQVPKCDCGNNLMYMFDKLYHEEFKITKNGVPFKHRYDFCDILEDAWREKLGCTSCDNGYEVEYDKLGRFIRGVLL
>NZ_CP010320.1|WP_001092475.1|74959_75289_+|hypothetical-protein
MNTITIKFGEGTAAWKDMQEVVKILNDKGYSTQPYGDIGTVKLTKVIEEGMKVSTEEKIAEPDPAAMNKTKEGTFKRILVEANYPWELIKDWTEEDCEAELGAIERANK
>NZ_CP010320.1|WP_009879813.1|75414_78183_+|hypothetical-protein
MVLNFKKIFILVFTVILLLGSLADFVSIGYAENTTDQEKKTDDVTVLQEKSDIKSLGLAPNEVVVANGKKGSDLLDFEAFIKPSDIVDGTEPFDKSNEAGNDSSPNNGIVRTFDTVTYPLKVTINPKKHDKLKDIKLKITGTLENGITNKRVNAKFAVGGKEDLEKGIVSFDMEYTLKETGNSLMIPVTVEVQGAEHGIKLKPNIKIQVMSVEGKDILNEQIEQSFENISPVTTSGKVNVKARINQSYSTLNFRLYRAYNPNAAESNRSNVFGNTITFYIANLPYRNDLRGATFPNGKINYHFEFSGRVTWDDKSLAETVLDFESEDTPIKIFNYGDIDTEAKKIPQENTESFELGIENYMQVNPHVAFTARSYIPKDKWNADDIEKYTINSVWDSGKTEISKPEVGKEKVVYKASVKDYVIGSTFPTMHAHTTNVPSFSKNQKAFSTVAFLIHTPNEYRSLGKNNQINKPNNVYYDLKCIVDSYEDSKGNVISYNTSTSTTITERNTVNGSYSLQNAFFTPDGKELGTPNLGYSTVSKGDATTIVGQDVKMHADLNVHAVTEGGAIIVYKWNTDSFYLTKEAGERAARDIISRGYTSLLGTTISNSDKQKVYYGIARKNDNSFQAITQNKEEDYEWYTTYDEARKYGEIAAIKNDIQDMFSHGTIIERGIFFKVKTRKVGSVNEKGTPNIIATAADIFPTADRKTRYRVAENRAYNNYTEYDENGVMTKLQSPVKSSVNFETLGIMNGETSSEVTTNKTTYYSSDNVNVTVDNLVKLPGEMDFTYLDEKIEMRVKIPKGLDYVVGTAKYGDQYIEPKIEQQSDGSNHLIWYDTLTRSNKVLKKINFETRINPVLLPQGNQVGLEIQNVLSSSMDTRLEKFRTSSKNISIVKIGMVGVSETIKKLQVKKIVIMKLGCSHIQL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	34192-34238	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32845-32891	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34409-34455	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64617-64663	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34410-34456	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35452-35498	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34409-34455	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34576-34622	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34405-34451	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34409-34455	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34899-34945	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34410-34456	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41257-41303	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34409-34455	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56923-56969	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53699-53745	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	62010-62056	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	104-150	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66095-66141	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68684-68730	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39055-39101	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34408-34454	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35349-35400	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32750-32801	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34314-34365	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34655-34706	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64522-64573	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70307-70358	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34315-34366	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22592-22643	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35357-35408	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34314-34365	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34481-34532	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9832-9883	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34241-34292	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34249-34300	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34310-34361	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34314-34365	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34804-34855	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41162-41213	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34314-34365	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56828-56879	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19291-19342	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53604-53655	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	61915-61966	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31496-31547	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68589-68640	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34313-34364	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34242-34293	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69460-69511	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	194-245	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66185-66236	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	79-130	0	1.0
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39145-39196	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69555-69605	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	289-339	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66280-66330	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	174-224	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39240-39290	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35255-35305	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32656-32706	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34220-34270	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34561-34611	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64428-64478	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70213-70263	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34221-34271	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22498-22548	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35263-35313	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34220-34270	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34387-34437	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9738-9788	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34147-34197	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34155-34205	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34216-34266	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34220-34270	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34710-34760	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34220-34270	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41068-41118	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34220-34270	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56734-56784	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19197-19247	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53510-53560	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	61821-61871	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31402-31452	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68495-68545	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34219-34269	0	1.0
NZ_CP010320_1	1.3\|66280\|51\|NZ_CP010320\|CRT	66280-66330	51	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34148-34198	0	1.0
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35444-35490	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34750-34796	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70402-70448	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22687-22733	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9927-9973	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34336-34382	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34344-34390	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19386-19432	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69370-69416	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31591-31637	1	0.979
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34337-34383	1	0.979
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34315-34366	1	0.981
NZ_CP010320_1	1.2\|66185\|52\|NZ_CP010320\|CRT	66185-66236	52	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	34097-34148	1	0.981
NZ_CP010320_1	1.1\|66095\|47\|NZ_CP010320\|CRT	66095-66141	47	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	1-35	12	0.745

1. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

2. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

3. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

4. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

5. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

6. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

7. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

8. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

9. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

10. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

11. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

12. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

13. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

14. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

15. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

16. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

17. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

18. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

19. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

20. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

21. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

22. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagcaatccaacatcaatgtata	Protospacer
***********************************************

23. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

24. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

25. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

26. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

27. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

28. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

29. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

30. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

31. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

32. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

33. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

34. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

35. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

36. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

37. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

38. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

39. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

40. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

41. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

42. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

43. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

44. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

45. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

46. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

47. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

48. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

49. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

50. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

51. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

52. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

53. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

54. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	Protospacer
****************************************************

55. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

56. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

57. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

58. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

59. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

60. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

61. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

62. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

63. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

64. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

65. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

66. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

67. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

68. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

69. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

70. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

71. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

72. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

73. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

74. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

75. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

76. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

77. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

78. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

79. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

80. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

81. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

82. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

83. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

84. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

85. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

86. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

87. spacer 1.3|66280|51|NZ_CP010320|CRT matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	CRISPR spacer
aaaagattgtacgtttaatataatagaagagagagagatggaaaaagaaaa	Protospacer
***************************************************

88. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

89. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

90. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

91. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

92. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

93. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

94. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

95. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

96. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

97. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

98. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
acctataaatccattatataccttaagtaatccaacatcaatgtata	Protospacer
***************************.*******************

99. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 1, identity: 0.981

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttt	Protospacer
***************************************************

100. spacer 1.2|66185|52|NZ_CP010320|CRT matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.981

tttcgtgttgaaatgattcagaccagtgtttatagggattatagtttttttg	CRISPR spacer
tttcgtgttgaaatgattcaaaccagtgtttatagggattatagtttttttg	Protospacer
********************.*******************************

101. spacer 1.1|66095|47|NZ_CP010320|CRT matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 12, identity: 0.745

acctataaatccattatataccttaagcaatccaacatcaatgtata	CRISPR spacer
------------attatataccttaagcaatccaacatcaatgtata	Protospacer
            ***********************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010322

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP010320

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection