CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	0 crisprs	NA	0	0	1
NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	2 crisprs	NA	4	10	1
NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009351	Bacillus thuringiensis HD1002 chromosome, complete genome	4 crisprs	cas14k,DEDDh,WYL,csa3,cas3,DinG,cas14j,c2c9_V-U4	0	3	13
NZ_CP009349	Bacillus thuringiensis HD1002 plasmid 1, complete sequence	0 crisprs	csa3,RT,cas14j	0	0	21
NZ_CP009347	Bacillus thuringiensis HD1002 plasmid 3, complete sequence	0 crisprs	RT,cas4	0	0	2
NZ_CP009346	Bacillus thuringiensis HD1002 plasmid 5, complete sequence	0 crisprs	NA	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

18330 : 73701

Bacillus_phage(33.33%)

transposase,integrase,protease

attL 54612:54631|attR 74655:74674

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000070870.1\|18330_19227_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_001179520.1\|19839_20349_+	DUF4367 domain-containing protein	NA	NA	NA	NA
WP_000476188.1\|20406_20784_-	DUF3888 domain-containing protein	NA	NA	NA	NA
WP_042993035.1\|21822_23034_+	replication initiation protein	E5FFJ0	Burkholderia_phage	1.1e-14	25.2
WP_000429665.1\|24047_24713_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_100910529.1\|24830_24968_+	SapB/AmfS family lantipeptide	NA	NA	NA	NA
WP_000370432.1\|25036_27640_+	protein kinase/lanthionine synthetase C family protein	NA	NA	NA	NA
WP_000995328.1\|28296_30003_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.1e-80	37.4
WP_000993663.1\|30306_30660_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_001072051.1\|30622_31189_+	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_000984699.1\|31185_31785_+	NDxxF motif lipoprotein	NA	NA	NA	NA
WP_000235461.1\|31905_34887_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.1e-257	45.5
WP_000690668.1\|34899_35451_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	3.2e-43	53.3
WP_001196890.1\|35751_36612_+	hypothetical protein	NA	NA	NA	NA
WP_001064652.1\|36687_37737_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_103656266.1\|37895_38624_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_080548773.1\|38611_39037_+	HAD-IIIC family phosphatase	NA	NA	NA	NA
WP_001053998.1\|39363_40797_-\|transposase	IS4-like element IS231F family transposase	NA	NA	NA	NA
WP_000278076.1\|41647_42721_-	hypothetical protein	NA	NA	NA	NA
WP_000898590.1\|42739_44224_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	5.6e-114	44.7
WP_000414502.1\|45933_52632_+	DNRLRE domain-containing protein	NA	NA	NA	NA
WP_003310266.1\|52649_53030_+	hypothetical protein	NA	NA	NA	NA
WP_003263840.1\|53046_53442_+	DUF4262 domain-containing protein	NA	NA	NA	NA
WP_001284342.1\|53666_54299_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	1.7e-16	31.7
54612:54631	attL	NA	NA	NA	NA
WP_001053998.1\|54741_56175_+\|transposase	IS4-like element IS231F family transposase	NA	NA	NA	NA
WP_000551390.1\|57610_58693_-	nitronate monooxygenase	NA	NA	NA	NA
WP_001100118.1\|58792_59683_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000503537.1\|59868_61806_+	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_000164676.1\|62530_63730_+	MFS transporter	NA	NA	NA	NA
WP_000899477.1\|64797_65373_+	hypothetical protein	NA	NA	NA	NA
WP_006918384.1\|65756_66191_+	DUF4879 domain-containing protein	NA	NA	NA	NA
WP_014895382.1\|66658_66970_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_042993006.1\|67085_67793_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.5e-40	45.1
WP_001017689.1\|67695_67944_-	hypothetical protein	NA	NA	NA	NA
WP_000156601.1\|68217_69177_+	ETX/MTX2 family pore-forming toxin	NA	NA	NA	NA
WP_000406475.1\|69333_70245_+	ETX/MTX2 family pore-forming toxin Cry60Aa	NA	NA	NA	NA
WP_001143746.1\|70384_73402_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	0.0e+00	99.3
WP_003254188.1\|73473_73701_-\|integrase	tyrosine-type recombinase/integrase	A0A0A7AR08	Bacillus_phage	2.5e-34	98.6
74655:74674	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009348

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009348_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009348_1

132888-133348

Orphan

Consensus_repeat	Method
GATATCATTGAAGACGAAGATGA	CRISPRCasFinder

9 spacers

The CRISPR arrays of NZ_CP009348_1

>merge|NZ_CP009348|1|132888-133348|CRISPRCasFinder
GAATTAATTGATGAGGAAGAGGAAGAGTTCACTCATGAGCCGGAAGACGATGATGACGAAGAAGAGGAACTTATTGAAGATGAAGATGAGGAAGAAGAGGAAATAGAGGACGAAGATGAAGAGGAGGAAGACGAGGAACTTGAAGAAGACGAGGATGAAGATTTAGAAGACGAAGATGATGATTTCGAAGAGGAAGATGAAGAATTAGATGACGAGGATGAGGAAATAGAAGACGAAGATGAAGATTTGGATGACGAGGATGAAGATTCAGAAGACGAGGATGAGGAAATCCTAGACGAAGATGATGATGAGAGTGGTTTAGTAGACACGGATGATGAAGATGAAGACGAAGCTGATTCTGAAGAAGACGAGGACGAAGAATTAGATGATGAAGATGATGATTCAGAAGACGAAGCTGATTTTGAAGAAGACGAAGATGAGGAATTAGAGGACGAAGATGA

>NZ_CP009348|1|1|132888-133348|CRISPRCasFinder
GAATTAATTGATGAGGAAGAGGA	AGAGTTCACTCATGAGCCG
GAAGACGATGATGACGAAGAAGA	GGAACTTATTGAAGATGAAGATGAGGAAGAA
GAGGAAATAGAGGACGAAGATGA	AGAGGAGGAAGACGAG
GAACTTGAAGAAGACGAGGATGA	AGATTTAGAAGACGAAGAT
GATGATTTCGAAGAGGAAGATGA	AGAATTAGATGACGAGGAT
GAGGAAATAGAAGACGAAGATGA	AGATTTGGATGACGAGGATGAAGATTCAGAAGACGAGGAT
GAGGAAATCCTAGACGAAGATGA	TGATGAGAGTGGTTTAGTAGACACGGAT
GATGAAGATGAAGACGAAGCTGA	TTCTGAAGAAGACGAGGACGAAGAATTAGATGATGAAGAT
GATGATTCAGAAGACGAAGCTGA	TTTTGAAGAAGACGAAGAT
GAGGAATTAGAGGACGAAGATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009348.1\|WP_000252699.1\|131713_132661_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|237394
NZ_CP009348.1\|WP_000830697.1\|134128_134686_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000508139.1\|128435_129689_+\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238017
NZ_CP009348.1\|WP_000826994.1\|138347_138908_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000823696.1\|136542_137025_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000823845.1\|135898_136519_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000464419.1\|130889_131615_+\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|223704
NZ_CP009348.1\|WP_000823697.1\|137047_137527_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000687689.1\|129695_130484_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341491
NZ_CP009348.1\|WP_000404429.1\|126096_126612_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000461270.1\|127431_128448_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000644807.1\|138950_139688_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_003255420.1\|137827_138346_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000283262.1\|127205_127400_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000824419.1\|135198_135876_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000830179.1\|134689_135181_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_001135708.1\|126624_126831_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000476432.1\|133479_134013_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_001004734.1\|126817_127003_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_003298989.1\|130499_130859_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009348.1\|WP_000252699.1\|131713_132661_+\|HD-domain-containing-protein	gnl\|CDD\|237394	PRK13480, PRK13480, 3'-5' exoribonuclease YhaM; Provisional.	6.24554e-08
NZ_CP009348.1\|WP_000464419.1\|130889_131615_+\|serine/threonine-protein-phosphatase	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	3.48276e-55
NZ_CP009348.1\|WP_000508139.1\|128435_129689_+\|FHA-domain-containing-protein	gnl\|CDD\|238017	cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins localize to the nucleus, where they participate in establishing or maintaining cell cycle checkpoints, DNA repair, or transcriptional regulation. Members of the FHA family include: Dun1, Rad53, Cds1, Mek1, KAPP(kinase-associated protein phosphatase),and Ki-67 (a human nuclear protein related to cell proliferation).	4.41815e-16
NZ_CP009348.1\|WP_000687689.1\|129695_130484_+\|hypothetical-protein	gnl\|CDD\|341491	cd17792, CtkA, serine/threonine-protein kinase CtkA and similar proteins. The Helicobacter pylori serine/threonine-protein kinase CtkA (proinflammatory kinase), encoded by the jhp940 gene, has been shown to be secreted by the bacterium and to induce cytokines in gastric epithelial cells. It may play a role in chronic gastric inflammation. CtkA autophosphorylates itself at a threonine residue near the N-terminus and it translocates into cultured human cells. It also enhances phosphorylation of the NF-kappaB p65 subunit at Ser276 in human epithelial cancer cells; phosphorylation at this position is known to activate the transcriptional activity of NF-kappaB.	5.16994e-13

>NZ_CP009348.1|WP_000252699.1|131713_132661_+|HD-domain-containing-protein
MVRVEEMQKLDKESISGVVWVHGYKQAPKKNKTGFYGMGDCYVKGGEKVAYRIWDDKLMNMMEQAVAKVGSSFFIEFEATGNVFNGLFSMSITELRFPKQENFNETDFMTVNLNARELNGKVNQILRNRVTPDALLVVGAILKGDIANRFATEFAGMHMHDAEPVGLLHHTTKMMEILDLVMVQHKNFGLDSNGVDLMYTGVLLHDIGKILELKNGLYTDIAIATHRFLGAEMIMEHKNFIIEKYDTLFYYNLISIITQHHGQYEERPRTIYSYIIHLIDNLEAQMTIIDEKYKEAKNGTEIYVNDFRLTVQKPQ
>NZ_CP009348.1|WP_000464419.1|130889_131615_+|serine/threonine-protein-phosphatase
MFEVVPFTDIGVVRETNEDNLVFLVGEFQGEEIALIVVCDGMGGLDDGENASRTVCQNLEETFANEEYETIAELKRAITMSITMSNKQLLNINMAKGKKGGTTVSCVLLADKGYLWHVGDSRIYQIKDGQVNRLTEDHTLVNKYIKDGDITEEEAKTHHQRNVILRAVGIKAGVKIDTNTFDYKDSSLVLCSDGFWHSLEDRQLVDLNNKHVSLNDLFQFAIAEGETDNITSVFVEHKSTN
>NZ_CP009348.1|WP_003298989.1|130499_130859_+|hypothetical-protein
MFDNIQIAHQEVVNNRHELVLENHLPSVYIIPRELFPQGVKRIPLGDIVNFIEWRIFPKEREDCKKLLKQLGLREYDPLEIAKRTKASLVEDGWWIAFSDTDTFEKDTVRGKMGYPRWN
>NZ_CP009348.1|WP_000687689.1|129695_130484_+|hypothetical-protein
MKIELLQLVDSTTSRGNLPKGWYNINGDVFLVKGNFHPNMVSGHTYDPYSEAMATLIARRLGFEHINYMLLPKQYFPELDVHGINHVSICKKLTLPQQTMRPLQRYLIDRFGVTKDDAFTQYKQVLPSLPLYKMLVFDALTGNEDRHLYNIDIIVDVLTGEERLAPIFDNGASLLSWVDDKDLKLASHFNKLDRAKPFRTTHQKQIKLVDQKIFPKLNLDALYTAIIQDITPILSLLPEDRANAIVKYLKWRMRYIGKVMEV
>NZ_CP009348.1|WP_000508139.1|128435_129689_+|FHA-domain-containing-protein
MGFVKLLTQDNEWVIVNELEKKEKAREDLAEYLKSENVDCILPFEIEKVKRKTFIRAKLTGKYSVLTRLQSPIDSREFVLLLKGIVDAMQTISSHNISPDYLDLDLDFIFINKENGKIELTLWILDNLAPKQNILHMFYQMGEVAKPKSSKDKTFLEGYAKMFQKEDMGLDKLDMFVNKTYSMLEQSVESSERAKENLAKQEVEIKETPIEEPVLEEPIIEEPVVQEQVIDEPDLVEPLIQEDDIEADVIIEEVKEPVVEAREEVASSVEIEESIQESDDDEILMPTDKTTFLMDDIEDEQEEDFDSGKTTILDEDDEEQIPYLIRESDGERYELSILKTETTFGKLGTDIQIKGNGLISRKHAVFHFEYGVVELEDIGSANGTFVNKKKLIKGRREQLAEGDVIKFANEVFQFFEG
>NZ_CP009348.1|WP_000461270.1|127431_128448_+|hypothetical-protein
MFEDRLKIVDTSIPTFDILNEIDKKGRLRDVVVGGYVKHKIEKPPIFHSEELAPNCKFVSFRVHFIGEQGREKKLTKGELVVYVPNDLVENDFYEFRGTLSLAGFDYTRVVTMMRFKKKEVKLQDKGMKGHNRKDSYKQEYPKKENKMQYVWEVHPVSVSDLDLGSLSSNLYHETMQFIQSPLSYTHKKLNSILETQSSRIDTDKYYYDFSTPIDKDELLKRPTKDSTSFEEENNYIIDKDYGIILEALEYPVLLLNLEAFGLDKTMLNYMIWLVDGALDVYDSIEDLQNNKINQDYVVNEQEGVLNGTRRKVVLVSEPSKGYPYLELKKGDMISWGL
>NZ_CP009348.1|WP_000283262.1|127205_127400_+|hypothetical-protein
MYPKELLKKYSEKKEDSTQLLSMQGVVEIDKGKDSSEYMEIETRLKELENEMTDIAKVFIESFI
>NZ_CP009348.1|WP_001004734.1|126817_127003_+|hypothetical-protein
MNENEFYKPVVPEWVAKILEKKKRNDPLATIGHSKEWENWKRKYPRKYKYAMLNGWIVEEK
>NZ_CP009348.1|WP_001135708.1|126624_126831_+|hypothetical-protein
MPQKKTYIGKVVEQEIDYGNSNALYHDVYIKEINDYLTQDLFNFEGKKVKVTVEVIEEDTKECQNERK
>NZ_CP009348.1|WP_000404429.1|126096_126612_+|hypothetical-protein
MEILNKYDELGFEVTVYEMTKMRKGEKTEIFKAEIKIADREELLTTLEASSKFQLRELLESWLEYEETTKEKLQGLPKVRFVRFATDEHSEYSYSTLMIRGDITNEEFLDLYHRIVKQVDTNQHEVIAQAMCREYGFQLVEEDLEIHAMYSKFSIVDRDVSYKTAGFTTLG
>NZ_CP009348.1|WP_000476432.1|133479_134013_+|hypothetical-protein
MFKRKILSIALPLMLVGGGCVQVYSGKAIEKKEIPKSHQTVTTVMYIDYLVNFMVDLEEANKSANKLLQLDESLNSVDMEFKSEIHSLKTSINVFKSIEPPKKYKEVHAKLLDSIISLDKGLDLVEQGIVDVESADFKTGKQTVMDSAEDYIKGLEEIDKLSGGEVSEAIDTWEEDK
>NZ_CP009348.1|WP_000830697.1|134128_134686_+|hypothetical-protein
MKRSLICLAVPMMLFAGGCGNEESKKEDKIAVASKEEKVAYIDQVIGFSNDFETIMKKMSKLTSDDMTLFSNKEEFIGVINEFTDLFDRLNNMEPDEKYKTQHEKLKRAMGYYAESFQIQLDNIDNPSSSELALSTSKLKDGLAIYKKSMGAINDIRRGNEIGTTEKSLEEKKQQNTTSETTEGE
>NZ_CP009348.1|WP_000830179.1|134689_135181_+|hypothetical-protein
MKRRLVALTIPVMLLGGVGCSKEEAQVKETDSLEVSQNDSSGTVSSSSSSNYQKETLKMTDEWSNLYLEISRKTSVGGDFKEVQGDLSELRMLTKKIEDIQAPDKYKKSQDKLKVAIRDYFIAVNESVSYLMSSSESSTVDYASQRERASQKFIEVLDEIRGL
>NZ_CP009348.1|WP_000824419.1|135198_135876_+|hypothetical-protein
MKRKVLAVALPITLALGVGCSKDSSEESKTDSIKVEDYKNADSVKETDSLKDAETKKEEADKGKFMKVVDEEMDKEALAQNPTLKKEATDKGQATGTMSEDKKELVAYQNKVNEGFEQFKTDLEATIPITQKDMELKTNKAELKAQYGKVKEQAIKLSEIEPPKEYPQFKENLKTNSDIIVMNIDQLFDDLLRDNTEKARSTKGDILDGLKYLKNTVEEIRRAGK
>NZ_CP009348.1|WP_000823845.1|135898_136519_+|hypothetical-protein
MKRKMLAVVLPLTLALGVGCSNGEDEKKKEEKANIEAEANKKALETVNKELDKLKEEKADLEKQTKEDKKIDKAKLKTVKEYQQEVDNKGLDFATEVQKVNPIIEKDQTLITNHQEVKEQFDKVKVVSKKLQDIKAPEQYEGLQTELKKSLIIYEKSIDKILEGVDELDENKVTTNINYMFEGLEMFGKAIDEIRALDEQNMSEVQ
>NZ_CP009348.1|WP_000823696.1|136542_137025_+|hypothetical-protein
MKRKLLALAIPMLLITGVGCESKDKKKDEVMEASIKQNKKEDYNKNASYLLKEFMEQTEEIDDSLDSWKSMDKKAVKLKELKKPYFELIEKIENLDYALKEDTQLQKDVGRAMFTAKTGIDMIEIGLKDEDKEAVNTSRKDLESASKSADKIVKELDKKK
>NZ_CP009348.1|WP_000823697.1|137047_137527_+|hypothetical-protein
MKRKLLALAIPMLLVTSIGVGCSAKEKQVDPKVSIEQNKKEDYKENLAYLMKDLSEQSKVVSDILTSKKSVEEKQKEFETASKDLLAIGDKVKALNASDKYKDVQLTMETAMGLLNMSVLSIKDGFEQKDGNLMSIGNDAIIKASKKIDEANKMMQEIK
>NZ_CP009348.1|WP_003255420.1|137827_138346_+|hypothetical-protein
MKRKVLAISLPVMLLSNVGCSADWIFAKDNEKEIHAIEKETKKEEQSYSNNISRLSSQLEIDVTELQKYFFDSSETGKEDLNTRLALFKTTISKIKKLEVPKNYKEAHKEVLKAVDLYESSINYRLESIEKKDQKGIDESKEKTKEAGDKLEEARKKVNSVDLQKSKEMWGK
>NZ_CP009348.1|WP_000826994.1|138347_138908_+|hypothetical-protein
MKRLVSVAVPVMLLFGCGVVKDTKPKVEETSKAMLKTTVSEKEYPSYMYEQLVTFSFNKDDIILGISSKQKGDDRYNKIFETASIMDEALDRMENVKVPDKYKANHKLILEGVEDARKGIKPILEAKGKDVNEVNIAITNNLPHLDGMDRPQWKEAIYQLAKENKDDFEKVFTKVMEEQVKKKSNS
>NZ_CP009348.1|WP_000644807.1|138950_139688_+|hypothetical-protein
MKAKKLIALTLPVLLFTGCTLNTYGLTQAEYRKVDKEFKADRMIEDMERLHYSDEQIEAQLRGALSQLEYEEEQKKEEKSGKKEEKETDKEDSGESKIIRDSVYVSATDYVDFMFRELVNYKSYIKTITKESNALAEGGYEGSAKDTVRSLRKNLTDMLEVKIPKKYSDYEYKIRDANEALVKQMPDLEKAVDNYEDSSQDKKKVKEEVDKVLKEIDKAMYIWEPFFSDMNSMNPNSLRKAVEGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009348_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009348_2

289321-289458

Orphan

Consensus_repeat	Method
CTAAACCTGTACAAAAGCAAGAAG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009348_2

>merge|NZ_CP009348|2|289321-289458|CRISPRCasFinder
CTCAACCTACTGAAAAGAAAGTAGAAGCACCTAAACCAACAGAACAGCCTAAAGAAGAGTCTAAACCTGTACAAAAGCAAGAAGTTGCTCAAACACAACAAGCGAAGTCTCAACCTAAACCTGTTCAAAAGCAAGAAG

>NZ_CP009348|2|2|289321-289458|CRISPRCasFinder
CTCAACCTACTGAAAAGAAAGTAG	AAGCACCTAAACCAACAGAACAGCCTAAAGAAGAGT
CTAAACCTGTACAAAAGCAAGAAG	TTGCTCAAACACAACAAGCGAAGTCTCAAC
CTAAACCTGTTCAAAAGCAAGAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009348.1\|WP_000732164.1\|262201_263470_+\|L,D-transpeptidase-family-protein	unknown	unknown	gnl\|CDD\|226309
NZ_CP009348.1\|WP_003254777.1\|260804_261992_+\|potassium-transporter-TrkH	unknown	unknown	gnl\|CDD\|214682
NZ_CP009348.1\|WP_000218244.1\|295447_295771_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000810633.1\|277484_288065_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|275067
NZ_CP009348.1\|WP_000924700.1\|289972_290821_+\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198393
NZ_CP009348.1\|WP_001007096.1\|293364_293745_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000444162.1\|260157_260568_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000442156.1\|273787_274498_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP009348.1\|WP_000204760.1\|293763_294123_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000957118.1\|290987_291386_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_003298828.1\|295169_295427_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_001246921.1\|291463_292075_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_003254758.1\|292182_292923_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_003299120.1\|264109_271792_+\|VaFE-repeat-containing-surface-anchored-protein	unknown	unknown	gnl\|CDD\|227268
NZ_CP009348.1\|WP_000058018.1\|274517_275099_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000258289.1\|272214_273627_+\|GW-domain-containing-glycosaminoglycan-binding-protein	unknown	unknown	gnl\|CDD\|227323
NZ_CP009348.1\|WP_000553982.1\|275178_275595_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_000961607.1\|294134_294845_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009348.1\|WP_003254767.1\|275847_276906_+\|DUF5011-domain-containing-protein	unknown	unknown	gnl\|CDD\|374521
NZ_CP009348.1\|WP_000843774.1\|292942_293359_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009348.1\|WP_000732164.1\|262201_263470_+\|L,D-transpeptidase-family-protein	gnl\|CDD\|226309	COG3786, COG3786, Uncharacterized protein conserved in bacteria [Function unknown].	5.40714e-36
NZ_CP009348.1\|WP_003254777.1\|260804_261992_+\|potassium-transporter-TrkH	gnl\|CDD\|214682	smart00475, 53EXOc, 5'-3' exonuclease.	3.79747e-21
NZ_CP009348.1\|WP_003299120.1\|264109_271792_+\|VaFE-repeat-containing-surface-anchored-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	4.64929e-59
NZ_CP009348.1\|WP_000810633.1\|277484_288065_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|275067	TIGR04226, Fimbrial_subunit_type_2, fimbrial isopeptide formation D2 domain. The Streptococcus Pneumoniae pilus backbone protein, RrgB, has three tandem domains with Lys-to-Asn isopeptide bonds, but these three regions are extremely divergent in sequence. This model represents the homology domain family of the D2 domain. It occurs just once in many surface proteins but up to twenty times in some pilin subunit proteins. Three of every four members have the typical Gram-positive C-terminal motif, LPXTG, although in many cases this motif may be involved in pilin subunit cross-linking rather than cell wall attachment. Proteins with this domain include fimbrial proteins with lectin-like adhesion functions, and the majority of characterized members are involved in surface adhesion to host structures.	5.57425e-22
NZ_CP009348.1\|WP_000924700.1\|289972_290821_+\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198393	cd10446, GIY-YIG_unchar_1, GIY-YIG domain of uncharacterized hypothetical protein found in bacteria. The family includes a group of uncharacterized bacterial hypothetical proteins with a GIY-YIG domain that shows statistically significant similarity to the N-terminal catalytic domains of GIY-YIG family of intron-encoded homing endonuclease I-TevI and catalytic GIY-YIG domain of nucleotide excision repair endonuclease UvrC.	1.71269e-53
NZ_CP009348.1\|WP_000258289.1\|272214_273627_+\|GW-domain-containing-glycosaminoglycan-binding-protein	gnl\|CDD\|227323	COG4990, COG4990, Uncharacterized protein conserved in bacteria [Function unknown].	8.3381e-42
NZ_CP009348.1\|WP_000442156.1\|273787_274498_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	6.7124e-55
NZ_CP009348.1\|WP_003254767.1\|275847_276906_+\|DUF5011-domain-containing-protein	gnl\|CDD\|374521	pfam16403, DUF5011, Domain of unknown function (DUF5011). This small family of proteins is functionally uncharacterized. This family is found in Bacteroides, Prevotella, and Parabateroides. Proteins in this family are around 230 amino acids in length.	1.91661e-09

>NZ_CP009348.1|WP_000810633.1|277484_288065_+|isopeptide-forming-domain-containing-fimbrial-protein
MKQKKYLSAVMATVIAFTTFMQPVVAGAETITGDKAKSEVKVEQEKAVQEPTVSPDVQTSEMDKKEVTNDKTPKSTTEEQERNKGQPVDEKKTVVEPKVSTTNANPTGVALTDEQKKEQAQLASTDEVKLSQNYVETDDNGDPLRLIEAGKDYTYEVNLDVSGNVTLLSDYVVKVEVEKKYLRDWGEPLHISKPELASEVTYADEGDKKVAYIKFPQLAGGTTLSFPVQLIVEAGLTPDMYEMKPMASLMDSKLNLVKKANEISYKVTYKKPGSQKYVNGQKENGSMVWAGIDDGKGVIKEGTEVPVEFSFSTDLEFLDNYRYFKAIEVVDTLPQGAKFDPKANPDWKLSADGKSVSTTVSLNEEIGMSTNGTLANKLSKLKLSLTFPNGKVNGTYTNNVTKTYIPEKAESYEPKVESKASIDFVLDAKPVGFVFTKKRSEDATIKDSLHYKGLDYTYRIEFKNPNSMPLHNVVIDDYKRKDGTYALDKRMEFTKVQTLNGEGEKVIAYIEEDGKVTEKQITKDGKYYNFPKGTKGYRYEVAKLDGAKFFQFLAYVKISNPKDVKYDTKDASKNLFENEASFKGEIQNPTDGKVIYKAEGTDKDDIPLVEFKESISLRKEITNSRDKVLKGGELHNRLFIHGADSNLDAETVIKGGKIIDLLPKGMTVVKSSVSRQGEVIPNYKNSGQTAIVWTFEDMKAGDFAPYTSKEYPQVGFTAIANDLSEEGTNINQAYLVFDDMENMGIEYKKDAQDKFDFNENSKTDDKVVYSEDYYVYVPNKEVVLTKSVQNEELAKNKVWSTDGVFVKYGEKANYKLNIKNHLDVDVPQVTVYDVLPFKGDRAIVPNDGGEYLSRESMYSNTLTGAINAPQGFTVYYTTDKVLDNASDSMTKLNWSKTLTDYSKATGIKIVMDNGKVLKSKESVDFEFGAIVPKTGLKAEDKAYNSAAVSVNGGTSFVEGNKVYTQMDIPEYPTITKDVEGKEHHDVDKGRTYQYNVKVKIPKNIKGYETLTIKDKLDRRLTYKYATLYKGYDVYNDAKVKVDGQELQVNLTKQDIENLQGKELNLKINAYINYDAPYELIENKADLQLNNESAIESNIVTVKPNPRKAKVTIAKVSGEGLNSFESVTKKLFGTTVKEVTEGNMVINPLDVLKANEEPKLLSGATFEILDSSKNVIHTVSTDYTGTVDIRDLDMGDYFIRETVAPKGYVLDSTEYPFTVKDTGTPSLEFKYSFYNKVDPIEPKLEKNILEHMTDGTVNRVSHKDVFRGEKYKYEVGTTIENLEGYKTIKLSDSLDARLDVHSAKLVVNSKDIQDVKPTIKGQDVSIVLTKEQLESFGMNKDGKLRIDLVIESSVKEGTNNEVIPNKGTLSLNDKPAVESNEVTVKPKDVTAKLVVVKTSGEKEHTFGQLADGQEPGKDLVKLAGAKFEVSNADRSKVETVVSNDNGLVELDNLPLGKYFIKEVEAPKGYKLDTNEYPFELKELKGTFHPVYEFTFYDVVDPETPQIVKDVNGKTHLETEYDKAFDYNVTTTIPKDLSGYEKVVMADSLDKRLDIKGVKVLVDGQESSYKATVKGQDVTLTLDRTELNKLANKQVRLQIEASIKYGTPAEIIDNKATITVNDKPSVDSNNVTVVPFLPLDPTIKKDVKGVEHLRVERERTYNYNVKSKIVDDVRGYKSLTVSDKLDKRLDVVDAKILVDGVESSYKATKSGQNVEVTFTREQLETLKGKEVNLQIQFKVKESTLAEEVPNMATITRNGDFNLDSNVVTVVPVDPETPKVVKDVNDVAHIDVVKGDEFTYHVKTTIPEDLLSYKSLTLADTLDKRLTINGSDVKIGGKAVKGIETKVDGQNVKFVLDRKQLEDYKGQEVVISIRAKVKYDAPIEIVNNKATIQVNDKPSVDSNNVTVKPENRKATLYLYKLSGEQSNTFGPALVEKGARKTSTTNPLLDSLKETEKNSVVNPLSSLTQSKHQPVPLEGGVFQILDASKNVVGTITSDSIGTAYIENLDLGNYFIKEVQAPKGYQLDSKEHPFTIVENGSKQLAFEYIFHDVKDPETPVITKDVEGKKHLEVEKGKEYKYNVKTTIPENVEGYESLTITDTLDNRLDLVNAKVYVDGRISTHVANIKGQTVTLNLTRVQLDQIEGKEVKIQITSKIKEDVAIETIENKANIQVNNKPSVDSNVVTVVPPTPENPNIKKDVEGLDHIVVEEGDNYNYNVKTVIAKNVKGYKTLTIKDELDNRLEVVNAKVLVDGKVSTLKADFKGNKVKLELTRSQLDSLQGKEVNLQITSKIKEGTGIVLIPNKATIELNDNPSIESNEVTVIPPTPDEPNIVKDVNGEKHAVVEHEENFNYNVKSVIPKDTKGYKTLTLKDTLDNRLDIVSTKVLVDGKPSTFKAVVEGQEVKLIVERSQLKTIEGKTLNLQITAKIKEGTPIETINNKATVQLNDKPEVDSNVVTVVPPTPIDPNIKKDVEGKEELVVEHKNEYNYNVKTKVADSVAGYKSLTIADTLDDRLDFVKSTVYVDGKASSFKAKVTGQNVVLELTRKQLDGLEGKELNLQITSKIKEGTPIEKIPNKATIQLNDKPSIDSNVVNVVPPTPIQPNIEKDVEGLQHLIIDTEKEFDYNVKSVIPKSVAGYKHITISDTLDKRLDLVDAKVQVNGKDTDFKVVKEGQKVTVKVDRKDLNGLEGKELNLVITAKIKDGTPIELIDNKANIQLNDQPLVESNEVTVIPPTPVQPDIYKNVEGTDRLEIEKEKEYNYTVKSVVPFNVMGYKHLTIEDMLDNRLDIVGVKVLVDDKESKYEAKVEGQHISLKLDRKELDTLLGKEVQLVITSKIKDSAPIEVIDNKATVQLNDEPKIDSNTVTVVPPTPVVPNIHKDVEGQEHIQVELEKEYKYNVKSVIPSKIDGYKTLTIADTLDKRLDVVEVNVFVDGKASKLVAERKGQDVKLVLDRKQLDDLKGKEVNVQITSKIKDGTPVEKIPNGASIQMNNLDAIQSNVVTVVPPTPVDPNIVKDIEGKQHLEVERGKVFNYNVKTKIADKVDGYKTLTIADKLDKRLGVVSATVLVDGKVSDLKAVVKGQDVTLTLDRKQLDKLMGAEVNVQIKALVLGDTKAENVPNKATIKLNDKPSIDSNVVTVIPPNPITPNIVKDVEGKEHLEIEQGKDYNYNVKTKIADSVAEYKYLTISDTLDKRLDIVKTTVLVDGVASELEANVKGQTVTLKLGRKQLDELVGKEVNVQITAQIKEGTEVNLIDNKATIQLNDNDAIESNVVTVIPPMPPVNPKVTKDVEGMNHIVIETGKEYDYNVKTTVANKLEGYKSLTIKDILDSRLTVVGAKVLVDGKETNFKVNIDNQEVTVKLTREQLETIKGKEINLVITSKINKGVAIENIENKATIQLNNRDLVESNTVTVIPPKPEEPVTPIPPKPEPPVTPEPPVKPEPPVKPEPPVKPEPPVKPEPVKPEPPKPVKPVKPEPPKPNKVEKPVPPKKPDRYLPRTGNAGDFGYTSYILFGSVIAIIVAVVYFTRRRKA
>NZ_CP009348.1|WP_003254767.1|275847_276906_+|DUF5011-domain-containing-protein
MLNKKLGIALGITAVLGLGIFGYKVYAKAPEIKTNEITIDYGKKLGTDKIETSTDVVKKQYKSATDTNKLGKQTIKVEVENDKGVTTEKEITLNVVDKEKPVIKTTQDKFVTKKGHSINLKQFVTAKDNVDGDLTNKILIQRFDYSKVGDIKVSMGVADSSDNFAEKTVIVSVVDEMPEVLTVPESRIVRTGDAFKPIDGVEAKDYNGKDLTSKININGNVDTSKAGEYSLTYQVTDSQGIFHQKSGLVVVKDEVVEKALRDEQKYKEENSVGDFVRPDKPETAKLLEDIADAKRKEGKKSIKDRAYDTVDKEKAAQTEKEIKDKVNDTTDSIKKEYDEHVKEHRKELGIDE
>NZ_CP009348.1|WP_000553982.1|275178_275595_+|hypothetical-protein
MHQLDFENKLADISKGRIVIEDSQIEHRDKEEDNIYKANWKGFEIYAKMGKNDWVENSYSVSTNRNVFEDKTLYENYHKLMESLIRIMDSKLTLEEIDKLIAKGVDENESPNTYDFGYERYVGKDKGNQIRFTITDRK
>NZ_CP009348.1|WP_000058018.1|274517_275099_+|hypothetical-protein
MSLQERIKAYRIPIVGVLLLLVVWFIFFRGSGSSGILTQQEFEDKLKEMSNGKIVISDSKIKMYESEDGGVYSANWNGFMLSSRVDKDKKLDRTFSIITKQAGYMDEISIGQYHDLVVYLTRLSNEKMSVDEANVLVDTGLNFNQQITTGEQHETSKGDLYYRLSGGKKDINFFSFLIMDEDGHKRVINPNKK
>NZ_CP009348.1|WP_000442156.1|273787_274498_+|class-A-sortase
MERRLKIRYGLIAGIIALGVGGYYVVDSMLQTDMRGIELDKNTIDENKKAKADFDLDSIKPLSEQELLENSLKRSTGWGKDLHYGNQGVVGGIYVPSVDIKLPISKGIGNNSLSRGVGTGFEDREMGKGNYVLLGHNSPNKHVLFSPLEDMKTGDIIYVTDATWMYEYETTDKKRIHQSQGEVMDNTTEDIITLITCFGGLNTDKRTVVTGKLKHKYPVSGAEKEIKTALNIKEDN
>NZ_CP009348.1|WP_000258289.1|272214_273627_+|GW-domain-containing-glycosaminoglycan-binding-protein
MVTMKKLIKTGKSAIVGTVGVGVLLSTSHSISADTLKPVDEKVQESQLERLSQEEDKKLDVQVPDLNKEKQENEEGVEKPQTENQEVKDEKVVEDGNKEKKPEVKNEEKPVVNEEEKPKTDSLQVVDEEKKEEPQVEEEEIYVVYKKVNSTQIIEKSNNESIWSKPHMLKGAENLGSVDEYVGKEVQMSEMALANRKAWFKISVEGKELGWVSSSVMSVATDLESINKAVGTEGTDDKYSIYSLPKGMQNSQEVAKVNDYANQELKATKQTVYNGTMWYKVSQNGNEIGWLDSRSVSERTVLPHMNVPIESQLDAKDPSRNLETGCEITAVSMMLQFAGANVDKVLLAKEMPYHDYDPNKGYVGDPWSDGPINTVYPPALLDLVKKYAGSSVNLTGVSLDKIKEKLNQNHPVVAWVGDMHGFGIHAITLTGYTNDKVFYNDPWTGEKDASMSWDSFDSKWTPKKSRALSY
>NZ_CP009348.1|WP_003299120.1|264109_271792_+|VaFE-repeat-containing-surface-anchored-protein
MYMLDAFKRGKVSKVMFSVLSLLMLTISTLISPIFAHADDGEPNVVQRASGNWTQMWHEKYNNKGWVYDAGQKYSIETDVIRFGDNSIAYCLEMMLESPNGHSLEEKTRLSDEYYKIMNNGYPVKTPEQLGANSWQEAHYATQVAVWIVNQDVKYSNLTFKNANVKQVVDKILADANNSSDTQDLSFSITPDHIKAEMTPWSTEYRQAGPFTIKTNGNGTFKPEAINAPGKVTFVDSMGNPKTELNSWEPFFAQINSNTPTGSFNIKVTGDMTKTETVWYKSHSGGIQHTTALVTLHKTPTAQNASISWDSNGGFKIKKVDDAGNPLGGAKFDVINWGNQVVRSLTTDSNGMASTDGLWFEDYTVKETQAPDGYELDNTPQKVTVDSKDKTLTFVNRKSKGGFRIHKVDDSNKPLQGVVFTIYGNDGLKMFDRTTDANGIIQLGDLPYGEYHFKESKGLDGYEFDDDVKHITINADSQNKEYKVVNKLISGSIKITKTDEENRPLKGVQFLVYNQNGDVVGEAYTNEQGIATMGNLPYGTYAWLENKGLDGYEAEKKTGSFVVGKDQKDHAVTVINKRMKGGLEIYKIDDSHQPLQGVEFTIYKDGKEFKKVTTGKDGKIKLPDLEFGKYSVKETKGLEGYVTDFKEESFELSSQNRSKSMVVVNKKIKGSLEITKTDDASKPLAGVQFTIYKDGKEYEQITTDANGKIVLNDLPMGKYTFKETRGLEGYVVSTKEEAFEIKNLGDSKKFTVVNKAIKGSIEITKTDDASKPLKGVEFTVYKDGKEYTKVTTNDKGIAEVKDLPYGSYTFKETKGIEGYVPDSTTKGVDIKEDGKTHKYTVINKKIKGNLEITKTDDAKKPLKGVEFTVYDAKDKEVAKVVTDDKGKASVKDLPYGKYYFKETKGLEGYVFSKEKVEFEIKNLNETKSYNVVNKLIRSNIEITKVDNEGKLLEGVEFTIYDSNDKEVAKVVTDAQGKAKYENLPYGKYYFKETKNLEGYVKNGTKYDIDVKQDMQTLKYDVINKKIRGSVEVLKVDADKKEKPLQGVEFTLFDQNNKVVGKPKLTDKDGKVSFDKLAFGKYYIKETKTIKGYNINNEKFPVDIDTDGKVVKHTVTNKVIRGNVELLKVDTENKNVTLKGAEFELRGSNDEVLGKYKTDANGKLVIKDLVFGDYKLIETIAPTGFNLEQTPISFSISEEGKTIGLTKENLKIYGNMEVTKVDAEDNKKVLANAKFEVYNEKGDKVVEGTTDAKGKAKFEHLPYGKYTFKEVVAPEGYLVNPTVFNFDILENGKTVSHKVTDQIIKGDLEVKKVDMADKKGLSDAKFEVFNAEGKKVAEGKTNKDGYAKFEKLPYGKYTFKETVAPKGYFLNETVFNFEIKEDGKIIAQVVENEKVPSIKTTATEKHDGAKEMHTSKEVTITDKVEYKDLLIGKEYTVKGKLMDKETKKPLLVGGKEVTAEATFTPDKATGSINLDFTFDATGLEEKEVVVFEDLIKEGKTLTTHSDLEDKDQTVKFVKPSVSTTATDKADGTKELHAIKDVTIIDVVEYKNLVVGKNYTLKGKLMDKATKQPLVIDGKEVVAEKNFSPREKDGKVPLEFKIDASTLEGKQVVVFEDVVHNNFVIATHADIEDKGQTVDFVKPEVKTTATNKADKEKEIHAIKNITVQDKVDYKNLVVGKEYTVKGKLMVKETNKPLVIEGKEVTAEKTFKPTAKNGSVTLDFTFDASKLEGKELVVFEDVVFNKTTIATHSDIEDKDQTVRVVKPEVHTTATNKADEGKEIHAQEKVTIQDKVAYKDLVKGKEYTVKGKLMDKATNKPFKVDGKEVTAESKFTAKEKDGVVTVDFTFNAEKLQGKSLVVFEDLYYEKELIATHSDIKDEGQTVRIVKPEVKTTATNKADEGKEIHADQTVTIQDKVEYKDLIIGKEYTVKGKLMDKATNKPLLVNDKEVTAESKFKAEAKDGSIILDFTFDAKALQGKEVVVFEDLYNEKLLVATHSEIEDKDQTVKFVKPEVKTTATNKADELKEVHSNREITLKDVVEYKDLIVGKEYTVKGKLIDKGTEKPFLVNDKEVTSEAKFIAEAKDGSITLDFTFEAKDVEGKDIVVFEDLYQDSLLVATHSDIEDKGQTVNFVKPEVKTTATNKEDGLKNIHSNKTVTIQDKVEYKDLIVGKEYVVKGKLMDKATNEPFLVDGKEVTSETKFTAEDKNGSVILDFTFEAKGVEGKEVVVFEDLYNEDILIATHSDIEDKDQTVEFVKPEVGTKATNKADGGKELHTNKSVTIQDTVDYKGLIVDKEYVVKGKLMDKETNKPLLVNDKEVTAEAKFTAKKETGSVTLDFTFDATGLEGKEVVVFEDLYQDNVLVATHSDITDEGQTVKFVKPEVKTTATNKENGSKELDANKSVTVTDKVEYHDLIVGKEYVVKGKLMDKATNKPLIINGIEVTSETKFTAKEKNGSVNLDFTFDATELQGKELVVFEDLYQDNVLVATHSDINDVNQTVKVKVKPVQPKPEQPKPEQPKPQKKPVPQTGSDSNFGTTMSILMGIIALALGGVFVFTRKNKAE
>NZ_CP009348.1|WP_000732164.1|262201_263470_+|L,D-transpeptidase-family-protein
MKKLDVETLKKHKKKLIVAGIGVAVLTSAGFGGNYYVQAKETEKQEIQQKEAKKKEVAKQEAEKKKQDELKAKLAKEEADKKAEEERVKAEEQKKAEEEKAKAEEQAKQEAERVKQEEEKKVEEQKKAEEGKQEEQVNGNQEGKKQGNSQENKQSKTQGNEQTQGIKGVAKKAEEPQQGSQENPQAKQGGEQAKQQTNNQEQPKQVSQQPTNKGGNQQANVQQEQGTAMTRAVSNSSVGKRTDQIVAVVAQGSSAKVTYLEKHNGNWKEVFTTNGFVGSQGVGQANESVSRTPRGAHSLGFAFGTSNPGTNLPFRQITPKSYWISNVNDDQYNTWQERDSSSPQDEHLIKETVAYKYGIVINYNTSNPVKGGGSGFFLHVSNGRPTAGCVSVPQAKMVELMQKLHGGAYIVNVNSINEISNY
>NZ_CP009348.1|WP_003254777.1|260804_261992_+|potassium-transporter-TrkH
MKDEMLDLIGENADRRRVIIIDFNHLAWRYAFSNAKGLSINRLVNGVSTIIDTTVPSYAIKQIVRWSNFGVNPTIVCLDAPVKSRKAYFSNILNKDKKELIPSDYKGDRKTPNGDFIQQIEIAGALMQQGGIYVYRKENYEADDIIHACVQKAKKDFPYLPIDVITGDADMIPLVDEQVSVYMKSKVHTYANEYSPTIKGYVQYTPESYQTYVQELSKYKTSSTQILVPYNTLLLAKILRGDSSDGLKGKPDWKPRMYNQLIEQLIRYEEPIHEIFRYGTWTSEIIDRRTKEVVTDWSSWTPEERKHLFQNYKEPKELKMIEDVLSRHVDDEDIEFIRERYIGMLLNGAFLPNIHVPDEFKRRPYEIEDKKPFTGFDITKLQEAVNVLEIRLPMG
>NZ_CP009348.1|WP_000444162.1|260157_260568_+|hypothetical-protein
MESKLFKTEKTERGTRVFLKDPLLHNMLPKRVFFFLERPVWSIFSIPFTIPFLPVRVSFGLSTNEFSRVLDKYCENLEELSNIQVVDPKTSILPYPSLGVYKVNMVEGVMFDFKSDKDMKSLLCKMDKAVERFRRT
>NZ_CP009348.1|WP_000924700.1|289972_290821_+|GIY-YIG-nuclease-family-protein
MLLKDMLQVCGLDLTKRIKVARHVDKDIDVQELYEKDNFELYQSYQGKNSFNCDYIVSFLGLENSQAVFIGVYEVKNPTEVTGLPQSIDTTEELRKRLSKAKWQYTLEKVDGFETLENRVIVQWEGVATSWCRYLNTFDLEVLQMLPKGETRKFTGYLDFILKRWELESIVNNPLKYKSWHESLSIVAGVYLIVDTKTGKQYVGSAYNTEGIWGRWKTYVNNGHGGNKLLMEILKQDPDRVNDFTYTILQVLPNTYKDTEVFKVESLYKRKLGSRAFGLNSN
>NZ_CP009348.1|WP_000957118.1|290987_291386_+|hypothetical-protein
MLTNEYLDDLFEGIKIEGEDYFYYFYVYQIPKEGVLLVNGIIPVGDIEHIIVCFTNKRLLFLEITMMGKYTGNMKSIDLIEFEHIKVKRGMIRTSIVLTSKNGKGNTVIKANSFTFGLSNQKKNLIALEKLY
>NZ_CP009348.1|WP_001246921.1|291463_292075_+|hypothetical-protein
MRNYEKVSLETWVNQLNSLVEYEIKETQVHVEENNFEPFSRGNIGRSTVHDLEELEGILAGVVVEGDMLTIKLLDGKQSSYDLNYVTSIMRRTDSPCFYLYFGRVETHVEITIKVDRLGVPIKSTSSINKNISKDINIPVKEFINNKELVKSVNNGNNSEGYIVLKDVELRLPINALNGIRETEDGCLLSFHVAQTLDIKVDK
>NZ_CP009348.1|WP_003254758.1|292182_292923_+|hypothetical-protein
MEVVKMGEIKLAEDIKGEVISFKNFVSELKEKENKHIVVHKLIADLDKELYTDGELLHVKEGRGGSFTLIVDEEQAPSERTYFSFLVKEIRKNKTKYYMIFKQGYVLEFSFKKSGSPCIKREVKVATKPTSNKEASELRHTLNNLGFTETRSFKTFSNFLLKSKESGYTDILTINPKGKKVEGLLDSVTIIDGGILVHVYQLGKGLSAVKFLEQDTILVSEVKMEDLVYFMVYGKSIVSPVIVKTK
>NZ_CP009348.1|WP_000843774.1|292942_293359_+|hypothetical-protein
MKSVKVNSNCSVIIEQHLVESLLRKANLKEGEEVFTIQFNQDYKYILLGYIKQDLYIFLMTNKRMLLHKVNETTGHLMGGLITLDEKKVLIGNMETGVISLPFKEKKHQTFISYLVGVSEDYKSNLFRYRERFKWVKE
>NZ_CP009348.1|WP_001007096.1|293364_293745_+|hypothetical-protein
MNEWMREEVLKTVEDYVKGSGVQDYFFVSGKKFLHELLECGKYPYRLTALWEGYTYTGKVNEIVKEEEKGTITINLDVTEEGKEKSMVLEEIHTKHAIMQRTVDSVHFTLFYKDSLVPLHFVYLKK
>NZ_CP009348.1|WP_000204760.1|293763_294123_+|hypothetical-protein
MTSTLSTKRKQVLISNVGKSKVIPFNKLFYHMFKRIETGATISTFQDGLVVRGKFVSLTNLIHKNEIELILELPNSREVELYFKANDIEEVVHGFGSNYNSYTLFTSREVVPIIISNIE
>NZ_CP009348.1|WP_000961607.1|294134_294845_+|hypothetical-protein
MLVTEERTARGIKDLKGSKITFQELVAKLKSYEGCLVELTRVRDVGLHPVIVRSIETCQINQVDVQEDAWFKLHLENEQDHYYYFKSSIECILQNGTTYYIIQTNNTYFEFKVKEEVCHSKRLKNYIDGMRNSLGVFRFTDTLTYDDFLEFLDNFEDYNYTKVSVLDGNGNHVTGQIDEVITSRARVGFCIILDNGEHTTIDFERENIVSIVDIKNSRNKYFMIYELDSITPLILE
>NZ_CP009348.1|WP_003298828.1|295169_295427_+|hypothetical-protein
MYPMRNYQEAMAFINYKFQQYHANDVSMLINFLESQATSLQYQVNQLLTHYQPNYNLIERNRTYIDILGVDVDKLKQARAIINQY
>NZ_CP009348.1|WP_000218244.1|295447_295771_+|hypothetical-protein
MTVQYDYKAMIQANKDFDVSTLENARHYVQQLSQGRSYTSVKDLLAGIDWLHTQAHHNIARYDGEATPQQLEHMKDVKQLYYVQKQKLSEVFKTYKNYGFDPSQVLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP009348.1	322324-322342	1	0.947
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP009351.1	2954310-2954328	1	0.947
NZ_CP009348_1	1.3\|133007\|16\|NZ_CP009348\|CRISPRCasFinder	133007-133022	16	NZ_CP009348.1	3703-3718	2	0.875
NZ_CP009348_1	1.3\|133007\|16\|NZ_CP009348\|CRISPRCasFinder	133007-133022	16	NZ_CP009348.1	345124-345139	2	0.875
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP009351.1	4820705-4820723	2	0.895
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP009348.1	322324-322342	2	0.895
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP009351.1	3586026-3586044	2	0.895

1. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to position: 322324-322342, mismatch: 1, identity: 0.947

agatttagaagacgaagat	CRISPR spacer
agaattagaagacgaagat	Protospacer
*** ***************

2. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to position: 2954310-2954328, mismatch: 1, identity: 0.947

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacaaagat	Protospacer
*************.*****

3. spacer 1.3|133007|16|NZ_CP009348|CRISPRCasFinder matches to position: 3703-3718, mismatch: 2, identity: 0.875

agaggaggaagacgag	CRISPR spacer
agaagacgaagacgag	Protospacer
***.** *********

4. spacer 1.3|133007|16|NZ_CP009348|CRISPRCasFinder matches to position: 345124-345139, mismatch: 2, identity: 0.875

agaggaggaagacgag	CRISPR spacer
agtggaagaagacgag	Protospacer
** ***.*********

5. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to position: 4820705-4820723, mismatch: 2, identity: 0.895

agatttagaagacgaagat	CRISPR spacer
agatttagaagaagatgat	Protospacer
************ ** ***

6. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to position: 322324-322342, mismatch: 2, identity: 0.895

agaattagatgacgaggat	CRISPR spacer
agaattagaagacgaagat	Protospacer
********* *****.***

7. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to position: 3586026-3586044, mismatch: 2, identity: 0.895

ttttgaagaagacgaagat	CRISPR spacer
tttagaagaagccgaagat	Protospacer
*** ******* *******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74482-74500	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6377-6395	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264191-264209	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	132911-132929	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	249912-249930	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	132911-132929	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8678-8696	0	1.0
NZ_CP009348_1	1.1\|132911\|19\|NZ_CP009348\|CRISPRCasFinder	132911-132929	19	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132419-132437	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74428-74458	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6419-6449	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264233-264263	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	132953-132983	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	249954-249984	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	132953-132983	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8624-8654	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132461-132491	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74347-74365	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8543-8561	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6512-6530	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264326-264344	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133046-133064	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250047-250065	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133046-133064	0	1.0
NZ_CP009348_1	1.4\|133046\|19\|NZ_CP009348\|CRISPRCasFinder	133046-133064	19	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132554-132572	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74305-74323	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8501-8519	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6554-6572	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264368-264386	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133088-133106	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250089-250107	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133088-133106	0	1.0
NZ_CP009348_1	1.5\|133088\|19\|NZ_CP009348\|CRISPRCasFinder	133088-133106	19	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132596-132614	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6596-6635	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264410-264449	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133130-133169	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250131-250170	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133130-133169	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132638-132677	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74242-74281	0	1.0
NZ_CP009348_1	1.6\|133130\|40\|NZ_CP009348\|CRISPRCasFinder	133130-133169	40	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8438-8477	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74191-74218	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8387-8414	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6659-6686	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264473-264500	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133193-133220	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250194-250221	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133193-133220	0	1.0
NZ_CP009348_1	1.7\|133193\|28\|NZ_CP009348\|CRISPRCasFinder	133193-133220	28	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132701-132728	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6710-6749	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264524-264563	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133244-133283	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250245-250284	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133244-133283	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132752-132791	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74128-74167	0	1.0
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8324-8363	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	74086-74104	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6773-6791	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264587-264605	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133307-133325	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250308-250326	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133307-133325	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8282-8300	0	1.0
NZ_CP009348_1	1.9\|133307\|19\|NZ_CP009348\|CRISPRCasFinder	133307-133325	19	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132815-132833	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	267632-267667	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	162809-162844	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	71022-71057	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	289344-289379	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	56745-56780	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	289345-289380	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	201829-201864	0	1.0
NZ_CP009348_2	2.1\|289345\|36\|NZ_CP009348\|CRISPRCasFinder	289345-289380	36	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	288957-288992	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	267578-267607	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	162869-162898	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	71082-71111	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	289404-289433	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	56805-56834	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	289405-289434	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	201775-201804	0	1.0
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	289017-289046	0	1.0
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	KJ019094	Synechococcus phage ACG-2014e isolate Syn7803US33, complete genome	126876-126906	5	0.839
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	KJ019156	Synechococcus phage ACG-2014e isolate Syn7803C2, complete genome	126967-126997	5	0.839
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	KJ019054	Synechococcus phage ACG-2014e isolate Syn7803C85, complete genome	126967-126997	5	0.839
NZ_CP009348_2	2.2\|289405\|30\|NZ_CP009348\|CRISPRCasFinder	289405-289434	30	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	39281-39310	5	0.833
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_014533	Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence	849306-849336	6	0.806
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MN694597	Marine virus AFVG_250M99, complete genome	9510-9540	6	0.806
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_041878	Pectobacterium phage CBB, complete genome	189070-189100	6	0.806
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	73969-73999	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	6878-6908	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	264692-264722	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	133412-133442	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	250413-250443	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	133412-133442	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	8165-8195	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	132920-132950	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MT325768	Psychrobacillus phage Perkons, complete genome	24091-24121	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_047815	Erwinia phage vB_EamM_Yoloswag, complete genome	248783-248813	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_041887	Rhodococcus phage Weasels2, complete genome	61428-61458	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_047920	Citrobacter phage vB_CroP_CrRp3, complete genome	3181-3211	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	LC494302	Escherichia phage SP27 DNA, complete genome	271901-271931	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MH622943	Myoviridae sp. isolate ctbc_4, complete genome	370932-370962	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	204541-204571	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_027364	Escherichia phage PBECO 4, complete genome	12987-13017	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MH383160	Escherichia phage UB, complete genome	73575-73605	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MK327931	Escherichia phage vB_EcoM_G17, complete genome	229835-229865	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	213513-213543	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	KM236246	Bacillus phage Moonbeam, complete genome	124274-124304	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	KM507819	Escherichia phage 121Q, complete genome	272645-272675	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_049857	Lactococcus phage P1048, complete genome	82457-82487	7	0.774
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_014534	Gloeothece verrucosa PCC 7822 plasmid Cy782202, complete sequence	2052-2082	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP050837	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-3, complete sequence	10031-10061	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP008843	Klebsiella michiganensis strain M1 plasmid pKOXM1B, complete sequence	2602-2632	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP024642	Klebsiella michiganensis strain F107 plasmid unnamed2, complete sequence	13775-13805	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP024642	Klebsiella michiganensis strain F107 plasmid unnamed2, complete sequence	144599-144629	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP042547	Klebsiella michiganensis strain C52 plasmid pC52_002, complete sequence	114591-114621	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	26911-26941	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP026718	Klebsiella oxytoca strain AR_0028 plasmid unitig_3_pilon, complete sequence	88033-88063	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MG967616	Bacillus phage v_B-Bak1, complete genome	44632-44662	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_047815	Erwinia phage vB_EamM_Yoloswag, complete genome	248759-248789	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	KC595511	Bacillus phage Basilisk, complete genome	45666-45696	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MG967618	Bacillus phage v_B-Bak10, complete genome	46060-46090	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MG967617	Bacillus phage v_B-Bak6, complete genome	44632-44662	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_013160	Rippkaea orientalis PCC 8802 plasmid pP880201, complete sequence	58963-58993	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP032289	Acinetobacter lwoffii strain ED9-5a plasmid pALWED3.4, complete sequence	43-73	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MG592495	Vibrio phage 1.121.O._10N.286.46.C4, partial genome	130932-130962	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MK448911	Streptococcus phage Javan34, complete genome	36795-36825	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MH518298	Pseudomonas phage SCYZ1, complete genome	16480-16510	8	0.742
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	255363-255393	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	175083-175113	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	83296-83326	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	301618-301648	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	69019-69049	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	301619-301649	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	189560-189590	9	0.71
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	301231-301261	9	0.71
NZ_CP009348_1	1.8\|133244\|40\|NZ_CP009348\|CRISPRCasFinder	133244-133283	40	MH844558	Exiguobacterium phage vB_EauM-23, complete genome	29181-29220	9	0.775
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MK448704	Streptococcus phage Javan213, complete genome	32825-32855	10	0.677
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_048080	Acinetobacter phage vB_AbaM_B09_Aci05, complete genome	92031-92061	10	0.677
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MT623546	Acinetobacter phage Ab_121, complete genome	42972-43002	10	0.677
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	NC_048074	Acinetobacter phage vB_AbaM_B09_Aci01-1, complete genome	92258-92288	10	0.677
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MH800199	Acinetobacter phage vB_AbaM_B09_Aci02-2, complete genome	92464-92494	10	0.677
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	MT121964	Phage DP SC_6_H4_2017 DNA cytosine methyltransferase and putative helicase genes, complete cds	66589-66619	11	0.645
NZ_CP009348_1	1.2\|132953\|31\|NZ_CP009348\|CRISPRCasFinder	132953-132983	31	AP014193	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C71-MedDCM-OCT-S24-C63, * SEQUENCING IN PROGRESS *	10293-10323	11	0.645

1. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

2. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

3. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

4. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

5. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

6. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

7. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

8. spacer 1.1|132911|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agagttcactcatgagccg	CRISPR spacer
agagttcactcatgagccg	Protospacer
*******************

9. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

10. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

11. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

12. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

13. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

14. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

15. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

16. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggaacttattgaagatgaagatgaggaagaa	Protospacer
*******************************

17. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

18. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

19. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

20. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

21. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

22. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

23. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

24. spacer 1.4|133046|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttagaagacgaagat	CRISPR spacer
agatttagaagacgaagat	Protospacer
*******************

25. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

26. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

27. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

28. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

29. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

30. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

31. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

32. spacer 1.5|133088|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agaattagatgacgaggat	CRISPR spacer
agaattagatgacgaggat	Protospacer
*******************

33. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

34. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

35. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

36. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

37. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

38. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

39. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

40. spacer 1.6|133130|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

agatttggatgacgaggatgaagattcagaagacgaggat	CRISPR spacer
agatttggatgacgaggatgaagattcagaagacgaggat	Protospacer
****************************************

41. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

42. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

43. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

44. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

45. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

46. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

47. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

48. spacer 1.7|133193|28|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatgagagtggtttagtagacacggat	CRISPR spacer
tgatgagagtggtttagtagacacggat	Protospacer
****************************

49. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

50. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

51. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

52. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

53. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

54. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

55. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

56. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
ttctgaagaagacgaggacgaagaattagatgatgaagat	Protospacer
****************************************

57. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

58. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

59. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

60. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

61. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

62. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

63. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

64. spacer 1.9|133307|19|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgaagaagacgaagat	CRISPR spacer
ttttgaagaagacgaagat	Protospacer
*******************

65. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

66. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

67. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

68. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

69. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

70. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

71. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

72. spacer 2.1|289345|36|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aagcacctaaaccaacagaacagcctaaagaagagt	CRISPR spacer
aagcacctaaaccaacagaacagcctaaagaagagt	Protospacer
************************************

73. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

74. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

75. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

76. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

77. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

78. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

79. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

80. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcaaacacaacaagcgaagtctcaac	CRISPR spacer
ttgctcaaacacaacaagcgaagtctcaac	Protospacer
******************************

81. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to KJ019094 (Synechococcus phage ACG-2014e isolate Syn7803US33, complete genome) position: , mismatch: 5, identity: 0.839

ggaact--tattgaagatgaagatgaggaagaa	CRISPR spacer
--atctggtattgaagaggaagatgaagaagaa	Protospacer
  * **  ********* ********.******

82. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to KJ019156 (Synechococcus phage ACG-2014e isolate Syn7803C2, complete genome) position: , mismatch: 5, identity: 0.839

ggaact--tattgaagatgaagatgaggaagaa	CRISPR spacer
--atctggtattgaagaggaagatgaagaagaa	Protospacer
  * **  ********* ********.******

83. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to KJ019054 (Synechococcus phage ACG-2014e isolate Syn7803C85, complete genome) position: , mismatch: 5, identity: 0.839

ggaact--tattgaagatgaagatgaggaagaa	CRISPR spacer
--atctggtattgaagaggaagatgaagaagaa	Protospacer
  * **  ********* ********.******

84. spacer 2.2|289405|30|NZ_CP009348|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 5, identity: 0.833

ttgctc-aaacacaacaagcgaagtctcaac	CRISPR spacer
-tgcacgaaacacaacaagcgaactcgcaaa	Protospacer
 *** * **************** ** ***

85. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_014533 (Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence) position: , mismatch: 6, identity: 0.806

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
gcagcttattgaagaggaagatgatgaagtt	Protospacer
* *.*********** ******** ****

86. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MN694597 (Marine virus AFVG_250M99, complete genome) position: , mismatch: 6, identity: 0.806

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
gtatccttttgcagatgaagatgaggaggaa	Protospacer
* * *.* *** ***************.***

87. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_041878 (Pectobacterium phage CBB, complete genome) position: , mismatch: 6, identity: 0.806

ggaactta--ttgaagatgaagatgaggaagaa	CRISPR spacer
--aagtgaatttgatgatgaagatgacgaagaa	Protospacer
  ** * *  **** *********** ******

88. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

89. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

90. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

91. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

92. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

93. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

94. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

95. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgatatcatcgaagacgaagatgaggaagat	Protospacer
 **  *.**.*****.**************

96. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MT325768 (Psychrobacillus phage Perkons, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
atggattattgaaaatgaatatgaggaagaa	Protospacer
. .. ********.***** ***********

97. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_047815 (Erwinia phage vB_EamM_Yoloswag, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ggacgaagatgaagatgaagatgaggacgaa	Protospacer
***    . ****************** ***

98. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_041887 (Rhodococcus phage Weasels2, complete genome) position: , mismatch: 7, identity: 0.774

----ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
gcgcgga----tttgaagatgaagatgagggagat	Protospacer
    ***     ******************.***

99. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_047920 (Citrobacter phage vB_CroP_CrRp3, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttat-tgaagatgaagatgaggaagaa	CRISPR spacer
-agtctggtatgaagatgaagaagaggaagaa	Protospacer
 .. ** .* ************ *********

100. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

101. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MH622943 (Myoviridae sp. isolate ctbc_4, complete genome) position: , mismatch: 7, identity: 0.774

---ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
tatcgaat---ttgaagatgaagatgatgaggaa	Protospacer
    ***.   **************** **.***

102. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

103. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

104. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

105. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

106. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

107. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to KM236246 (Bacillus phage Moonbeam, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgaacgtattgtagatgaagatgaaaaacac	Protospacer
 **** ***** ************..** *

108. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaatcagttgaagaagacgatgaggaagaa	Protospacer
.***.. .******* ** ************

109. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_049857 (Lactococcus phage P1048, complete genome) position: , mismatch: 7, identity: 0.774

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agagttatttgaagatgatgatgaagaagaa	Protospacer
.**..*  ********** *****.******

110. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_014534 (Gloeothece verrucosa PCC 7822 plasmid Cy782202, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
tgcctgtattgaagatgaagataaggcagat	Protospacer
 *  . ****************.*** ***

111. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP050837 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-3, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

112. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP008843 (Klebsiella michiganensis strain M1 plasmid pKOXM1B, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

113. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP024642 (Klebsiella michiganensis strain F107 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

114. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP024642 (Klebsiella michiganensis strain F107 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

115. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP042547 (Klebsiella michiganensis strain C52 plasmid pC52_002, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

116. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

117. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP026718 (Klebsiella oxytoca strain AR_0028 plasmid unitig_3_pilon, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ctacgtagatgaagatgaagatgaagaagaa	Protospacer
  *  * . ***************.******

118. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MG967616 (Bacillus phage v_B-Bak1, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agttggtattgaagatgaagttgaggaatta	Protospacer
.*    ************** *******  *

119. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_047815 (Erwinia phage vB_EamM_Yoloswag, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
cgacgaagatgaagatgaagatgaggacgaa	Protospacer
 **    . ****************** ***

120. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to KC595511 (Bacillus phage Basilisk, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agttggtattgaagatgaagttgaggaatta	Protospacer
.*    ************** *******  *

121. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MG967618 (Bacillus phage v_B-Bak10, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agttggtattgaagatgaagttgaggaatta	Protospacer
.*    ************** *******  *

122. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MG967617 (Bacillus phage v_B-Bak6, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agttggtattgaagatgaagttgaggaatta	Protospacer
.*    ************** *******  *

123. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_013160 (Rippkaea orientalis PCC 8802 plasmid pP880201, complete sequence) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ttatttaattgaacatgaagatgacgaagat	Protospacer
  * .* ****** ********** *****

124. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP032289 (Acinetobacter lwoffii strain ED9-5a plasmid pALWED3.4, complete sequence) position: , mismatch: 8, identity: 0.742

---ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
ttcaaaat---ttgaagatgaagatgaagatgaa	Protospacer
   ..**.   ****************.** ***

125. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MG592495 (Vibrio phage 1.121.O._10N.286.46.C4, partial genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
tgtgtatcttgaagtagaagatgaggaagaa	Protospacer
 * .. * ******  ***************

126. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MK448911 (Streptococcus phage Javan34, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
tcagtttattgaagctgaagaggaggaaaag	Protospacer
  *..********* ****** ******.*.

127. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MH518298 (Pseudomonas phage SCYZ1, complete genome) position: , mismatch: 8, identity: 0.742

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
gttctatgttgaagatgaagaagaggaggaa	Protospacer
*   . *.************* *****.***

128. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

129. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

130. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

131. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

132. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

133. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

134. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

135. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.71

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
agaaccaattgaagatgaagatgaaatcgtt	Protospacer
.****. *****************..  *

136. spacer 1.8|133244|40|NZ_CP009348|CRISPRCasFinder matches to MH844558 (Exiguobacterium phage vB_EauM-23, complete genome) position: , mismatch: 9, identity: 0.775

ttctgaagaagacgaggacgaagaattagatgatgaagat	CRISPR spacer
tgcctaaaccgacgaggacgaagaatgtgatgatgaagaa	Protospacer
* *. **.  ****************  ***********

137. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MK448704 (Streptococcus phage Javan213, complete genome) position: , mismatch: 10, identity: 0.677

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
acgctggattgaagatgaagaacaggaagag	Protospacer
. . .  **************  *******.

138. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_048080 (Acinetobacter phage vB_AbaM_B09_Aci05, complete genome) position: , mismatch: 10, identity: 0.677

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
aagtattattgaggatgaagatgagcaattc	Protospacer
...  *******.************ **

139. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MT623546 (Acinetobacter phage Ab_121, complete genome) position: , mismatch: 10, identity: 0.677

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
aagtattattgaggatgaagatgagcaattc	Protospacer
...  *******.************ **

140. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to NC_048074 (Acinetobacter phage vB_AbaM_B09_Aci01-1, complete genome) position: , mismatch: 10, identity: 0.677

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
aagtattattgaggatgaagatgagcaattc	Protospacer
...  *******.************ **

141. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MH800199 (Acinetobacter phage vB_AbaM_B09_Aci02-2, complete genome) position: , mismatch: 10, identity: 0.677

ggaacttattgaagatgaagatgaggaagaa	CRISPR spacer
aagtattattgaggatgaagatgagcaattc	Protospacer
...  *******.************ **

142. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to MT121964 (Phage DP SC_6_H4_2017 DNA cytosine methyltransferase and putative helicase genes, complete cds) position: , mismatch: 11, identity: 0.645

ggaacttattgaagatgaagatgaggaagaa------	CRISPR spacer
------tactgatgatgaagatgaagaggaggaagaa	Protospacer
      **.*** ***********.**.**.

143. spacer 1.2|132953|31|NZ_CP009348|CRISPRCasFinder matches to AP014193 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C71-MedDCM-OCT-S24-C63, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 11, identity: 0.645

ggaacttattgaagatgaagatgaggaagaa------	CRISPR spacer
------cgatgaagatgaagatgaagaagaggaagaa	Protospacer
      .. ***************.*****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

117203 : 127003

Bacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003298979.1\|117203_120497_+	DNA polymerase I	S4U8J4	Listeria_phage	1.7e-25	23.2
WP_001198496.1\|120544_120925_+	hypothetical protein	NA	NA	NA	NA
WP_000565922.1\|121276_121495_+	hypothetical protein	NA	NA	NA	NA
WP_000727297.1\|121681_122767_+	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_003298982.1\|122855_123176_+	hypothetical protein	R4JDU4	Bacillus_phage	4.0e-09	40.0
WP_000442474.1\|123419_123818_+	hypothetical protein	U5J9G1	Bacillus_phage	2.4e-16	39.3
WP_000032377.1\|123835_124033_+	hypothetical protein	A0A218KBS9	Bacillus_phage	3.0e-07	40.7
WP_000085609.1\|124039_124603_+	hypothetical protein	A0A218KBS9	Bacillus_phage	2.0e-11	48.2
WP_003298987.1\|124728_125208_+	hypothetical protein	NA	NA	NA	NA
WP_000257080.1\|125224_125569_+	hypothetical protein	NA	NA	NA	NA
WP_000834751.1\|125584_125884_+	hypothetical protein	NA	NA	NA	NA
WP_000033408.1\|125897_126086_+	hypothetical protein	NA	NA	NA	NA
WP_000404429.1\|126096_126612_+	hypothetical protein	NA	NA	NA	NA
WP_001135708.1\|126624_126831_+	hypothetical protein	NA	NA	NA	NA
WP_001004734.1\|126817_127003_+	hypothetical protein	F8WPL1	Bacillus_phage	3.6e-15	60.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP009351

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009351_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009351_1

429891-429987

Orphan

Consensus_repeat	Method
AAATACTTTGCAACAAGCAAATTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009351_1

>merge|NZ_CP009351|1|429891-429987|CRISPRCasFinder
AAATACTTTGCAACAAGCAAATTTAATTGTACAATGTGTTTAACAAAAGAAAAATAAAGAGAAAAAGATAAACAAATACTTTGCAACAAGCAAATTT

>NZ_CP009351|1|1|429891-429987|CRISPRCasFinder
AAATACTTTGCAACAAGCAAATTT	AATTGTACAATGTGTTTAACAAAAGAAAAATAAAGAGAAAAAGATAAAC
AAATACTTTGCAACAAGCAAATTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009351.1\|WP_000176229.1\|431773_432088_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_014895311.1\|433253_434258_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000277643.1\|430425_430614_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224393
NZ_CP009351.1\|WP_000237490.1\|425247_426309_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP009351.1\|WP_000473481.1\|416805_417159_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000705175.1\|434220_435033_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|180750
NZ_CP009351.1\|WP_000005254.1\|429459_429789_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP009351.1\|WP_000773517.1\|415827_416268_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_001025406.1\|435594_435810_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378590
NZ_CP009351.1\|WP_000466635.1\|427785_429039_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379188
NZ_CP009351.1\|WP_042992861.1\|427413_427644_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000900691.1\|421093_421348_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000436950.1\|435074_435341_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000817807.1\|435412_435577_+\|DUF3954-domain-containing-protein	unknown	unknown	gnl\|CDD\|315731
NZ_CP009351.1\|WP_000348892.1\|430831_431611_+\|phage-regulatory-protein	unknown	unknown	gnl\|CDD\|371131
NZ_CP009351.1\|WP_000368958.1\|430035_430281_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000123129.1\|432361_433009_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP009351.1\|WP_000875666.1\|423081_424314_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
NZ_CP009351.1\|WP_001237444.1\|421606_422350_+\|M15-family-metallopeptidase	unknown	unknown	gnl\|CDD\|350624
NZ_CP009351.1\|WP_000520177.1\|417734_421016_+\|VaFE-repeat-containing-surface-anchored-protein	unknown	unknown	gnl\|CDD\|227268

Protein	Function_ID	Function_description	E-value
NZ_CP009351.1\|WP_000817807.1\|435412_435577_+\|DUF3954-domain-containing-protein	gnl\|CDD\|315731	pfam13128, DUF3954, Protein of unknown function (DUF3954). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are approximately 60 amino acids in length.	3.73393e-09
NZ_CP009351.1\|WP_000237490.1\|425247_426309_-\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.54705e-46
NZ_CP009351.1\|WP_000705175.1\|434220_435033_+\|ATP-binding-protein	gnl\|CDD\|180750	PRK06921, PRK06921, hypothetical protein; Provisional.	9.43713e-23
NZ_CP009351.1\|WP_000005254.1\|429459_429789_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.1346e-15
NZ_CP009351.1\|WP_001025406.1\|435594_435810_+\|hypothetical-protein	gnl\|CDD\|378590	pfam11195, DUF2829, Protein of unknown function (DUF2829). This is a uncharacterized family of proteins found in bacteria and bacteriphages.	5.59094e-06
NZ_CP009351.1\|WP_000466635.1\|427785_429039_+\|hypothetical-protein	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	0.00816143
NZ_CP009351.1\|WP_000277643.1\|430425_430614_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	1.08928e-11
NZ_CP009351.1\|WP_000348892.1\|430831_431611_+\|phage-regulatory-protein	gnl\|CDD\|371131	pfam10552, ORF6C, ORF6C domain. This domain was identified by Iyer and colleagues.	1.53514e-29
NZ_CP009351.1\|WP_000123129.1\|432361_433009_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	6.81419e-11
NZ_CP009351.1\|WP_000875666.1\|423081_424314_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	7.24006e-66
NZ_CP009351.1\|WP_001237444.1\|421606_422350_+\|M15-family-metallopeptidase	gnl\|CDD\|350624	cd14852, LD-carboxypeptidase, L,D-carboxypeptidase DacB and LdcB, and related proteins. This L,D-carboxypeptidase family includes LdcB LD-Carboxypeptidase from Streptococcus pneumoniae, Bacillus anthracis, and Bacillus subtilis, and L,D-carboxypeptidase DacB from Streptococcus pneumonia and Lactococcus lactis. These enzymes are active against cell-wall-derived tetrapeptides and synthetic tetrapeptides lacking the sugar moiety but are inactive against tetrapeptides terminating in L-alanine. L,D-carboxypeptidase DacB plays a key role in the remodeling of S. pneumoniae peptidoglycan during cell division. It adopts a zinc-dependent carboxypeptidase fold and acts as an L,D-carboxypeptidase towards the tetrapeptide L-Ala-D-iGln-L-Lys-D-Ala of the peptidoglycan stem. This family also includes vanY D-Ala-D-Ala carboxypeptidase which is vancomycin-inducible and penicillin-resistant. VanY hydrolyzes depsipeptide- and D-alanyl-D-alanine-containing peptidoglycan precursors; it is insensitive to beta-lactams. All these enzymes belong to the MEROPS family M15 subfamily B.	1.3216e-82
NZ_CP009351.1\|WP_000520177.1\|417734_421016_+\|VaFE-repeat-containing-surface-anchored-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	1.65298e-48

>NZ_CP009351.1|WP_000005254.1|429459_429789_-|helix-turn-helix-transcriptional-regulator
MSETMGSRIKEVRKSLKMKQNELADAVGVNYTMISLYESNKREPSRETVENIARVTNVSADYIMGLSKHKTFDKETSKKIIDDVEDIMKRINQLPADKREKIINMINDL
>NZ_CP009351.1|WP_000466635.1|427785_429039_+|hypothetical-protein
MFGEGGSKFVKELKERTIKNSKKHLQKEFKYNLMKELMKKIKQDMDDKGFKIRPLAKKVGVDRSVITDGIVTGKTAEMKLDTFMKIMDVVYENLEERQEVIRKFIKLSRNDLNIRKSLVYCQGTGEYDVIADLVKIHQGDRLLNKYIRVYELFNKRNQNIKKGQPLIEEMDEQLFSSDAELQVVINILYALSMHDTFNIRAMNPYMDKVEKNLIEVHDKFINNWLTMFFDERMAYVNLFDDNLELCRQKCEKLLKEANNVPLIYTTSMCCIGESYMFDDKFLAEKWISDSIAYLDKHGVSRESRKYKAFNTTLNYLYIEFGFNLDKINFDYIDTSELGYYIGLYEDKEKGLEMIYNLVKERGSSPFTDYYIARINEDLEGLEKALIRFERVANYHYAKAVRRTIQLLKNKQEEVERV
>NZ_CP009351.1|WP_042992861.1|427413_427644_+|hypothetical-protein
MAGFSPLKLKYNNKTMGEWETIVILEEQLLKKSKKTIILKGIVLYWVRISNYGREFAVLKVYEINKIILLNINKDP
>NZ_CP009351.1|WP_000237490.1|425247_426309_-|site-specific-integrase
MVIYKDEQRGTYYFVTRIRQFDGTLKQVKRRGFKTKKEAREAEAKMLVEKETTSSLTFSQAADSYFNWYSQRRKQSSIETIKNVIYNHLVIEFGNLKVEQIIPKHVMNYQNKIINKYSAKHLKKIHAVLSAIFNFSIKFHGLTNNPAKITGNFEKESNKRMNFWEFEEFKQFILAVDDPLYKTFFSVLYYSGARKGELMALTWSDINFDEKTININKTEYNRQVTEPKTKASNRIIMLPSFIMDMLHDIKKTAALNAPVKSDYVVFGEFYNSISSSTLRQKFIKYIKIAQVKKIVLHEFRHSHASYLINKGVSPLIVAQRLGHSDVATTLNTYSHLYPSKQAEVVAFMENDLV
>NZ_CP009351.1|WP_000875666.1|423081_424314_+|N-acetylmuramoyl-L-alanine-amidase
MKYKLIATGILAGSLLTYSSNTFANTHKFPDVPAWADKSVNYLVDKQVLNGYPDGTFGSNDSLDRASATKIMTKVLGIQIDSNAKPSFTDSQNHWATPYIAAAEKAGIVKGEGNGIFNPSGKVTRAAMATMLVNAYKLQSAANHNEQVKFEDLKGHWGEKYANILIGLKISNGTENGWQPNRFITRAEAAQLTAKTDMMQHRPQNPLESKTIIIDPGHGGEDPGKSTKGLPESKIVLDTSLRLQQLLEKHTPFTVLLTRQSDNRPGHDQKSSLQERVKFAKKNQGDIFISVHANAFNGNAKGTETYYYKSSKSEKTNPHVEESRVLAEKIQTRLVEALQTRDRGVKHGDLHVIRENDMPAVLTELAFIDNGIDYSKLSTEDGRQIAAEAIYEGILDYYEWKGNNVSEYRL
>NZ_CP009351.1|WP_001237444.1|421606_422350_+|M15-family-metallopeptidase
MRLKLVGIFSCVIMMLGIFIIYTNQSIGKEPDKTNYESRENSINKEKDSRGKGQSKYNESSFASIQAVVNKEYGLPEDYKPEDLVVPNVPFSFSGTVEKSHLRKEAAEALEKLFDLAKQEGIQLNAVSGFRSYDYQQRLYANNVKRKGQEHTDRFSAKPGHSEHQTGLTMDVSSKSANNELELSFANTKEGKWLKENAHRAGFIIRYPKGKESITGYAYEPWHIRYVGDIAENIYEQKQTLEEYMNL
>NZ_CP009351.1|WP_000900691.1|421093_421348_-|hypothetical-protein
MLGINVKKTNEELIISWQLAEITIPLRDVIEVTEDATYAGVEDVDVIRIGAAYGTTDRILIKTVKQNYVLFTTNKVAILNAIQT
>NZ_CP009351.1|WP_000520177.1|417734_421016_+|VaFE-repeat-containing-surface-anchored-protein
MGKRVIIRVFTLLSVLALFLNVFLPRASAEVMTHEKYSMNWSYSNSLGKHIRTEMIKNSSGQIAYCLTLGLKSPNGEDLPEMGKTDNVVYRVLLNGFPQKSVQQLGVANQNEAHYATQLAVWNALGQLDVNELKHENKNVEKAAKAIISNANNSEETQDVFMNVIPAEKQKAELKGEFFETNLYSVQTNAKGGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTKVQAIAYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLADAVFEVFNANNESVGKITTGADGIAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKGNIEIKKLSDSGKVLPNVEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLETQTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDVSKKLEGAEFELKDASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNHLIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEMHTSKSVTIQDKVEYKDLQVGKEYTVKGKLMNKETNKPLVVNGKEVTAETKFTPTEANGFITLDFTFDATGLEEKEVVVFEELLKDGKVVTTHADINDKGQTVKFVKPSVKTTATNKADGGKEIHSKDSITIQDKVEYTNLVVGKEYTVKGKLMNKAINKPLLIDGKEVTAETKFTAKEKNGFVTLDFTFVGAEQQGREVVVFEDLLHEGQVIATHADINDVGQTVRFVEPSIKTTATNKADGSKELDASKSVTIQDKVEYKDLIVGKEYVVKGKLMDKATNKPLLVDGKEVTVESKFTAKEKNGSIILDFTCNASALQGKEVVVFEELYQDNILIAIHAEIEDKGQTVKFKEVKPEQPKPEQPNSDENTPTPEQPNEQVKEQPQPKKEIQSKIGWLPQTGTNLTSWISMAAGALLLIVGGVIFLKRKNA
>NZ_CP009351.1|WP_000473481.1|416805_417159_-|hypothetical-protein
MFKKIIVSSMALTMFGGAATMLEAPTAQAASYNSTSSSYFDVTPEEAVAFYQSQDYKKLKVFLDDFEARNPYAPGGGYAQGSVRMQKFNDALRDAKLTNVYQEFIRISYYNHYPEPK
>NZ_CP009351.1|WP_000773517.1|415827_416268_+|hypothetical-protein
MKLNKLVLSCGVVSALTLGVLGNNTYAEEVHKTNDPIHVVEHVSADLLLTQTMDYSGEAETSFVYDGSTDLSFSMKNNGQNTMGYSVKGPNTELIVGGYIKPGEQQINVTNVRNALSPLPNGTYKIYVSNDDGSKGQFQVSVRSMN
>NZ_CP009351.1|WP_000368958.1|430035_430281_+|hypothetical-protein
MDNKKDLSAREAKKAYMRAWRAANKEKVKATQERYWKKVAQKMNMKESEIKNDYNRNWYQKNKDKRNDYMRDYYQKKKQNS
>NZ_CP009351.1|WP_000277643.1|430425_430614_+|helix-turn-helix-domain-containing-protein
MYKNLFIVRREHRMTQEDAGKLVNICQQTYYLKEKGKRDFTLTEAKLLAQHFKTTVDDLFAK
>NZ_CP009351.1|WP_000348892.1|430831_431611_+|phage-regulatory-protein
MDGLTVANELVFASNGEVVTDSLTIAEMFGKEHKNIKRDILETISKLASLQHNAEVDELGINFNTLKFEPIEYRDNRNRIQEKYILNFDAFMLVTMSYTTQKAMLLKVKYINEFNRMKNYIQSQQQVPTDPMSILKLTFEALEGQKQELQHIKSDVKDLRENAPLFAVECDEISNAVKRHGVALLGGKQSNAYQHAGIRGKVYRDIYKQLYREFGVTSHKAIKRGHLALATKIVGEYTLPIVLSEKINIVNSQIKFSEM
>NZ_CP009351.1|WP_000176229.1|431773_432088_+|hypothetical-protein
MTLSVLKKDVKKKQILDEFLQHCEKKQIEAIQKNDPLLLCTWIKEARLARRELIALYREKEKHDTQLERDRKSILGIVEHLKSRGINASTVGRAHHSTLSEECY
>NZ_CP009351.1|WP_000123129.1|432361_433009_+|sigma-70-family-RNA-polymerase-sigma-factor
MTAEELFKEKQYLVIAAIKQQFGSIARAGQIAEINNMDLEDLIQVGHLYLWEHCVNYDPERVDTFNAYVMKGMKWAMSDELHLKGTPFKISRRVGHEERNKMNIHSIDLHRDEETVNEFYAVSPIDVEEEVMLSIEFEEVTSVLEEKEKSIILHVGEGYTTEEIAIKLEMKKSTVHTRKTRAFLKMNPDYKPLKQKSFFLGKRMIKRNHQLGLVI
>NZ_CP009351.1|WP_014895311.1|433253_434258_+|hypothetical-protein
MNTNVIKVARINLQGNTLDQGWFKYLTLENGKPYMVAITILSEIFYWYKPTEIKDERTNEIQYKQKFKADKLQKSYQQLADSFGFTKRQVQEACKDLVKRELIAIEFRTIIVNGTRHNNVMYVEPIVKNIEKISILYQDPITSESDTLPHSNERDSHIKTKEALTLKRGTNTKITTEITTNKKTSCHKFETCDMEHAKLLFQLILETNSEHKEPNFEKWANEFRLIRERDKKTNQQIVYLLEWSQNHSFWKKNILSPSKLRKQWDRLVIEAKEEHEVKKNEQIRKHSGSHGRFAKEGYEKLPEPTRTWRELTEKEREESQQEYENNIEWLGEDA
>NZ_CP009351.1|WP_000705175.1|434220_435033_+|ATP-binding-protein
MKITLNGSEKTLNDTCPLCSGTGIILNGWTGKMCDCQKKQSEIARLKNAMIPEEFEEARFKNYIRHTDMQKKMFNSMMEYLKKFNEIRDTKRNSFGYIATYGEARLKALSIDERVEKMKLHNNYGLGKTHLQIAAARWIIQNVQTVNKDIVNAQPRGCRVVCISDVTFMTEIMSAKRDDKKEYFEKLHTVVDYADVLVWDDLGKSKHTESREEMYYEIINERYKRKAPIIFSSNEDEYTLPEKIGFAAADRLLGMANDYLIEVEGESYRR
>NZ_CP009351.1|WP_000436950.1|435074_435341_+|hypothetical-protein
MEQLTFEDIVGNMDYTAHSTAAKFLSNHSVTPTYAVEFFDRDKKQKLRWFEVNTEGEAKEMAEETYGRIQIIKVYVSNRTLKEIMELD
>NZ_CP009351.1|WP_000817807.1|435412_435577_+|DUF3954-domain-containing-protein
MKREIDMKTNGIYIVVDGKINFEEPPKSGYGQQVLYWVKGKVSHTQTTITKKFK
>NZ_CP009351.1|WP_001025406.1|435594_435810_+|hypothetical-protein
MNIQEATKLAMEQNKFISRLHFMKTFKVKIKPTNTYELCGNYPIYPNEFKPRRAWNPCADDLIADDWIIVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009351_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009351_2

3224236-3224311

Orphan

Consensus_repeat	Method
TGATTGTGTCCTCCATGGTGATGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009351_2

>merge|NZ_CP009351|2|3224236-3224311|CRISPRCasFinder
TGATTGTGTCCTCCATGGTGATGATGTCCGCCGTTATGATTGTGCCCACCATGATTGTGTCCTCCATGATGATGAT

>NZ_CP009351|2|2|3224236-3224311|CRISPRCasFinder
TGATTGTGTCCTCCATGGTGATGAT	GTCCGCCGTTATGATTGTGCCCACCA
TGATTGTGTCCTCCATGATGATGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009351.1\|WP_000743027.1\|3224561_3226091_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|171510
NZ_CP009351.1\|WP_000656109.1\|3215971_3217633_-\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP009351.1\|WP_000893348.1\|3221808_3223512_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP009351.1\|WP_001248844.1\|3227115_3228999_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226921
NZ_CP009351.1\|WP_000193671.1\|3212244_3213747_+\|spore-germination-protein	unknown	unknown	gnl\|CDD\|377020
NZ_CP009351.1\|WP_000885973.1\|3231932_3232664_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009351.1\|WP_000513939.1\|3217646_3219074_-\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP009351.1\|WP_000401661.1\|3211234_3212056_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|225213
NZ_CP009351.1\|WP_000387173.1\|3209464_3210925_-\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP009351.1\|WP_000892989.1\|3226218_3227112_+\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP009351.1\|WP_001189930.1\|3229036_3229459_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NZ_CP009351.1\|WP_003309076.1\|3211084_3211228_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000448446.1\|3220379_3221777_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129983
NZ_CP009351.1\|WP_000925213.1\|3234584_3235589_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP009351.1\|WP_000185806.1\|3213727_3214834_+\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP009351.1\|WP_000723120.1\|3229518_3230484_-\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|187580
NZ_CP009351.1\|WP_000760052.1\|3233529_3234588_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP009351.1\|WP_000095913.1\|3230528_3231719_-\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893
NZ_CP009351.1\|WP_000987242.1\|3219216_3219927_-\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP009351.1\|WP_001167972.1\|3232695_3233517_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045

Protein	Function_ID	Function_description	E-value
NZ_CP009351.1\|WP_000743027.1\|3224561_3226091_+\|cardiolipin-synthase	gnl\|CDD\|171510	PRK12452, PRK12452, cardiolipin synthase.	0
NZ_CP009351.1\|WP_000656109.1\|3215971_3217633_-\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP009351.1\|WP_000893348.1\|3221808_3223512_-\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	2.99317e-109
NZ_CP009351.1\|WP_001248844.1\|3227115_3228999_+\|VWA-domain-containing-protein	gnl\|CDD\|226921	COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism].	1.90481e-97
NZ_CP009351.1\|WP_000193671.1\|3212244_3213747_+\|spore-germination-protein	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
NZ_CP009351.1\|WP_000885973.1\|3231932_3232664_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.07831e-20
NZ_CP009351.1\|WP_000513939.1\|3217646_3219074_-\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP009351.1\|WP_000401661.1\|3211234_3212056_-\|phosphotransferase	gnl\|CDD\|225213	COG2334, COG2334, Putative homoserine kinase type II (protein kinase fold) [General function prediction only].	2.62392e-28
NZ_CP009351.1\|WP_000387173.1\|3209464_3210925_-\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
NZ_CP009351.1\|WP_000892989.1\|3226218_3227112_+\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	6.9487e-37
NZ_CP009351.1\|WP_001189930.1\|3229036_3229459_-\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	1.7486e-24
NZ_CP009351.1\|WP_000925213.1\|3234584_3235589_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.49512e-87
NZ_CP009351.1\|WP_000448446.1\|3220379_3221777_+\|amino-acid-permease	gnl\|CDD\|129983	TIGR00905, Arginine/ornithine_antiporter, transporter, basic amino acid/polyamine antiporter (APA) family. This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines].	1.33606e-97
NZ_CP009351.1\|WP_000185806.1\|3213727_3214834_+\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	6.39068e-40
NZ_CP009351.1\|WP_000723120.1\|3229518_3230484_-\|L-threonine-3-dehydrogenase	gnl\|CDD\|187580	cd05272, TDH_SDR_e, L-threonine dehydrogenase, extended (e) SDRs. This subgroup contains members identified as L-threonine dehydrogenase (TDH). TDH catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. This group is distinct from TDHs that are members of the medium chain dehydrogenase/reductase family. This group has the NAD-binding motif and active site tetrad of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP009351.1\|WP_000760052.1\|3233529_3234588_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	8.98999e-88
NZ_CP009351.1\|WP_000095913.1\|3230528_3231719_-\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NZ_CP009351.1\|WP_000987242.1\|3219216_3219927_-\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.60325e-130
NZ_CP009351.1\|WP_001167972.1\|3232695_3233517_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	8.44295e-133

>NZ_CP009351.1|WP_000893348.1|3221808_3223512_-|EAL-domain-containing-protein
MLEQRGHALYDSSLRDLKLALDESSIVAITDRKGLITYVNDKFCEISKYKREELIGKDHRILNSGHHPKTFFQNLWKRILNGKVWTGEIRNRAKDGTYYWVKTTIVPFLNEKGEPYQFIAIRNDISSRKEAEHRLRLSESRYRELAYHDALTSLPNRLQLITTVNKLIADKKEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGGDEFVLLTKNHRQDDMSQLATSVLSCFQAPFMLEGHEVYISASLGLCSYPQDGLDVETLLKNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKVEFALQKAIRDEELDVALQPIIDLKTKRYSGIEALVRCMTEDGPIAPSEFIPVAEESGLIIKLGDWVLEKSCRLFKTLPNYQEGLKLSVNLSIQQLMQKRFILSVRSILKRTGFPPNRLILEITESIAVRHFDYIIATLQELRNMGVLIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAHSLNLAVVAEGVETVEQESLLQSMSCDYVQGFYYAKPLSVGELKEKLITDF
>NZ_CP009351.1|WP_000448446.1|3220379_3221777_+|amino-acid-permease
METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWSITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAATASVIISFAGYLSTFFPVLQSKQILFSINGFSLELGKGLTFLVCSLMLWGIQYILSQNIDRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAIATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALPQDALKESQKPLVDALNLAIGNKGAYIMALLALISLFGSTVGWIVVSSEVPYQAAKNGLFPKFFGKTNKKGSPSKSLLITNVMTQIFLFSTISGTVSEAYSFAIVVATLAYLIPYLVSTLYQFKLVITGETYDIMPGSRIKDGIITTLAFVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLMKDSQKTD
>NZ_CP009351.1|WP_000987242.1|3219216_3219927_-|trehalose-operon-repressor
MMSKYEQIYTEISKSIDNKQLKEGCKIPSETELMKQYEASRGTVRKAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEMDKEKATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEFIPGLTKEIATASIYKYIEKELGLHISYSQRVIEVQPCTEDDRKYLDLNGTDYVVVVKNFTHLYDGSQFEYTESRHRLDIFHFSDVARRK
>NZ_CP009351.1|WP_000513939.1|3217646_3219074_-|PTS-system-trehalose-specific-EIIBC-component
MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDNDKLQSVSLVKGAFHNAGIFQVVIGPGDVDRVYAELITLAGMEESTVADVKDSGNQKLNPAQKFVKIFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLGGLWDLINMMANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLEGQKIEYFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGVLALGIIGPVTRHIGDLLTVGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQLIAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGVNLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMIIAVVIPFTLTWLFAKRVKQK
>NZ_CP009351.1|WP_000656109.1|3215971_3217633_-|alpha,alpha-phosphotrehalase
MKDWHKSVVYQIYPKSFNSYYNKETGDIKGVTEKLDYLKELGVDYIWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLAEAKVRNIEIMLDIVVNHSSTEHKWFKEAKEDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTEQYYLHLFDETQADLNWENEQLREEVYDMMRFWLDKGVTGFRLDVINLISKDQCFLNDEGNTATSDGRKYYTDGPRVHEYLQEMNRKVFAGKDVITVGEMSSTTIDNCIKYSNPERNELSMTFSFHHLKVDYPNGDKWTKAEFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGDDRKYRNESAKMLATAMHMLQGTPYIYQGEEIGMTNPKFESIEQYRDVESLNIYDIKREEGLSKEEIIGILKQKSRDNSRTPMQWNEEMNSGFTTSTPWISVAENFTEINVEKALEDKESVFYHYKKLIELRKTYDVITEGEYAILDKNDPKIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQLDGMKQEVLLSNYKDASKDIAKLNLRPYESIVYRYTK
>NZ_CP009351.1|WP_000185806.1|3213727_3214834_+|GerAB/ArcD/ProY-family-transporter
MTNTQSKISLVQLTFFVIQCQIGVGILSLPNRLHPIAKGGGWISVLIAGLATQLIILLMWFLLRRFPDANMYEIACMMFGNKFGKLLGFSYVFYFTLIGMTVMLNACTVIKIWILQATPWYAILLLFTIACCYVAYNTFKVIVRFYVMASILILPMALLIGLGLSRADFSYIFPITEAGWWNIIKASKETITAMYGFEIFLIAFPKVNGTAVAKLKAISIANGFVTLFYAFTVWICFIVFSPKQVELIPEPVAYLLRSLHIGIVDRTDLIFIPIWMITVVASIASCYAAASIGIGHIFNLANHKKSVPIVGVISFSIALFIDTPEELKLIANFTDKFTYIFIIVLPFLFLLYSLLRNKKGAPYAQKNS
>NZ_CP009351.1|WP_000193671.1|3212244_3213747_+|spore-germination-protein
MTQQEEQQKSKNQKHMFPSLPENINYIENKLCHSDDIKKLDIPFQNGKGIILYIESLADPNLIHQLALEPLLTRSDLSLDKAFSTLNMKKETNLNYGVQLLLQGKSLYFHEHVESFCTFETALSLKRAITEPDNEGIVRGPHTGFVEDLATNLASIRKLIKSPNVVVKYFTLGEEMHTKVAITYIQNIANDDLVAEVKRRLEMIKTDALMPPGYIQEFIEDTSFSPFPQQLNTERPDRTAANLMEGRVAILSDGDPTALIVPVTLFAFYQSPDDYNNRWIVGSFVRMIRLVSFLIAFLLPAIYIATVAFHPDVLPLELVYTIKASLEQVPLPPIFEALLMELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAIASFLVPSNDMSSAVRILRFPLMVLAAIFGYVGISFGIIITFVHLCQLHSFHTPYLSPLAPMRIKDMKDSFVRFPIWSFWERPHDSKPKKMQRQHVTREDENGDKHAK
>NZ_CP009351.1|WP_000401661.1|3211234_3212056_-|phosphotransferase
MEIAVERVFTKEILRRAAKAFHVTVEEKPLGDFENYIFKAKGDNDEDYVLRLTHSSHRSKKEVEAELDFLRYVAEHGAKVAGPLNSTSQNLVEEIGAEDSTFFFASLFTYAKGEQVKGEGSPYWGDDYFEAWGKAIGQLHRLTMSYPKTDYRDTWEEDESGIVNELEDDQVKKIAAVLMDEIKALPVERETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYNYFIHDLAMVLYYSILFTPWTAEEKTDFARKQLQVLRKGYEHEHRLADSWYE
>NZ_CP009351.1|WP_003309076.1|3211084_3211228_-|hypothetical-protein
MFLRLRDVGLYGTLQKKFKGKGMPDNFRELSEELYERIIKREAIVNI
>NZ_CP009351.1|WP_000387173.1|3209464_3210925_-|alanine:cation-symporter-family-protein
MEAFVNWLNNIVWSPALVYLCLGVGLYFSIRTRFLQVRHVGEMVKLTFQGEKSEAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAGSAYIESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGLLLPGVQANSIAVSLETAFGINTTVSGVLLVVVLAIIIFGGVKRIVNVAQVVVPFMAVGYILVACVIVAMNIEKLPEAFMLIIRSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGPHAAAAAEVSHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKNFIVNKLNGAQPGPGYTQAAVESVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWLSIVLKFVFLGAVFYGCIKTAATAWALGDIGVGIMAWVNIIAILLLQKPALVALKDYEKQKKEGKDPVFDPQPLGIKNADFWEHEYGKDKKEEVS
>NZ_CP009351.1|WP_000743027.1|3224561_3226091_+|cardiolipin-synthase
MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFPGKEISHAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEKDFKHSTEIKWNSFQKRSIKKRILESFMRLISPLL
>NZ_CP009351.1|WP_000892989.1|3226218_3227112_+|MoxR-family-ATPase
MLEQFHIHSDLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSIIEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTLQTKDGASEVSFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQEVVYGDEEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLNDVATIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDETEQMTVRELAESYFFEG
>NZ_CP009351.1|WP_001248844.1|3227115_3228999_+|VWA-domain-containing-protein
MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIEKKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQLFVLLEDLRVEEIVKNLRPGTKHIFKRRKEMYRNYFGSQNEINRVRNYHGDRLFCLCYLSLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYVVEKIRYRLEALLESDMLNNYFGHAPLYLSVLADEKNCRVEDLANDDTQLIDDDENKNKMDESFSTWHRENKNNENENFLRFELESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQHDGAYGKYNVGASHTFKEARKANIDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANNDKYYGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFHEALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVNYKNSTLPNVGPEIMQLREEEDNRDGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIGIFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE
>NZ_CP009351.1|WP_001189930.1|3229036_3229459_-|NUDIX-hydrolase
MQRVDVVYALIHDEETDKILMVHNAEQNVWSLPGGAVEKGEILEEALIREVKEETGLIATLGGLVAINEKFFEESGNHALFFTFRANVVKGELIAEDEGEISAIEWVDRTIANERFPYYDGGFESLLEVAIPYKFQPETK
>NZ_CP009351.1|WP_000723120.1|3229518_3230484_-|L-threonine-3-dehydrogenase
MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVKSGPFETLDVTDGQKLHDIAKHNEVDTIIHLAALLSATAEKNPLFAWNLNMGGLVNALEAARELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPTTMYGVNKVAGELLCDYYHQKFGVDTRGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKGAYTSYIAEGTYMDMMYMPDALQAIISLMEADPSKLVHRNAFNITAMSFEPEQIAASIRKHIPTFTMDYAVDSARQTIADSWPNSIDATAAMKEWGFKAEYDLDKMTTDMLAKLKKKLTAELVMN
>NZ_CP009351.1|WP_000095913.1|3230528_3231719_-|glycine-C-acetyltransferase
MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYINLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQKAIAAKESGLYNKLMVITDGVFSMDGDVAKLTEIVEIAEELDLMTYVDDAHGSGVLGKGAGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTALTPADAAACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEFSKRLNEEGVYAKSIVFPTVAKGKGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII
>NZ_CP009351.1|WP_000885973.1|3231932_3232664_+|class-I-SAM-dependent-methyltransferase
MAFTESDVYNNTAFFEQYMKRRYRENSPNESIEKPVFFQLIGHVQGKQILDLGCGDAKFGAELLEKGCYSYTGIEGSELMYEKAKNQLENKNGSVHFLNLKDYTYPSSTFDLVTSRLALHYIEHLDTIFQNVFQTLKTNGTFTFSVQHPVITSSFESLQTSGKRTSWLVDDYFKLGKRVEPWIDQEVIKYHRTTEEYFTLLQQAGFTITSLKEATPNPIYFQNEEEYKRRLRIPLFLLFSCTK
>NZ_CP009351.1|WP_001167972.1|3232695_3233517_-|ABC-transporter-ATP-binding-protein
MQKALETKRLTLSYGETSIIDELNLEIPKGEITIFIGSNGCGKSTLLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRYPYQTWLKQWSEKDEEMVQKALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIILLDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQGKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGRGRRVVKEVAQAIR
>NZ_CP009351.1|WP_000760052.1|3233529_3234588_-|iron-ABC-transporter-permease
MKKYIPFRIGKGELSFLMYKRACLVLLSLLLVLIGLFFASAGMGDMKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLASPDIIGITGGASVAVVLFLALFSDKNNALTVSIHYMPLAAFAGATIVAVFVYLFAWQNDGLSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWVLILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRVFMLLLSTALIGGAVAFAGGIGFVGLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTIFTPLEIPAGVFTSAIGAPYFIYLLYKSRNS
>NZ_CP009351.1|WP_000925213.1|3234584_3235589_-|iron-ABC-transporter-permease
MLLKTNRAKGIGLFVGIIAVVICIWGSIIFGYTNTSWKLALDAFFHFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFFIVVAIVIFSVTSLSAFTWIAFLGAAVAAVLVFASSSLGKEGTTPLKLTLAGVAISALFSSLTQGLLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASLIMAGKVNTLMMGEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIITPHFARFLVGVDHRWRVPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009351_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009351_3

4128951-4129084

Orphan

Consensus_repeat	Method
GACAAATCTCAAAAAGAAGAGAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009351_3

>merge|NZ_CP009351|3|4128951-4129084|CRISPRCasFinder
GACAAATCTCAAAAAGAAGAGAAGTCAACGAGCACGAAACCAGAAAATAAAACAGAAGACAAGTCTCAAAAAGAAGAGAAATCAACAAGCGGTTCAACTAGTGACAAAAAAGAAGAACCGAAGAAAGAAGAAAA

>NZ_CP009351|3|3|4128951-4129084|CRISPRCasFinder
GACAAATCTCAAAAAGAAGAGAA	GTCAACGAGCACGAAACCAGAAAATAAAACAGAA
GACAAGTCTCAAAAAGAAGAGAA	ATCAACAAGCGGTTCAACTAGTGACAAAAAA
GAAGAACCGAAGAAAGAAGAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009351.1\|WP_001207164.1\|4134033_4134735_+\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP009351.1\|WP_003272396.1\|4121948_4122659_+\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP009351.1\|WP_000411275.1\|4122698_4124003_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP009351.1\|WP_000672657.1\|4124211_4125231_+\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP009351.1\|WP_000144420.1\|4127360_4128068_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP009351.1\|WP_000008903.1\|4129277_4129412_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000457978.1\|4130153_4131155_+\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP009351.1\|WP_000170827.1\|4126518_4127361_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009351.1\|WP_000393115.1\|4133300_4134044_+\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP009351.1\|WP_000544012.1\|4129720_4129993_+\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP009351.1\|WP_000243437.1\|4125329_4126337_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009351.1\|WP_014894859.1\|4134846_4135614_+\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NZ_CP009351.1\|WP_000467945.1\|4132359_4133037_+\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP009351.1\|WP_000568213.1\|4116580_4118443_+\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP009351.1\|WP_000931959.1\|4131583_4132018_+\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP009351.1\|WP_000757801.1\|4135853_4136732_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP009351.1\|WP_000847747.1\|4136750_4137410_+\|sugar-transferase	unknown	unknown	gnl\|CDD\|274398
NZ_CP009351.1\|WP_000367477.1\|4119943_4121464_+\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP009351.1\|WP_000998960.1\|4118439_4119942_+\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP009351.1\|WP_000057889.1\|4121666_4121903_+\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173

Protein	Function_ID	Function_description	E-value
NZ_CP009351.1\|WP_001207164.1\|4134033_4134735_+\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	8.02666e-84
NZ_CP009351.1\|WP_003272396.1\|4121948_4122659_+\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	1.11897e-33
NZ_CP009351.1\|WP_000672657.1\|4124211_4125231_+\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	6.60741e-135
NZ_CP009351.1\|WP_000144420.1\|4127360_4128068_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	3.22291e-09
NZ_CP009351.1\|WP_000411275.1\|4122698_4124003_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP009351.1\|WP_000457978.1\|4130153_4131155_+\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP009351.1\|WP_000170827.1\|4126518_4127361_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.14749e-90
NZ_CP009351.1\|WP_000393115.1\|4133300_4134044_+\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	1.97657e-83
NZ_CP009351.1\|WP_000544012.1\|4129720_4129993_+\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP009351.1\|WP_000243437.1\|4125329_4126337_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.63553e-31
NZ_CP009351.1\|WP_014894859.1\|4134846_4135614_+\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	4.47552e-106
NZ_CP009351.1\|WP_000467945.1\|4132359_4133037_+\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	5.32085e-82
NZ_CP009351.1\|WP_000568213.1\|4116580_4118443_+\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP009351.1\|WP_000931959.1\|4131583_4132018_+\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP009351.1\|WP_000757801.1\|4135853_4136732_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NZ_CP009351.1\|WP_000847747.1\|4136750_4137410_+\|sugar-transferase	gnl\|CDD\|274398	TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.	9.86921e-99
NZ_CP009351.1\|WP_000367477.1\|4119943_4121464_+\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	1.04015e-150
NZ_CP009351.1\|WP_000998960.1\|4118439_4119942_+\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	1.2119e-172
NZ_CP009351.1\|WP_000057889.1\|4121666_4121903_+\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23

>NZ_CP009351.1|WP_000144420.1|4127360_4128068_+|ABC-transporter-permease
MTFSMKRFSAIVRKEINDAGKNSQVILMALLPILLAVFYSNMDSIKEFFAGFVIVMTITMVGSYVQAIIIAEEKEKHTLRVLMLSPASPIEVILGKSVLTVFFVLASSFISLVILDTFKGNIGMLVIIILIGTLLCVVLGTIVGLLSQNIAQTSILGLPIFIIFIMGPMLQEMVKNEFIIKVVNLLPTNHVMEALQKVIKGEGFIAIQEHILNNTIWTICLIILCIIVYKKKQLD
>NZ_CP009351.1|WP_000170827.1|4126518_4127361_+|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFDGKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNEEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIEVVLKDKQKEVVQKDELGAKRISEWMKKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP009351.1|WP_000243437.1|4125329_4126337_+|ATP-binding-cassette-domain-containing-protein
MVLLELKQLGKTNQLPVIDLKVAKGQCVVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGGAIGKKNYPRIGFCFLKDEAYDRLKVKEYFKFLIGLYESKISIEEVVQSVGLLDKLNVKIEKLSFSEKRRLHIGRVMIHNPDLVILEEPEQNVDIESTIIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKIEIEQEEVEEVGEEKVIQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP009351.1|WP_000672657.1|4124211_4125231_+|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVESLPMEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKEELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQRGDKIIITTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP009351.1|WP_000411275.1|4122698_4124003_+|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP009351.1|WP_003272396.1|4121948_4122659_+|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKDKANIQKWEVEQSPDGYKATSYKKFASHEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQKVNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP009351.1|WP_000057889.1|4121666_4121903_+|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP009351.1|WP_000367477.1|4119943_4121464_+|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASALILCIAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKNRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGATTPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTLDSMWFYMLAYMLMNIGAFAIIHGLILQNDKENITIFTGLYKKSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP009351.1|WP_000998960.1|4118439_4119942_+|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTSKKELRTVRALGLFGTALPFGIAIVLACTYASGKSLSLFDEKVKWIKFGDFTAVDKRWFSIYYELGIDGLSLIMMVLTALLAMLAAIAAFSIKSNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFLEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVSAGGELVIPSSLQLGVFIAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGTFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDIMVLGGLAKSVPILSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEYVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP009351.1|WP_000568213.1|4116580_4118443_+|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGALPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASAVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYFLFVLAVIAAFLTAFYMFRLYFLVFTGEAKTKEDVHESPRVMKYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYGKKSISREWAGGTGTSFYNLLKEKYYVDELYNMTVIPITKGIARVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR
>NZ_CP009351.1|WP_000008903.1|4129277_4129412_+|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEELEREE
>NZ_CP009351.1|WP_000544012.1|4129720_4129993_+|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP009351.1|WP_000457978.1|4130153_4131155_+|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NZ_CP009351.1|WP_000931959.1|4131583_4132018_+|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP009351.1|WP_000467945.1|4132359_4133037_+|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLMQCIQKTDIENVYLMAAGPIPPNPAELLGSRAMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKLLGVVLNDKREEKEQYGYY
>NZ_CP009351.1|WP_000393115.1|4133300_4134044_+|capsular-polysaccharide-biosynthesis-protein
MEETISLKELFHIFKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMFQAGEIQTNIQLTNTYKVIIKSPVILEQVNEKLNLNMTAQELTKKVNVANEKDSQVIAVTAEDKDPKIARDIANATADVFKGEVAKIMNVDNVTVISKAEVAENQSPIKPAPMLNIAIAFIVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPSSRKVRGQTIGS
>NZ_CP009351.1|WP_001207164.1|4134033_4134735_+|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>NZ_CP009351.1|WP_014894859.1|4134846_4135614_+|tyrosine-protein-phosphatase
MIDLHCHILPGIDDGAQTITDSLTMAQQAVSEGIHTIVATPHHQNGKYINEYTSVIHHVKQLNDELQQYNIPLTILPGQEIRLYGDLLEDYEAGKIVTLNETNKYIFIEFPSNHVPRYAEHLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGNFGKKIKKFSLQLVEHNLTHMVASDAHNTTSRGFHLAESYELIEKEFGTSVMSDLKENPYLLISGKAIYKEDPEQIRRKKLFGIF
>NZ_CP009351.1|WP_000757801.1|4135853_4136732_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQAETPCLRQLMNQYEGTQSSVIGVQTVPENETHRYGIIDPIERNGRSYQVRQFVEKPAEGTAPSDLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEMQRVFAYDFEGTRYDVGEKFGFIRTTIEMALQQKELKEQLIKYMVELVHKEAIK
>NZ_CP009351.1|WP_000847747.1|4136750_4137410_+|sugar-transferase
MKTGENIARDYQITPDTQTIQVESNQSKIYLGIKYLLDVMFSLVGLILLMPVILIFSILIILESPGSPFYLQERLGLNGKRFKVIKLRSMRNDAEKNGAKWAEKNDPRVTKIGLFIRKTRIDELPQLFNILKGDMSLVGPRPERPIFTEKFERDIPGFKKRLEVKPGLTGWAQVNGGYEITPKEKLNLDVYYINHASIILDFKIIIKTVRVVITGDGAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009351_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009351_4

4384412-4384528

Orphan

Consensus_repeat	Method
AAGAAAAATGGAGAATTAATCAAACGCTTGTTTAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009351_4

>merge|NZ_CP009351|4|4384412-4384528|CRISPRCasFinder
AAGAAAAATGGAGAATTAATCAAACGCTTGTTTAAGCTGTATGTTCGGTAGAAAGAAACTCATGTAGTTCAAAGGTTAACGAAGAAAAATGGAGAATTAATCAAACGCTTGTTTAAG

>NZ_CP009351|4|4|4384412-4384528|CRISPRCasFinder
AAGAAAAATGGAGAATTAATCAAACGCTTGTTTAAG	CTGTATGTTCGGTAGAAAGAAACTCATGTAGTTCAAAGGTTAACG
AAGAAAAATGGAGAATTAATCAAACGCTTGTTTAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009351.1\|WP_000486369.1\|4373556_4375938_+\|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|224170
NZ_CP009351.1\|WP_002008874.1\|4377502_4379305_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173850
NZ_CP009351.1\|WP_001180555.1\|4380253_4380439_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000359401.1\|4388829_4389495_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP009351.1\|WP_000218968.1\|4384723_4385089_+\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP009351.1\|WP_000826875.1\|4383784_4384312_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_001242142.1\|4387053_4387398_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009351.1\|WP_000640870.1\|4386244_4386589_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224572
NZ_CP009351.1\|WP_000666176.1\|4381919_4382933_+\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP009351.1\|WP_000864824.1\|4379420_4380140_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293807
NZ_CP009351.1\|WP_000735090.1\|4389518_4390331_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP009351.1\|WP_000568179.1\|4386601_4386901_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP009351.1\|WP_106081637.1\|4380727_4381897_+\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427
NZ_CP009351.1\|WP_000929162.1\|4391447_4392233_+\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP009351.1\|WP_000026896.1\|4385130_4385514_+\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP009351.1\|WP_001002987.1\|4380452_4380701_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP009351.1\|WP_000713769.1\|4382992_4383640_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP009351.1\|WP_001206329.1\|4375959_4377132_+\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|181072
NZ_CP009351.1\|WP_000601782.1\|4387811_4388837_+\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP009351.1\|WP_001226751.1\|4390402_4391209_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381

Protein	Function_ID	Function_description	E-value
NZ_CP009351.1\|WP_000864824.1\|4379420_4380140_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293807	cd07721, yflN-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis yflN; MBL-fold metallo hydrolase domain. This subgroup includes the uncharacterized Bacillus subtilis yflN protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	6.40912e-64
NZ_CP009351.1\|WP_000486369.1\|4373556_4375938_+\|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|224170	COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism].	5.25516e-83
NZ_CP009351.1\|WP_002008874.1\|4377502_4379305_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	0
NZ_CP009351.1\|WP_000359401.1\|4388829_4389495_+\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	8.57648e-99
NZ_CP009351.1\|WP_000218968.1\|4384723_4385089_+\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.13259e-61
NZ_CP009351.1\|WP_000735090.1\|4389518_4390331_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	6.69253e-111
NZ_CP009351.1\|WP_000640870.1\|4386244_4386589_+\|hypothetical-protein	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21
NZ_CP009351.1\|WP_000026896.1\|4385130_4385514_+\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	6.96592e-70
NZ_CP009351.1\|WP_106081637.1\|4380727_4381897_+\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP009351.1\|WP_000568179.1\|4386601_4386901_+\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	2.00054e-18
NZ_CP009351.1\|WP_000929162.1\|4391447_4392233_+\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	5.15323e-150
NZ_CP009351.1\|WP_000666176.1\|4381919_4382933_+\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.25572e-86
NZ_CP009351.1\|WP_001002987.1\|4380452_4380701_+\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	9.62029e-15
NZ_CP009351.1\|WP_000713769.1\|4382992_4383640_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	8.02684e-16
NZ_CP009351.1\|WP_001206329.1\|4375959_4377132_+\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|181072	PRK07661, PRK07661, acetyl-CoA C-acetyltransferase.	0
NZ_CP009351.1\|WP_000601782.1\|4387811_4388837_+\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	2.96413e-176
NZ_CP009351.1\|WP_001226751.1\|4390402_4391209_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	5.121e-112

>NZ_CP009351.1|WP_000826875.1|4383784_4384312_+|hypothetical-protein
MKRLSYFLFFILICLVGAGCAKDKEGEKLEYNGRALVIGVVGEKPKDTFRNVKFEEMKLEALEKKSKEVDGFLIMKDHFQEASTEQYKNVFSSLKKPVFFIGLQDKLYSIFITKGIEYNSARKDVNAMYTQGFANIGSGEGQQWAIGLSNGGNTEESIHNMYIVVFQTIADYLNR
>NZ_CP009351.1|WP_000713769.1|4382992_4383640_-|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSTVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSVIFGKLACFSIYYFWQTTVPRPTVVGTDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHAFEYYILTFFGTLIILSTLFTKQHAFLDAVSGMTLASILYFGVQLLLAKEPIKVPVKQNHKM
>NZ_CP009351.1|WP_000666176.1|4381919_4382933_+|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNTVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVVPAMVITYIIIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NZ_CP009351.1|WP_106081637.1|4380727_4381897_+|L-lactate-dehydrogenase
MRSFYFLYVNKYIINIFPVVTNMTKMEYNNSQKGQKLCSIFHKVSMVSIVGTSIIKNVKNKRNRLYDQLGEIAMKRHTRKIAIIGTGLVGSSCAYSIVNQGICEELLLIDINHERAVGEAMDLSHCINFTNTRTKVYAGSYEDCKDMDIVIITAGPAPKPGQSRLDTLGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYEVWKLSGLPRNRVIGTGTSLDSSRLRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKERFGEIDLDEIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYGEYDICTGVPAIITRDGIREVVELNLTEDEESRFAKSNDILRDYMKTIGY
>NZ_CP009351.1|WP_001002987.1|4380452_4380701_+|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE
>NZ_CP009351.1|WP_001180555.1|4380253_4380439_+|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLEQYAQTCTDPQLKQMLQKDAQDARNTKQQLMTFLG
>NZ_CP009351.1|WP_000864824.1|4379420_4380140_+|MBL-fold-metallo-hydrolase
MKVISVGTVHQIAFLPRLFPINCYFVEEETGLTLIDAALPFCAKKILQSARKIGKPITNIVITHAHDDHVGALDVIKQVLPDVPVYISKRDACLLEGDKVLQEGERNTPIKVGVSKQINTIPDILLQEGDKVGSLVAIGAPGHTPGSMAFLDTRNDALIVGDAFQTRGGLAVAGQLKWLFPFPMFGTWDAEVSLASAQKLLEYKPSLLATGHGKMIENPLIQMQRAIEEAERNLSRKSL
>NZ_CP009351.1|WP_002008874.1|4377502_4379305_+|acyl-CoA-dehydrogenase
MKEEIFMEKTVGNAVKGGSFLVDEITIDQVFTPEDFSSEHKMIAKTTEDFIVNEVLPELEYLEQHEFDRSVRLLKEAGELGLLGADVPEEYGGIGLDKVSSALIAEKFSRAGGFAITHGAHVGIGSLPIVLFGNEEQKKKYLPLLATGEKLAAYALTEPGSGSDALGAKTTARLNAEGTHYVLNGEKQWITNSAFADVFIVYAKIDGEHFSAFIVEKEYAGVSTSPEEKKMGIKCSSTRTLILEDALVPKENLLGEIGKGHIIAFNILNIGRYKLGVGTVGSAKRAVEISAQYANQRQQFKQPIARFPLIQEKLANMAAKTYAAESSVYRTVGLFESRMSTLSEEEVKDGKAVAASIAEYAIECSLNKVFGSEVLDYTVDEGVQIHGGYGFMAEYEIERMYRDSRINRIFEGTNEINRLIVPGTFLRKAMKGELPLLQKAQKLQEELMMMMPEEVGDEPLALQKYLVTNAKKIGLMVAGLAAQKYGKALDKEQEILVNIADIVSNLYAMESAVLRTEKAIKTTGLEKNKQKVLYTEVFCQEAFNEIEADAKETLIAVENGDMLRMMLSSLRKLTRHTPLNVIPKKREIAAKILEDERYTV
>NZ_CP009351.1|WP_001206329.1|4375959_4377132_+|acetyl-CoA-C-acetyltransferase
MREAVIVAGARTPIGKAKRGSLKTVRPDDLGALVVKETLKRANYEGPIDDLIFGCAMPEAEQGLNMARNIGGLAGLSYDVPAITINRYCSSGLQSIAYGAERIMLGHSEAVLSGGAESMSLVPMMGHVVRPNSRLVEAAPEYYMGMGHTAEQVAVKYGISREEQDAFAVRSHQRAAKALAAGNFADETVSVDVTLRSVGSNNKLQEETIIFAQDEGVRAETSLDILGKLRPAFNVRGSVTAGNSSQMSDGAASVLLMDREKAVSDGMKPLAKFRSFAVAGVPPEVMGIGPIAAIPKALKLAGLELSDIGLFELNEAFASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLIHEMKRRNEQFGIVTMCIGGGMGAAGVFELL
>NZ_CP009351.1|WP_000486369.1|4373556_4375938_+|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein
MFQIKKAAVLGSGVMGSGIAAHLANIGIPTLLLDIVPPALTKEEEAKGLTLEHKSVRNRFSNTAVQKLLKQKPAPLTVKGNLALIEAGNLEDDLERLADVDWIIEVVVENLDIKKKLFEKVDAVRKPGSIVSSNTSGISVEKMAEGRSDDFQKHFLGTHFFNPPRYLKLLEVIPTKETDPQVLSFMKLFGEDVLGKGVVIAKDTPNFIGNRIGTYGLLVTLQEMIKRGYSIGEVDSVTGPLIGRPKSATFRTLDVVGLDTFVHVANNVYENVQEEERDVFKVPAFMHDMLEKKWLGSKTGQGFFLKQGKEILELNPETMEYEARKKLKAASVELSKQEKGLANKLKALVYAKDRAGELLWNIITPTLLYSAKLHKEIADDIVAIDQAMKWGFGWEQGPFEVWDAIGVEKSVQKMEENGVVVPTWVKEMLEKGFTTFYKHDNGDSYYYDNGEYKLIERNKKAISLKQLKAKNGVLKKNSGASLIDLGDGILCLEFHSKSNAIGMDITQMINYAVDEVEKNYKGLVIGNQSKNFCVGANLAMILMEAQDDNYFEIELVVKNFQDAMTKIKYSSKPVVAAPYGMTLGGGTEVCLPAASIQASSETYMGLVEVGVGLIPGGGGNKELYIKHLNKMPNGVEFDLQKVANKVFESVAMAKVSTSAQEAVSNNFLGDKDGISVNGDHLLYDAKQKALALYEAGYKAPIRKKIPVVGETGYATLVLGAEAMHLSGYISEHDLHIAKKLAYVIAGGKVPYGTEVDEQYLLDVEREAFISLVSEMKSQARMQHMLVKGKPLRN
>NZ_CP009351.1|WP_000218968.1|4384723_4385089_+|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ
>NZ_CP009351.1|WP_000026896.1|4385130_4385514_+|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQGELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP009351.1|WP_000640870.1|4386244_4386589_+|hypothetical-protein
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSTHLANVLWGADIDVYTEYLR
>NZ_CP009351.1|WP_000568179.1|4386601_4386901_+|thioredoxin-family-protein
MIDWTGAEATSLIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEELKIGMLDLNYAPHLAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYTELK
>NZ_CP009351.1|WP_001242142.1|4387053_4387398_+|hypothetical-protein
MRLYSLLQSFVNYANGQYHLEPLLRREEKTVNFRLGDESCSLQISRDYIELVHEERGTEQIICLDEKDIEQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMPVGA
>NZ_CP009351.1|WP_000601782.1|4387811_4388837_+|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIEKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISTITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKTKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMERGKIVETGPVLDVFRNPKQDITKRFVQQLTDSEDTNETIESLIEKYPDGKVIRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP009351.1|WP_000359401.1|4388829_4389495_+|ABC-transporter-permease
MDKLLANVDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKSINTVIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFLIQWIGDSLTTRIDKR
>NZ_CP009351.1|WP_000735090.1|4389518_4390331_+|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEVAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVADHGRGLAILQKEGILKVKDGVDPVKATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGNDSPYANIVAVRKGDKDKKEIKALVEVLHSKEIEDFINKEYKGAVVPVKE
>NZ_CP009351.1|WP_001226751.1|4390402_4391209_+|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MRKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKELPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPISE
>NZ_CP009351.1|WP_000929162.1|4391447_4392233_+|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINQMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETAEQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009351_1	1.1\|429915\|49\|NZ_CP009351\|CRISPRCasFinder	429915-429963	49	JQ062992	Bacillus phage phIS3501, complete genome	4738-4786	0	1.0
NZ_CP009351_1	1.1\|429915\|49\|NZ_CP009351\|CRISPRCasFinder	429915-429963	49	NZ_CP014849	Bacillus thuringiensis strain HD12 plasmid pHD120038, complete sequence	23265-23313	2	0.959
NZ_CP009351_2	2.1\|3224261\|26\|NZ_CP009351\|CRISPRCasFinder	3224261-3224286	26	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	103187-103212	5	0.808
NZ_CP009351_3	3.2\|4129031\|31\|NZ_CP009351\|CRISPRCasFinder	4129031-4129061	31	JX238501	Bacillus phage phiAGATE, complete genome	124565-124595	8	0.742

1. spacer 1.1|429915|49|NZ_CP009351|CRISPRCasFinder matches to JQ062992 (Bacillus phage phIS3501, complete genome) position: , mismatch: 0, identity: 1.0

aattgtacaatgtgtttaacaaaagaaaaataaagagaaaaagataaac	CRISPR spacer
aattgtacaatgtgtttaacaaaagaaaaataaagagaaaaagataaac	Protospacer
*************************************************

2. spacer 1.1|429915|49|NZ_CP009351|CRISPRCasFinder matches to NZ_CP014849 (Bacillus thuringiensis strain HD12 plasmid pHD120038, complete sequence) position: , mismatch: 2, identity: 0.959

aattgtacaatgtgtttaacaaaagaaaaataaagagaaaaagataaac	CRISPR spacer
aattgtacaatgtgtttaacaaaagaaagataaagagaaaaagacaaac	Protospacer
****************************.***************.****

3. spacer 2.1|3224261|26|NZ_CP009351|CRISPRCasFinder matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

gtccgccgttatgattgtgcccacca	CRISPR spacer
ttccgccgctatgattgtgcccagat	Protospacer
 *******.**************

4. spacer 3.2|4129031|31|NZ_CP009351|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

atcaacaagcggttcaactagtgacaaaaaa	CRISPR spacer
agtgaagggcggtttaactagtggcaaaaaa	Protospacer
* ..* ..******.********.*******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

16574 : 146717

117

Bacillus_phage(43.4%)

bacteriocin,tail,integrase,tRNA,terminase,coat,head,portal,protease,capsid,holin

attL 17323:17340|attR 125735:125752

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000213007.1\|16574_17879_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
17323:17340	attL	NA	NA	NA	NA
WP_001101244.1\|17944_18844_+	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	3.1e-35	31.8
WP_000526274.1\|18886_19429_+\|protease	ATP-dependent protease proteolytic subunit HslV	NA	NA	NA	NA
WP_000550084.1\|19451_20843_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.1e-47	29.9
WP_000421290.1\|20920_21700_+	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_000111485.1\|22047_22749_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_001018576.1\|22852_23740_+	elongation factor Ts	NA	NA	NA	NA
WP_000042669.1\|23806_24529_+	UMP kinase	NA	NA	NA	NA
WP_000531505.1\|24531_25089_+	ribosome recycling factor	NA	NA	NA	NA
WP_000971296.1\|25174_25951_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	9.0e-23	42.5
WP_000813589.1\|25968_26760_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_000790358.1\|26783_27926_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_001090241.1\|27943_29200_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_000814295.1\|29309_31010_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_000059996.1\|31134_35436_+	PolC-type DNA polymerase III	A0A0A8WJ41	Clostridium_phage	4.1e-24	39.6
WP_000359095.1\|35769_36240_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_000102611.1\|36257_37364_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_000071123.1\|37375_37648_+	YlxR family protein	NA	NA	NA	NA
WP_001286522.1\|37648_37960_+	YlxQ family RNA-binding protein	NA	NA	NA	NA
WP_000036346.1\|37964_40031_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.9e-19	25.9
WP_000634349.1\|40027_40309_+	DUF503 family protein	NA	NA	NA	NA
WP_000776437.1\|40324_40681_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_000399363.1\|40767_41691_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_000766703.1\|41734_42706_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	2.1e-05	31.8
WP_001229392.1\|42806_43076_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_000076743.1\|43236_45375_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_000868223.1\|45527_46427_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000593001.1\|46514_47756_+	insulinase family protein	G3MBJ8	Bacillus_virus	4.4e-56	34.5
WP_001239759.1\|47891_48143_+	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000954735.1\|48313_49216_+	dipicolinic acid synthetase subunit A	NA	NA	NA	NA
WP_000844788.1\|49670_51218_-	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	1.8e-144	54.0
WP_001046154.1\|51490_52294_-	hypothetical protein	NA	NA	NA	NA
WP_000351864.1\|52449_52884_-	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	5.1e-60	79.0
WP_000900757.1\|52897_53335_-	helix-turn-helix domain-containing protein	A0A2P1JU09	Anoxybacillus_phage	7.5e-35	55.2
WP_001060851.1\|53508_53700_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001141265.1\|53734_53983_+	hypothetical protein	NA	NA	NA	NA
WP_000537277.1\|54073_54661_+	hypothetical protein	D2XR41	Bacillus_phage	2.2e-74	69.7
WP_000215309.1\|54674_54896_+	hypothetical protein	NA	NA	NA	NA
WP_000354295.1\|55079_55295_+	hypothetical protein	A0A0S2GLC6	Bacillus_phage	1.0e-24	69.0
WP_000782004.1\|55291_55591_-	hypothetical protein	NA	NA	NA	NA
WP_000998369.1\|55774_56059_+	hypothetical protein	D2XR42	Bacillus_phage	1.9e-23	55.3
WP_000312141.1\|56338_57289_+	DnaD domain protein	D2XR43	Bacillus_phage	7.7e-85	61.2
WP_000063910.1\|57285_58608_+	replicative DNA helicase	D2XR44	Bacillus_phage	5.1e-236	95.0
WP_000926798.1\|58610_58799_+	hypothetical protein	D2XR45	Bacillus_phage	9.7e-16	85.5
WP_001126004.1\|58773_59136_+	hypothetical protein	D2XR47	Bacillus_phage	1.6e-54	88.3
WP_000512856.1\|59209_59401_+	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	6.4e-15	63.5
WP_000032820.1\|60441_61758_-	collagen-like protein	A0A285PWR0	Cedratvirus	4.4e-38	62.6
WP_000192854.1\|63346_63811_+	ArpU family transcriptional regulator	D2XR57	Bacillus_phage	1.1e-73	92.2
WP_001012125.1\|63810_64353_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	8.6e-89	91.7
WP_000434817.1\|64475_64676_-	cold-shock protein	Q9AZD3	Lactococcus_phage	6.3e-21	72.7
WP_001099642.1\|66200_66641_-	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_000778987.1\|66919_67141_+	hypothetical protein	B5LPQ8	Bacillus_virus	1.9e-23	75.7
WP_000877970.1\|67137_67410_+	hypothetical protein	A0A1B1P7D2	Bacillus_phage	1.8e-07	47.8
WP_001209624.1\|67375_67711_+	HNH endonuclease	D2XR61	Bacillus_phage	4.7e-53	91.0
WP_000763336.1\|67861_68218_+	hypothetical protein	A0A2H4JBV9	uncultured_Caudovirales_phage	3.6e-59	100.0
WP_000635288.1\|68214_69870_+\|terminase	terminase large subunit	A0A2H4JI41	uncultured_Caudovirales_phage	6.1e-311	95.5
WP_043333521.1\|69935_71042_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	3.1e-186	89.9
WP_000216398.1\|71025_71799_+\|protease	Clp protease ClpP	R9TLM7	Paenibacillus_phage	7.0e-60	54.1
WP_000152777.1\|71818_72982_+\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	2.7e-209	95.9
WP_001243202.1\|72994_73291_+	hypothetical protein	D2XR19	Bacillus_phage	2.3e-43	90.6
WP_003310446.1\|73292_73643_+\|head	phage head closure protein	D2XR20	Bacillus_phage	2.1e-51	86.2
WP_000997535.1\|73644_73989_+	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	6.3e-45	79.6
WP_000176454.1\|73985_74321_+	hypothetical protein	D2XR22	Bacillus_phage	2.0e-51	90.8
WP_001004907.1\|74321_74909_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.1e-87	82.1
WP_000415912.1\|74913_75276_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	2.4e-42	70.8
WP_000094137.1\|79176_80646_+\|tail	phage tail protein	A0A0S2MV63	Bacillus_phage	2.3e-229	78.3
WP_001260218.1\|80642_84962_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	62.6
WP_001075307.1\|84983_85349_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.8e-43	69.7
WP_001261076.1\|85379_85616_+\|bacteriocin	bacteriocin biosynthesis protein	A0A2H4JGN9	uncultured_Caudovirales_phage	1.7e-25	100.0
WP_000540632.1\|85615_86425_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	2.0e-134	83.3
WP_000722940.1\|86626_87133_-	hypothetical protein	NA	NA	NA	NA
WP_000050864.1\|87816_88305_-	hypothetical protein	NA	NA	NA	NA
WP_002000636.1\|88319_90026_-	hypothetical protein	NA	NA	NA	NA
WP_085960240.1\|90228_90465_+	dipicolinate synthase	NA	NA	NA	NA
WP_000414846.1\|90615_91662_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000692456.1\|91685_92918_+	aspartate kinase	NA	NA	NA	NA
WP_000564763.1\|92929_93808_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_000823089.1\|94734_96405_+	ribonuclease J	NA	NA	NA	NA
WP_000139825.1\|96509_97259_+	translocation-enhancing protein TepA	NA	NA	NA	NA
WP_000605020.1\|97255_97459_+	ribonuclease	NA	NA	NA	NA
WP_001118795.1\|97671_100053_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.0e-89	51.4
WP_000114182.1\|100590_101316_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_000725767.1\|101408_102485_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	5.6e-47	33.6
WP_000456929.1\|102602_104135_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-11	25.9
WP_001085255.1\|104127_105186_+	ABC transporter permease	NA	NA	NA	NA
WP_000008857.1\|105186_106146_+	ABC transporter permease	NA	NA	NA	NA
WP_000772416.1\|106355_107630_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	1.6e-56	30.3
WP_000411971.1\|107630_108917_+	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	3.8e-10	28.4
WP_000759625.1\|109017_109731_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_000114444.1\|109806_110055_+	DUF3243 domain-containing protein	NA	NA	NA	NA
WP_000574107.1\|110193_110979_+	DUF3388 domain-containing protein	NA	NA	NA	NA
WP_000137465.1\|111000_111915_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001052967.1\|111980_112559_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_000990684.1\|112579_113818_+	competence/damage-inducible protein A	NA	NA	NA	NA
WP_001283853.1\|113962_114994_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	3.2e-137	71.5
WP_000099770.1\|115477_117043_+	ribonuclease Y	NA	NA	NA	NA
WP_001221092.1\|117201_117996_+	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_000404341.1\|118145_118406_+	stage V sporulation protein SpoVS	J9PTX7	Bacillus_phage	8.4e-10	43.8
WP_003309838.1\|118428_119388_+	membrane dipeptidase	NA	NA	NA	NA
WP_000625417.1\|119613_121371_+	2-oxoacid:acceptor oxidoreductase subunit alpha	NA	NA	NA	NA
WP_000190155.1\|121357_122224_+	2-oxoacid:ferredoxin oxidoreductase subunit beta	NA	NA	NA	NA
WP_001005392.1\|122652_124182_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_000870460.1\|124185_124617_+	hypothetical protein	NA	NA	NA	NA
WP_001288799.1\|124743_125286_+\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_000195994.1\|125466_128145_+	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	1.8e-33	24.5
125735:125752	attR	NA	NA	NA	NA
WP_000516485.1\|128153_130118_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.5e-61	29.7
WP_000461138.1\|130395_130581_-	hypothetical protein	NA	NA	NA	NA
WP_001235297.1\|131085_133869_+	HSR1-like GTP-binding protein	NA	NA	NA	NA
WP_000791034.1\|133966_135886_-	LTA synthase family protein	W6LM83	Streptococcus_phage	4.4e-95	36.8
WP_000272409.1\|136390_137728_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_000771008.1\|137993_138791_-	LysM peptidoglycan-binding domain-containing protein	A0A172JHR8	Bacillus_phage	2.8e-35	39.4
WP_000689209.1\|139085_140927_+	peptidase	NA	NA	NA	NA
WP_001244684.1\|141106_142087_+	phosphatidylinositol diacylglycerol-lyase	NA	NA	NA	NA
WP_000008148.1\|142286_144002_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-09	47.2
WP_000006462.1\|144515_144707_+	hypothetical protein	NA	NA	NA	NA
WP_000454959.1\|144893_146327_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_000878483.1\|146360_146717_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

DBSCAN-SWA_2

200632 : 209889

uncultured_Caudovirales_phage(40.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000708856.1\|200632_201292_-	helix-turn-helix domain-containing protein	A0A2H4J441	uncultured_Caudovirales_phage	8.7e-35	41.0
WP_000283161.1\|201453_201666_+	hypothetical protein	A6M975	Geobacillus_virus	1.3e-11	63.0
WP_000531298.1\|201862_202621_+	phage regulatory protein	A0A2H4JBC7	uncultured_Caudovirales_phage	4.1e-97	70.2
WP_001189066.1\|202632_202827_+	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	2.6e-16	72.6
WP_000511422.1\|202979_203867_+	DnaD domain protein	A0A2H4J394	uncultured_Caudovirales_phage	1.0e-94	64.6
WP_000464432.1\|204275_204662_+	hypothetical protein	A0A288WG73	Bacillus_phage	5.4e-45	68.3
WP_000981476.1\|204896_205886_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	7.6e-35	43.3
WP_001051376.1\|206009_206852_+	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	1.4e-32	47.7
WP_000392443.1\|206913_207144_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.7e-25	77.6
WP_001102628.1\|207515_207839_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000031383.1\|207831_208374_+	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_000976234.1\|208374_209178_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000413739.1\|209268_209889_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2

DBSCAN-SWA_3

325211 : 350952

Bacillus_phage(56.52%)

integrase,capsid,terminase

attL 311108:311124|attR 356493:356509

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
311108:311124	attL	NA	NA	NA	NA
WP_000237495.1\|325211_326303_-\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	2.5e-164	79.8
WP_000947503.1\|327110_328331_+	hypothetical protein	A0A0U3TNF6	Bacillus_phage	1.1e-112	50.9
WP_003259427.1\|328733_329078_-	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	1.4e-15	40.6
WP_000819158.1\|329247_329454_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000549470.1\|329519_329708_+	helix-turn-helix transcriptional regulator	A0A0S2GLE9	Bacillus_phage	1.4e-17	74.2
WP_000187073.1\|329728_330376_+	sigma-70 family RNA polymerase sigma factor	W8CYN8	Bacillus_phage	6.0e-105	89.3
WP_000167563.1\|330653_330956_+	hypothetical protein	H0USU0	Bacillus_phage	9.5e-29	66.7
WP_000866208.1\|330956_331220_+	hypothetical protein	A0A2H4J4P5	uncultured_Caudovirales_phage	7.2e-17	52.5
WP_000572113.1\|331212_331407_+	hypothetical protein	NA	NA	NA	NA
WP_000543065.1\|331485_332421_+	hypothetical protein	S6C475	Thermus_phage	2.2e-100	58.5
WP_000224585.1\|332442_333249_+	recombination protein RecT	S6AVW6	Thermus_phage	1.1e-95	67.1
WP_000611881.1\|334397_335030_+	ATP-binding protein	S6B1M2	Thermus_phage	2.7e-57	52.5
WP_000049348.1\|335035_335515_+	IDEAL domain-containing protein	NA	NA	NA	NA
WP_000049838.1\|335527_335953_+	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	4.1e-30	51.9
WP_000323349.1\|335968_336637_+	hypothetical protein	NA	NA	NA	NA
WP_000762586.1\|336626_337349_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_003269482.1\|337514_337781_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000973815.1\|337764_338499_+	sigma-70 family RNA polymerase sigma factor	C7DTL2	Bacillus_phage	2.1e-58	51.2
WP_000520931.1\|339074_339257_+	hypothetical protein	A0A1B1P7L7	Bacillus_phage	2.9e-09	58.5
WP_000164426.1\|339291_340089_+	phage antirepressor KilAC domain-containing protein	A0A1Q1PVZ8	Staphylococcus_phage	1.5e-73	52.1
WP_001072816.1\|340758_341133_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	6.0e-17	40.7
WP_000876114.1\|341494_341710_+	hypothetical protein	NA	NA	NA	NA
WP_000248554.1\|341994_342150_+	BC1881 family protein	NA	NA	NA	NA
WP_003309811.1\|342235_342418_+	hypothetical protein	NA	NA	NA	NA
WP_003259446.1\|342570_343143_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	4.9e-42	48.1
WP_000515245.1\|343185_343722_+	hypothetical protein	A5GYP7	Lactococcus_phage	9.5e-40	56.3
WP_014895320.1\|343735_345151_+\|terminase	phage terminase large subunit	U5PVG8	Bacillus_phage	9.1e-191	69.3
WP_000222862.1\|345147_345378_+	hypothetical protein	NA	NA	NA	NA
WP_000124815.1\|345391_345592_+	hypothetical protein	NA	NA	NA	NA
WP_000467413.1\|345649_347773_+	hypothetical protein	NA	NA	NA	NA
WP_000366285.1\|347773_348049_+	DUF2829 domain-containing protein	A0A0A7AQX0	Bacillus_phage	9.2e-23	59.0
WP_003269488.1\|348048_348300_+	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	3.3e-19	54.2
WP_000668389.1\|348299_348560_+	DUF2829 domain-containing protein	S5MAK7	Bacillus_phage	4.3e-30	70.6
WP_000791086.1\|348559_348814_+	hypothetical protein	A0A1B1P7N4	Bacillus_phage	6.5e-39	86.6
WP_000917220.1\|348897_349746_+	hypothetical protein	NA	NA	NA	NA
WP_014895319.1\|349761_350952_+\|capsid	phage major capsid protein	A0A1B1IV93	uncultured_Mediterranean_phage	2.3e-33	28.2
356493:356509	attR	NA	NA	NA	NA

DBSCAN-SWA_4

355392 : 365741

Bacillus_phage(100.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014895315.1\|355392_359664_+	hypothetical protein	A0A0A0RPU4	Bacillus_phage	4.2e-138	37.2
WP_003261708.1\|359763_359988_+	hypothetical protein	A0A1B1P780	Bacillus_phage	5.9e-20	75.0
WP_000392441.1\|360054_360285_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.6e-28	87.8
WP_000405770.1\|360284_360989_+	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	2.9e-113	84.4
WP_001171598.1\|361378_361963_-	type IV secretory system conjugative DNA transfer family protein	A0A288WFT6	Bacillus_phage	1.1e-81	74.3
WP_001009469.1\|361967_362171_-	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	2.2e-13	56.1
WP_001256514.1\|362376_362694_+	hypothetical protein	H0USY0	Bacillus_phage	3.2e-51	97.1
WP_000170774.1\|362690_362873_+	hypothetical protein	Q2I8E2	Bacillus_phage	1.0e-22	90.0
WP_014895314.1\|362988_364170_+	cell division protein FtsK	H0USY1	Bacillus_phage	1.2e-217	95.7
WP_003262705.1\|364111_364732_+	hypothetical protein	H0USY2	Bacillus_phage	1.1e-111	95.6
WP_000730121.1\|364757_365741_-	helix-turn-helix domain-containing protein	A0A0S2MVF4	Bacillus_phage	1.1e-134	74.9

DBSCAN-SWA_5

425247 : 516991

Bacillus_phage(81.82%)

tail,terminase,coat,head,holin,portal,integrase,capsid,protease

attL 418939:418955|attR 477052:477068

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
418939:418955	attL	NA	NA	NA	NA
WP_000237490.1\|425247_426309_-\|integrase	site-specific integrase	H0UST3	Bacillus_phage	7.6e-198	100.0
WP_042992861.1\|427413_427644_+	hypothetical protein	H0UST5	Bacillus_phage	7.9e-36	100.0
WP_000466635.1\|427785_429039_+	hypothetical protein	H0UST6	Bacillus_phage	1.9e-216	100.0
WP_000005254.1\|429459_429789_-	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	1.3e-52	100.0
WP_000368958.1\|430035_430281_+	hypothetical protein	NA	NA	NA	NA
WP_000277643.1\|430425_430614_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	2.6e-21	80.6
WP_000348892.1\|430831_431611_+	phage regulatory protein	H0UST9	Bacillus_phage	6.2e-141	100.0
WP_000176229.1\|431773_432088_+	hypothetical protein	H0USU0	Bacillus_phage	2.4e-51	100.0
WP_000123129.1\|432361_433009_+	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	5.2e-117	100.0
WP_014895311.1\|433253_434258_+	hypothetical protein	H0USU2	Bacillus_phage	4.6e-189	100.0
WP_000705175.1\|434220_435033_+	ATP-binding protein	W8CZ50	Bacillus_phage	1.6e-155	100.0
WP_000436950.1\|435074_435341_+	hypothetical protein	W8CYZ5	Bacillus_phage	2.7e-43	100.0
WP_000817807.1\|435412_435577_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-24	100.0
WP_001025406.1\|435594_435810_+	hypothetical protein	A0A0S2GLC6	Bacillus_phage	8.7e-37	100.0
WP_000705117.1\|435806_436106_-	hypothetical protein	H0USU6	Bacillus_phage	3.3e-50	100.0
WP_003259886.1\|436478_436676_+	hypothetical protein	H0USU7	Bacillus_phage	6.6e-31	100.0
WP_001092479.1\|436837_437146_+	hypothetical protein	H0USU8	Bacillus_phage	5.1e-54	100.0
WP_001270306.1\|437173_437566_+	hypothetical protein	H0USU9	Bacillus_phage	2.1e-76	100.0
WP_000362234.1\|437606_437810_+	hypothetical protein	A0A1B1P8C8	Bacillus_phage	7.5e-14	55.2
WP_000055205.1\|438177_438441_+	hypothetical protein	H0USV0	Bacillus_phage	1.0e-42	100.0
WP_000074683.1\|438640_438835_+	hypothetical protein	NA	NA	NA	NA
WP_000965619.1\|439770_440052_+	hypothetical protein	A0A0S2GLD3	Bacillus_phage	8.7e-45	100.0
WP_000166145.1\|440411_440897_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	6.1e-86	100.0
WP_001012129.1\|440893_441436_+\|integrase	site-specific integrase	H0USV4	Bacillus_phage	1.9e-96	100.0
WP_000930963.1\|441651_441876_+	hypothetical protein	H0USV5	Bacillus_phage	1.5e-34	100.0
WP_000017441.1\|442305_442593_+	hypothetical protein	H0USV6	Bacillus_phage	8.6e-48	100.0
WP_000443967.1\|442627_442849_+	hypothetical protein	H0USV7	Bacillus_phage	1.9e-31	100.0
WP_000002724.1\|442841_443120_+	hypothetical protein	H0USV8	Bacillus_phage	1.2e-41	100.0
WP_000778970.1\|443116_443329_+	hypothetical protein	H0USV9	Bacillus_phage	7.1e-31	100.0
WP_001198488.1\|443462_443717_+	hypothetical protein	H0USW0	Bacillus_phage	1.1e-43	100.0
WP_001139462.1\|443706_444084_+	HNH endonuclease	H0USW1	Bacillus_phage	4.0e-69	100.0
WP_000940125.1\|444212_444716_+\|terminase	phage terminase small subunit P27 family	H0USW2	Bacillus_phage	8.0e-89	100.0
WP_000621122.1\|444717_446412_+\|terminase	terminase large subunit	H0USW3	Bacillus_phage	0.0e+00	99.6
WP_000577485.1\|446600_447854_+\|portal	phage portal protein	H0USW4	Bacillus_phage	1.2e-242	100.0
WP_001259161.1\|447840_448551_+\|protease	Clp protease ClpP	H0USW5	Bacillus_phage	3.2e-128	100.0
WP_003263053.1\|448588_449755_+\|capsid	phage major capsid protein	H0USW6	Bacillus_phage	3.3e-210	100.0
WP_000244597.1\|449775_450063_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	1.8e-45	100.0
WP_001068030.1\|450049_450373_+\|head	phage head closure protein	H0USW8	Bacillus_phage	1.1e-56	100.0
WP_000763219.1\|450365_450800_+	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	1.8e-76	100.0
WP_000609192.1\|450796_451156_+	DUF3168 domain-containing protein	H0USX0	Bacillus_phage	4.5e-62	100.0
WP_000896770.1\|451156_451765_+\|tail	tail protein	W8CYT6	Bacillus_phage	5.8e-102	100.0
WP_000779154.1\|451813_452131_+	hypothetical protein	H0USX2	Bacillus_phage	1.1e-54	100.0
WP_001262739.1\|452351_456383_+\|tail	phage tail tape measure protein	H0USX3	Bacillus_phage	0.0e+00	100.0
WP_000900857.1\|456394_457879_+	hypothetical protein	H0USX4	Bacillus_phage	2.2e-296	100.0
WP_001260181.1\|457875_461901_+	hypothetical protein	H0USX5	Bacillus_phage	0.0e+00	100.0
WP_000389535.1\|462024_462249_+	hypothetical protein	H0USX6	Bacillus_phage	8.3e-30	100.0
WP_014895309.1\|462324_462750_+\|holin	phage holin family protein	H0USX7	Bacillus_phage	5.7e-72	100.0
WP_001068398.1\|462808_463450_+	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	2.3e-109	88.9
WP_000924202.1\|464060_464642_-	hypothetical protein	H0USX8	Bacillus_phage	1.8e-100	100.0
WP_000043393.1\|464930_465509_-	type IV secretory system conjugative DNA transfer family protein	H0USX9	Bacillus_phage	2.6e-107	100.0
WP_001033468.1\|465478_465697_-	hypothetical protein	A0A288WFV9	Bacillus_phage	5.6e-07	48.3
WP_000834294.1\|465693_465894_-	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	1.0e-07	47.7
WP_001257567.1\|466067_466385_+	hypothetical protein	H0USY0	Bacillus_phage	9.9e-53	100.0
WP_000170782.1\|466381_466564_+	hypothetical protein	Q2I8E2	Bacillus_phage	3.0e-22	88.3
WP_014895307.1\|466679_467861_+	cell division protein FtsK	H0USY1	Bacillus_phage	7.3e-226	100.0
WP_000548071.1\|467802_468423_+	hypothetical protein	H0USY2	Bacillus_phage	6.5e-117	100.0
WP_000745810.1\|468432_469263_-	hypothetical protein	A0A2H4J6G7	uncultured_Caudovirales_phage	6.7e-101	69.6
WP_000520485.1\|470737_471343_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003310157.1\|471623_472970_-	ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	1.9e-20	23.8
WP_025989074.1\|473995_476725_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	8.6e-12	26.6
WP_002162674.1\|476876_477107_+	hypothetical protein	NA	NA	NA	NA
477052:477068	attR	NA	NA	NA	NA
WP_033795298.1\|477619_478888_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_000527920.1\|479347_481555_+	S-layer protein	NA	NA	NA	NA
WP_000819434.1\|481880_482429_+	hypothetical protein	NA	NA	NA	NA
WP_000524430.1\|483968_484304_+	hypothetical protein	NA	NA	NA	NA
WP_000088964.1\|484561_484936_-	hypothetical protein	NA	NA	NA	NA
WP_000481863.1\|485956_487939_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.9e-15	36.7
WP_000116956.1\|488250_489366_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.3e-112	56.1
WP_000934343.1\|490528_491617_-	CDP-glucose 4,6-dehydratase	M4QRT5	Synechococcus_phage	3.3e-15	27.9
WP_000633065.1\|491645_492605_-	NAD(P)-dependent oxidoreductase	A0A2K9L0I7	Tupanvirus	3.3e-19	26.2
WP_001087534.1\|492659_494729_-	hypothetical protein	NA	NA	NA	NA
WP_000864426.1\|494749_495499_-	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_001046794.1\|496062_496737_-	papain-like cysteine peptidase	NA	NA	NA	NA
WP_000619983.1\|497147_498275_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_000527367.1\|498271_499375_-	endospore germination permease	NA	NA	NA	NA
WP_000055704.1\|499376_500870_-	spore germination protein	NA	NA	NA	NA
WP_001204206.1\|501689_502733_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_000769023.1\|504045_505422_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.3e-21	36.2
WP_001033598.1\|505694_507110_-	phosphatidylinositol-specific phospholipase C	NA	NA	NA	NA
WP_000782791.1\|507524_508094_-	hypothetical protein	NA	NA	NA	NA
WP_001183018.1\|508846_510133_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_001124407.1\|510416_511184_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-07	32.8
WP_001280560.1\|511188_512592_+\|coat	spore coat protein	NA	NA	NA	NA
WP_000465155.1\|512805_513831_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	1.3e-37	34.2
WP_000699376.1\|513827_514790_+	NAD-dependent epimerase/dehydratase family protein	M1IGU2	Acanthocystis_turfacea_Chlorella_virus	7.7e-32	31.8
WP_000251480.1\|514789_515995_+	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	A0A2P1ELT3	Moumouvirus	1.6e-47	34.5
WP_000679359.1\|515995_516991_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_6

1809854 : 1816764

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000783172.1\|1809854_1811750_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	2.8e-46	25.5
WP_000165966.1\|1811746_1812394_-	HD domain-containing protein	S4W232	Pandoravirus	2.5e-10	28.3
WP_000499713.1\|1812503_1813331_+	hypothetical protein	NA	NA	NA	NA
WP_000709202.1\|1813650_1813776_-	hypothetical protein	NA	NA	NA	NA
WP_000109862.1\|1813772_1814846_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.9e-74	42.0
WP_000541075.1\|1815032_1815380_+	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	2.5e-09	27.1
WP_000478848.1\|1816026_1816290_-	hypothetical protein	A0A218KBU4	Bacillus_phage	3.4e-06	38.9
WP_000427801.1\|1816488_1816764_-	stage V sporulation protein S	J9PTX7	Bacillus_phage	2.9e-08	41.2

DBSCAN-SWA_7

2002938 : 2011793

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001258546.1\|2002938_2003808_-	aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	5.6e-66	44.6
WP_002083265.1\|2003937_2004192_-	hypothetical protein	W8CYN0	Bacillus_phage	4.5e-40	100.0
WP_000818985.1\|2004904_2005624_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_001231613.1\|2005851_2006925_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	3.7e-192	99.7
WP_000612415.1\|2006921_2007599_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.0e-123	99.6
WP_000453881.1\|2007639_2009400_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-275	99.2
WP_001194308.1\|2009636_2010401_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755524.1\|2010500_2011793_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.9e-10	30.3

DBSCAN-SWA_8

3193552 : 3201710

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000487912.1\|3193552_3195004_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.7e-139	54.2
WP_000831286.1\|3195436_3195781_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.5e-42	78.1
WP_000277057.1\|3195793_3196324_-	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	8.6e-17	34.3
WP_000738865.1\|3196457_3197705_-	hypothetical protein	NA	NA	NA	NA
WP_000565487.1\|3197880_3198558_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-33	35.6
WP_000822548.1\|3198569_3199961_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.6e-33	29.8
WP_000085772.1\|3200126_3200648_-	dihydrofolate reductase	NA	NA	NA	NA
WP_114365429.1\|3200723_3201710_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	4.2e-17	29.4

DBSCAN-SWA_9

3540345 : 3548721

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088579.1\|3540345_3540933_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4
WP_001262424.1\|3540929_3541970_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.5e-68	46.3
WP_000879034.1\|3542075_3543491_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.0
WP_000055594.1\|3543475_3545695_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	3.3e-163	41.2
WP_000666782.1\|3545678_3546362_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278823.1\|3546358_3546613_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170545.1\|3546605_3547325_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000625687.1\|3547413_3548721_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.1e-20	25.3

DBSCAN-SWA_10

4801057 : 4808745

uncultured_Caudovirales_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001036830.1\|4801057_4802041_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	4.2e-17	27.2
WP_000403765.1\|4802030_4802801_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-13	28.6
WP_002162479.1\|4802833_4803598_+	class B sortase	NA	NA	NA	NA
WP_000587818.1\|4803670_4803994_-	heme oxygenase	NA	NA	NA	NA
WP_001255945.1\|4804288_4805488_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.0
WP_001014310.1\|4805527_4805722_-	YwbE family protein	NA	NA	NA	NA
WP_000018046.1\|4806066_4806759_+	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	6.8e-06	26.9
WP_000247674.1\|4806760_4807696_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-24	26.6
WP_000221121.1\|4807821_4808745_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-45	43.5

DBSCAN-SWA_11

4850946 : 4906667

Klosneuvirus(25.0%)

protease,transposase,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960238.1\|4850946_4852103_-\|transposase	IS3-like element ISBt2 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	4.9e-33	43.1
WP_000475213.1\|4852220_4852835_-	hypothetical protein	NA	NA	NA	NA
WP_001983650.1\|4853354_4853603_+	hypothetical protein	NA	NA	NA	NA
WP_000358275.1\|4853800_4854799_+	hypothetical protein	NA	NA	NA	NA
WP_000105215.1\|4855108_4856386_+	trigger factor	NA	NA	NA	NA
WP_000472289.1\|4856649_4857909_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-148	66.3
WP_000119171.1\|4858015_4859686_+\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	8.7e-15	33.5
WP_000097281.1\|4859868_4862199_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.3e-177	43.7
WP_000869118.1\|4862195_4862792_+	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
WP_000359773.1\|4862826_4863243_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_000133913.1\|4863245_4863698_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000547856.1\|4864114_4865449_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_000009002.1\|4865466_4866300_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_001226404.1\|4866315_4867245_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_000992324.1\|4867247_4868000_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_001087080.1\|4868020_4869010_+	porphobilinogen synthase	NA	NA	NA	NA
WP_000712938.1\|4869009_4870296_+	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.7e-05	34.1
WP_003256548.1\|4870376_4871378_+	stage VI sporulation protein D	NA	NA	NA	NA
WP_000350651.1\|4871412_4872438_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_000072243.1\|4872921_4875567_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	5.5e-165	43.0
WP_000582072.1\|4875660_4876962_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_000360995.1\|4877126_4878077_+	hypothetical protein	NA	NA	NA	NA
WP_000720491.1\|4878309_4878885_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_001013396.1\|4878931_4879609_+	JAB domain-containing protein	NA	NA	NA	NA
WP_000466736.1\|4879766_4880786_+	rod shape-determining protein MreB	NA	NA	NA	NA
WP_001135484.1\|4880827_4881679_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000975762.1\|4881693_4882239_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_000391514.1\|4882274_4882961_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_000503309.1\|4882963_4883761_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_000797477.1\|4883894_4884641_+	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000599047.1\|4884633_4885494_+	stage IV sporulation protein FB	NA	NA	NA	NA
WP_000855475.1\|4885561_4886953_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_000270907.1\|4887118_4887427_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_002082112.1\|4887438_4887783_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000944957.1\|4887786_4888077_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_001003585.1\|4888140_4888683_+	sporulation protein	NA	NA	NA	NA
WP_000497121.1\|4888687_4889974_+	GTPase ObgE	NA	NA	NA	NA
WP_002082113.1\|4890162_4890870_+	response regulator transcription factor	NA	NA	NA	NA
WP_000865417.1\|4890859_4891942_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_000114530.1\|4892035_4892812_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.6e-19	31.0
WP_001011408.1\|4892786_4894709_+	ABC transporter permease	NA	NA	NA	NA
WP_001026364.1\|4894758_4896669_+	ABC transporter permease	NA	NA	NA	NA
WP_000621701.1\|4896765_4897617_+	prephenate dehydratase	NA	NA	NA	NA
WP_000796367.1\|4897794_4898265_-	hypothetical protein	NA	NA	NA	NA
WP_000511662.1\|4898456_4899104_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_000812273.1\|4899185_4899728_-	transcription repressor NadR	NA	NA	NA	NA
WP_000973781.1\|4899727_4900870_-	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	8.5e-30	29.2
WP_001138541.1\|4901022_4902552_+	L-aspartate oxidase	NA	NA	NA	NA
WP_001092241.1\|4902571_4903405_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_000025282.1\|4903435_4904542_+	quinolinate synthase NadA	NA	NA	NA	NA
WP_043333502.1\|4904768_4906667_+\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA

DBSCAN-SWA_12

5049107 : 5071597

Bacillus_phage(75.0%)

integrase,terminase

attL 5043422:5043437|attR 5057053:5057068

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5043422:5043437	attL	NA	NA	NA	NA
WP_000237492.1\|5049107_5050169_-\|integrase	site-specific integrase	H0UST3	Bacillus_phage	6.5e-165	81.9
WP_000466631.1\|5051509_5052763_+	hypothetical protein	H0UST6	Bacillus_phage	2.6e-173	80.2
WP_000351012.1\|5053244_5053583_-	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	1.4e-09	35.2
WP_000817630.1\|5053761_5054082_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001025461.1\|5054277_5054475_+	hypothetical protein	NA	NA	NA	NA
WP_000277639.1\|5054486_5054675_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	9.4e-19	75.8
WP_000801520.1\|5054695_5055340_+	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	4.9e-75	64.2
WP_001175895.1\|5055387_5056623_+	DEAD/DEAH box helicase	A0A1B1P7L4	Bacillus_phage	8.2e-212	86.5
WP_001132421.1\|5056612_5056930_+	hypothetical protein	A0A1B1P7L0	Bacillus_phage	1.1e-11	43.7
WP_000665151.1\|5056930_5057209_+	nuclease	A0A1B1P7M6	Bacillus_phage	2.1e-43	87.0
5057053:5057068	attR	NA	NA	NA	NA
WP_000195964.1\|5057208_5059128_+	AAA family ATPase	A0A1B1P7N0	Bacillus_phage	3.4e-281	83.0
WP_000268681.1\|5059151_5059469_+	hypothetical protein	A0A1B1P7N6	Bacillus_phage	5.1e-33	75.2
WP_000818339.1\|5059468_5059960_+	DUF669 domain-containing protein	A0A1B1P7N3	Bacillus_phage	2.8e-86	93.9
WP_014895342.1\|5060023_5061712_+	hypothetical protein	A0A1B1P7M5	Bacillus_phage	3.4e-301	87.5
WP_000417045.1\|5061713_5061965_+	hypothetical protein	A0A0A7AQI9	Bacillus_phage	7.1e-06	38.7
WP_000276479.1\|5062172_5064038_+	DNA primase	A0A1B1P7L5	Bacillus_phage	0.0e+00	91.0
WP_000483565.1\|5064483_5064879_+	hypothetical protein	A0A1C8E9D1	Bacillus_phage	5.7e-42	66.4
WP_042992867.1\|5065930_5066503_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.7e-42	48.1
WP_000161455.1\|5066544_5067051_+	hypothetical protein	A0A090DCM3	Clostridium_phage	2.9e-38	51.6
WP_042992865.1\|5067094_5068510_+\|terminase	phage terminase large subunit	U5PVG8	Bacillus_phage	9.8e-193	70.2
WP_000222861.1\|5068506_5068737_+	hypothetical protein	NA	NA	NA	NA
WP_000124816.1\|5068750_5068951_+	hypothetical protein	NA	NA	NA	NA
WP_000467411.1\|5069009_5071133_+	hypothetical protein	NA	NA	NA	NA
WP_001009041.1\|5071133_5071346_+	hypothetical protein	A0A1C8E971	Bacillus_phage	5.2e-34	94.3
WP_014895339.1\|5071345_5071597_+	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	2.3e-20	56.6

DBSCAN-SWA_13

5078478 : 5089721

Bacillus_phage(100.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014895334.1\|5078478_5083134_+	hypothetical protein	A0A0A0RPU4	Bacillus_phage	4.7e-159	33.6
WP_000389432.1\|5083232_5083457_+	hypothetical protein	A0A1B1P780	Bacillus_phage	2.7e-20	76.4
WP_000392441.1\|5083523_5083754_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.6e-28	87.8
WP_000405774.1\|5083753_5084458_+	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	2.0e-114	86.1
WP_000110514.1\|5085371_5085965_+	restriction endonuclease	NA	NA	NA	NA
WP_000403528.1\|5085961_5086183_-	helix-turn-helix transcriptional regulator	A0A0S2SXH7	Bacillus_phage	2.3e-08	35.9
WP_003256223.1\|5086368_5086674_+	hypothetical protein	A0A288WG38	Bacillus_phage	2.5e-21	46.9
WP_000170776.1\|5086670_5086853_+	hypothetical protein	Q2I8E2	Bacillus_phage	2.3e-22	88.3
WP_000891527.1\|5086968_5088150_+	cell division protein FtsK	H0USY1	Bacillus_phage	6.3e-185	80.9
WP_001025806.1\|5088091_5088712_+	hypothetical protein	H0USY2	Bacillus_phage	2.8e-99	83.5
WP_000730122.1\|5088737_5089721_-	helix-turn-helix domain-containing protein	A0A0S2MVF4	Bacillus_phage	4.5e-136	75.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP009349

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3946

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000232874.1\|1694_2879_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_000655504.1\|3289_3946_-	hypothetical protein	A0A223LKM8	Bacillus_phage	3.8e-14	32.7

DBSCAN-SWA_2

7982 : 10081

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000706738.1\|7982_8753_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-32	39.7
WP_000410775.1\|9877_10081_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.5e-17	63.6

DBSCAN-SWA_3

15462 : 17136

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001020813.1\|15462_16350_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.5e-07	21.4
WP_000933896.1\|16473_17136_+	O-methyltransferase	S5YRC3	Mycobacterium_phage	2.4e-40	43.8

DBSCAN-SWA_4

25408 : 26107

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000137754.1\|25408_26107_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.1e-15	28.9

DBSCAN-SWA_5

38720 : 40268

Clostridium_botulinum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000767377.1\|38720_40268_-	hypothetical protein	Q38196	Clostridium_botulinum_phage	3.3e-08	37.6

DBSCAN-SWA_6

43759 : 46417

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000520755.1\|43759_46417_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	3.3e-32	26.1

DBSCAN-SWA_7

54095 : 57740

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000289092.1\|54095_54572_-	C40 family peptidase	A0A0A0RPZ1	Bacillus_phage	3.7e-27	53.4
WP_001191655.1\|54683_56507_-	maturase	A0A0U4J920	Pseudomonas_phage	1.2e-28	28.8
WP_000550849.1\|57077_57740_-	hypothetical protein	A0A223LKM8	Bacillus_phage	1.0e-14	40.6

DBSCAN-SWA_8

74072 : 75992

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000615757.1\|74072_74465_+	helix-turn-helix domain-containing protein	A0A0P0IZG9	Lactobacillus_phage	8.6e-06	38.3
WP_003310553.1\|74861_75992_-	hypothetical protein	H0UST6	Bacillus_phage	6.0e-68	36.9

DBSCAN-SWA_9

97431 : 99743

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000867049.1\|97431_97881_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0A8WJI9	Clostridium_phage	1.1e-36	51.7
WP_001097636.1\|97877_99743_-	anaerobic ribonucleoside triphosphate reductase	A0A2R2ZH54	Clostridioides_phage	8.4e-160	45.4

DBSCAN-SWA_10

105852 : 179155

Bacillus_phage(35.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000762743.1\|105852_106251_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	2.6e-50	68.2
WP_000166246.1\|106262_107375_+	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	5.1e-80	45.5
WP_001188811.1\|107860_108607_-	hypothetical protein	NA	NA	NA	NA
WP_001231608.1\|108789_109722_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000893014.1\|110350_111199_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_001038827.1\|111986_112931_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_001243463.1\|113485_114538_+	cell filamentation protein Fic	NA	NA	NA	NA
WP_000082758.1\|114713_116069_-	amino acid permease	NA	NA	NA	NA
WP_000690460.1\|116732_117845_+	alanine dehydrogenase	NA	NA	NA	NA
WP_000628924.1\|117841_118843_+	bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB	NA	NA	NA	NA
WP_001284904.1\|118937_120320_+	amino acid permease	NA	NA	NA	NA
WP_000700712.1\|120753_121779_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003256157.1\|122338_124579_+	hypothetical protein	G1FGA4	Mycobacterium_phage	1.2e-11	47.3
WP_043333206.1\|125106_127473_+	DUF3472 domain-containing protein	NA	NA	NA	NA
WP_043333208.1\|127577_130313_+	S8 family serine peptidase	Q2A0D0	Sodalis_phage	4.4e-16	25.9
WP_000821353.1\|130935_131097_+	six-cysteine peptide SCIFF	NA	NA	NA	NA
WP_000581828.1\|131157_132564_+	thioether cross-link-forming SCIFF peptide maturase	A0A1L7N0Q5	Ralstonia_phage	1.9e-10	23.0
WP_000491774.1\|132708_133104_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_000167466.1\|133417_134323_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_085960238.1\|134384_135541_-\|transposase	IS3-like element ISBt2 family transposase	A0A1B1P773	Bacillus_phage	3.5e-47	42.7
WP_000871007.1\|135752_136727_-	nitronate monooxygenase	NA	NA	NA	NA
WP_000467334.1\|137169_137400_-	helix-turn-helix transcriptional regulator	S5MBY6	Brevibacillus_phage	9.4e-13	43.2
WP_043320231.1\|138223_139681_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.4e-23	30.2
WP_000800736.1\|139694_140360_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.1e-35	35.2
WP_000494781.1\|141299_142493_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-25	32.3
WP_001009326.1\|142976_144407_+	ABC transporter permease	NA	NA	NA	NA
WP_000447831.1\|144418_145105_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-24	34.8
WP_001043921.1\|145257_145530_-	HU family DNA-binding protein	A0A1P8CWT5	Bacillus_phage	3.5e-22	60.0
WP_000853266.1\|145919_146162_-	hypothetical protein	NA	NA	NA	NA
WP_000723694.1\|146880_147225_+	BlaI/MecI/CopY family transcriptional regulator	A0A0A8WJP7	Clostridium_phage	7.0e-12	34.2
WP_003255930.1\|147284_148763_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_000721293.1\|149347_150658_-	phosphatidylinositol-specific phospholipase C	NA	NA	NA	NA
WP_000726947.1\|151374_151938_-	hypothetical protein	NA	NA	NA	NA
WP_000686199.1\|153480_154131_+	sugar phosphate isomerase	NA	NA	NA	NA
WP_001194338.1\|154504_155500_-	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_000619726.1\|155766_157770_-	endochitinase	M1H4X6	Acanthocystis_turfacea_Chlorella_virus	6.9e-43	40.0
WP_000586190.1\|158504_159626_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	5.6e-175	81.8
WP_000439701.1\|159977_161108_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_000713538.1\|162104_163103_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_000276016.1\|163113_163767_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_001217721.1\|164138_164390_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_000074462.1\|164407_165112_+	aquaporin family protein	M1HH19	Acanthocystis_turfacea_Chlorella_virus	3.5e-34	36.3
WP_000232811.1\|166313_167300_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_000103758.1\|167335_168136_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_000818327.1\|168154_169066_+	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_000250783.1\|169267_169642_+	DUF956 family protein	NA	NA	NA	NA
WP_001021941.1\|170038_171652_+	SH3 domain-containing protein	A0A1J0MS59	Bacillus_phage	4.3e-43	54.3
WP_000599693.1\|172245_172548_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000616115.1\|172861_173278_+	FosB family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	7.6e-53	85.3
WP_001053998.1\|173736_175170_+\|transposase	IS4-like element IS231F family transposase	NA	NA	NA	NA
WP_001086889.1\|175889_176291_+	BlaI/MecI/CopY family transcriptional regulator	A0A0A8WJP7	Clostridium_phage	5.0e-09	30.4
WP_000468909.1\|176293_177430_+	peptidase M56	NA	NA	NA	NA
WP_003254688.1\|177976_179155_+	CapA family protein	A0A0N9SJ77	Staphylococcus_phage	7.7e-58	34.9

DBSCAN-SWA_11

183137 : 253789

Bacillus_phage(72.22%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000053755.1\|183137_183731_-\|protease	cell envelope-bound metalloprotease (camelysin)	NA	NA	NA	NA
WP_085961348.1\|184995_186337_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.7e-33	37.1
WP_043320313.1\|186707_186890_+	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1B1P7U8	Bacillus_phage	2.6e-21	88.3
WP_000141883.1\|187596_187845_-	hypothetical protein	A0A288WFY7	Bacillus_phage	1.1e-35	92.7
WP_000981141.1\|188508_189597_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.3e-164	78.8
WP_000196759.1\|189854_190247_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_043320300.1\|190384_190582_+	hypothetical protein	A0A0A0RMG9	Bacillus_phage	5.6e-06	45.5
WP_000059259.1\|192083_192491_+	hypothetical protein	NA	NA	NA	NA
WP_000389273.1\|193038_193287_+	hypothetical protein	NA	NA	NA	NA
WP_001079532.1\|193662_194016_-	nitrous oxide-stimulated promoter family protein	NA	NA	NA	NA
WP_000151822.1\|194445_194664_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001080993.1\|194656_195130_+	hypothetical protein	NA	NA	NA	NA
WP_001262251.1\|195177_195717_-	hypothetical protein	NA	NA	NA	NA
WP_001214614.1\|195803_197567_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	5.5e-36	24.4
WP_000064032.1\|197667_198108_-	hypothetical protein	NA	NA	NA	NA
WP_000536399.1\|198109_198460_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000864837.1\|200243_200645_+	hypothetical protein	NA	NA	NA	NA
WP_000954710.1\|200978_201785_+	N-hydroxyarylamine O-acetyltransferase	NA	NA	NA	NA
WP_000483139.1\|202117_204097_+	DUF3472 domain-containing protein	G1FGA4	Mycobacterium_phage	9.3e-08	40.2
WP_000424048.1\|204818_205055_+	hypothetical protein	NA	NA	NA	NA
WP_000264559.1\|205177_205408_-	XRE family transcriptional regulator	A0A1B1P883	Bacillus_phage	5.9e-07	41.5
WP_000958230.1\|205627_205822_+	hypothetical protein	W8CYN5	Bacillus_phage	2.7e-13	56.2
WP_000511835.1\|205834_207001_+	DNA translocase FtsK	W8CYG2	Bacillus_phage	3.7e-190	83.2
WP_001245886.1\|206990_207602_+	hypothetical protein	W8CZ47	Bacillus_phage	8.5e-85	74.3
WP_157453536.1\|207705_207849_+	hypothetical protein	NA	NA	NA	NA
WP_043333212.1\|208022_209135_+	alanine dehydrogenase	NA	NA	NA	NA
WP_000064087.1\|209131_210133_+	bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB	NA	NA	NA	NA
WP_043333214.1\|210480_213042_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_001033628.1\|214274_215258_-	glycerophosphoryl diester phosphodiesterase	NA	NA	NA	NA
WP_001224400.1\|215605_216055_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_001097425.1\|216619_218566_+	BglG family transcription antiterminator	NA	NA	NA	NA
WP_000770306.1\|218714_220670_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_000138688.1\|220687_221635_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_000610358.1\|222096_223329_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.0e-20	26.1
WP_000362061.1\|223333_224026_-	response regulator transcription factor	NA	NA	NA	NA
WP_000454406.1\|225543_226257_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-34	35.5
WP_000581945.1\|226253_228722_+	ABC transporter permease	NA	NA	NA	NA
WP_001110937.1\|228757_228919_+	S-layer protein	NA	NA	NA	NA
WP_000428522.1\|230084_231494_+	S-methylmethionine permease	NA	NA	NA	NA
WP_000066234.1\|231468_232446_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_000204906.1\|233409_233703_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043333216.1\|234291_234846_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003256943.1\|235454_235733_+	hypothetical protein	NA	NA	NA	NA
WP_000805753.1\|235771_236278_+	DUF3902 family protein	NA	NA	NA	NA
WP_003256947.1\|236687_237026_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.8e-36	68.8
WP_000160158.1\|237274_237571_-\|transposase	IS3 family transposase	A0A1B1P776	Bacillus_phage	1.5e-07	32.0
WP_001019437.1\|237654_238299_-	hypothetical protein	NA	NA	NA	NA
WP_001152303.1\|238399_240055_-	aspartate aminotransferase family protein	M1HWX9	Paramecium_bursaria_Chlorella_virus	2.8e-05	31.1
WP_000456654.1\|240541_241468_-	aldo/keto reductase	NA	NA	NA	NA
WP_000659072.1\|241833_249441_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.4e-160	27.7
WP_000720470.1\|249680_250307_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_000273030.1\|250503_250758_+	hypothetical protein	NA	NA	NA	NA
WP_000517954.1\|250822_251290_+	hypothetical protein	NA	NA	NA	NA
WP_000868981.1\|251725_252115_+	hypothetical protein	NA	NA	NA	NA
WP_001077538.1\|252331_253006_-	hypothetical protein	NA	NA	NA	NA
WP_003258988.1\|253552_253789_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-07	57.7

DBSCAN-SWA_12

260573 : 261668

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000681821.1\|260573_261668_-	phosphodiester glycosidase family protein	A0A1X9I9K5	Staphylococcus_phage	2.3e-08	28.0

DBSCAN-SWA_13

265613 : 266651

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001057951.1\|265613_266651_-	serine hydrolase	A0A2P1N568	Mycobacterium_phage	3.5e-06	21.9

DBSCAN-SWA_14

280168 : 283474

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000697861.1\|280168_281017_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	6.8e-32	34.0
WP_000770927.1\|281062_282019_-	dTDP-glucose 4,6-dehydratase	K7QJG5	Escherichia_phage	2.1e-77	44.5
WP_001226088.1\|282015_282582_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	1.4e-36	44.0
WP_000676108.1\|282607_283474_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	9.8e-103	63.9

DBSCAN-SWA_15

292351 : 297648

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000481737.1\|292351_293098_-	3-oxoacyl-[acyl-carrier-protein] reductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-20	30.9
WP_000627588.1\|293090_294041_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_000281616.1\|294037_294457_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_000649291.1\|294466_295624_-	ABC transporter permease	NA	NA	NA	NA
WP_000129817.1\|295643_296591_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-28	32.1
WP_000848165.1\|296625_297648_-	glycosyl transferase	A0A1V0SDW6	Indivirus	1.5e-38	29.8

DBSCAN-SWA_16

304606 : 305316

Marinitoga_camini_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001033051.1\|304606_304804_-	helix-turn-helix transcriptional regulator	A0A142LP09	Marinitoga_camini_virus	5.6e-06	44.1
WP_000753230.1\|304956_305316_+	helix-turn-helix transcriptional regulator	A0A0A8WFJ2	Clostridium_phage	5.4e-15	50.6

DBSCAN-SWA_17

314126 : 322922

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000276743.1\|314126_315689_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	3.7e-07	20.8
WP_000987035.1\|315690_317391_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.9e-25	23.1
WP_000405656.1\|317956_319114_-	radical SAM protein	NA	NA	NA	NA
WP_000260424.1\|319249_319945_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_000333843.1\|320239_322147_-	asparagine synthase (glutamine-hydrolyzing)	A0A1X9VNR2	Mimivirus	7.3e-34	32.4
WP_003257883.1\|322163_322922_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.2e-21	33.2

DBSCAN-SWA_18

326883 : 329869

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000262983.1\|326883_328371_-	acyl--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	4.4e-26	25.7
WP_000429540.1\|328387_329869_-	acyl--CoA ligase	A0A2K9KZV5	Tupanvirus	2.4e-24	26.0

DBSCAN-SWA_19

336016 : 341495

Bacillus_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000792433.1\|336016_337414_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-25	28.4
WP_000722050.1\|337403_338048_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.2e-30	33.8
WP_043320168.1\|338173_338521_+	hypothetical protein	NA	NA	NA	NA
WP_000473547.1\|338654_339023_+	hypothetical protein	NA	NA	NA	NA
WP_000709194.1\|339686_340106_+	hypothetical protein	NA	NA	NA	NA
WP_001167052.1\|340175_340391_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.3e-19	71.6
WP_000712401.1\|340787_341495_-\|transposase	IS6-like element IS240C family transposase	A0A1X9I6C6	Streptococcus_phage	6.0e-42	42.9

DBSCAN-SWA_20

344611 : 345292

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000447828.1\|344611_345292_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-21	32.4

DBSCAN-SWA_21

351940 : 357184

Sinorhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000435488.1\|351940_352474_-	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	4.4e-05	25.9
WP_000598100.1\|353345_353549_-	hypothetical protein	NA	NA	NA	NA
WP_000822719.1\|354937_357184_-	hypothetical protein	G1FGA4	Mycobacterium_phage	6.0e-11	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP009347

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

79840 : 90817

Bacillus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001031181.1\|79840_81457_+	hypothetical protein	A0A0K2FMB2	Brevibacillus_phage	1.4e-131	41.0
WP_000691718.1\|81568_82648_+	ATP-binding protein	A0A0E3D9S6	Bacillus_phage	2.9e-160	77.4
WP_000398537.1\|82697_83087_+	hypothetical protein	NA	NA	NA	NA
WP_001173852.1\|83155_84016_+	thymidylate synthase	A0A0H3V0R8	Geobacillus_virus	1.3e-75	47.7
WP_000624473.1\|84012_84531_+	dihydrofolate reductase	A0A0E3D9G3	Bacillus_phage	1.5e-21	40.4
WP_000945823.1\|84533_84743_+	hypothetical protein	NA	NA	NA	NA
WP_000487831.1\|84836_85727_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	1.8e-30	48.1
WP_003254307.1\|85856_86054_+	hypothetical protein	NA	NA	NA	NA
WP_000881565.1\|86203_88165_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	9.6e-106	36.4
WP_001023489.1\|88195_88678_+	dUTP diphosphatase	Q332E8	Clostridium_botulinum_C_phage	2.4e-26	43.0
WP_000583728.1\|88674_89289_+	dTMP kinase	A0A1V0QGB5	Shearwaterpox_virus	6.0e-14	29.9
WP_001068334.1\|89292_89772_+	hypothetical protein	NA	NA	NA	NA
WP_000156298.1\|89796_90075_+	hypothetical protein	NA	NA	NA	NA
WP_000548555.1\|90067_90817_+	hypothetical protein	A7KV01	Bacillus_phage	1.6e-16	40.7

DBSCAN-SWA_2

108794 : 144508

Bacillus_phage(60.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000180796.1\|108794_109610_+	phage repressor protein/antirepressor Ant	A0A2D1GQG9	Lysinibacillus_phage	2.0e-20	58.1
WP_003254024.1\|109685_110297_+	hypothetical protein	NA	NA	NA	NA
WP_003310322.1\|110391_110535_+	hypothetical protein	NA	NA	NA	NA
WP_003254025.1\|110540_110813_+	hypothetical protein	NA	NA	NA	NA
WP_001146641.1\|110838_111474_+	hypothetical protein	NA	NA	NA	NA
WP_000477626.1\|111486_111810_+	hypothetical protein	A0A1I9S626	Bacillus_phage	1.7e-20	61.9
WP_000642957.1\|111784_112018_+	hypothetical protein	NA	NA	NA	NA
WP_000500661.1\|112017_112272_+	hypothetical protein	A0A076G7F3	Bacillus_phage	2.1e-29	67.5
WP_001208820.1\|112614_113049_+	hypothetical protein	A0A127AXQ6	Bacillus_phage	1.1e-17	46.2
WP_000504037.1\|113089_113281_+	hypothetical protein	NA	NA	NA	NA
WP_000483063.1\|113391_113679_+	hypothetical protein	NA	NA	NA	NA
WP_001284343.1\|113740_114169_+	nucleoside deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.1e-17	38.1
WP_000342987.1\|114219_114429_+	hypothetical protein	NA	NA	NA	NA
WP_000687311.1\|114451_115279_+	metallophosphoesterase	O64184	Bacillus_phage	4.2e-119	66.9
WP_001053438.1\|115389_115581_+	hypothetical protein	NA	NA	NA	NA
WP_000186693.1\|115619_116045_-	hypothetical protein	NA	NA	NA	NA
WP_000161131.1\|116070_116874_-	hypothetical protein	NA	NA	NA	NA
WP_000568325.1\|117118_117373_-	hypothetical protein	NA	NA	NA	NA
WP_000386129.1\|117709_118150_+	hypothetical protein	NA	NA	NA	NA
WP_001064689.1\|118270_118993_+	hypothetical protein	A7KUV4	Bacillus_phage	9.9e-16	33.3
WP_000499887.1\|118967_120083_+	hypothetical protein	A7XX66	Thermus_virus	9.3e-13	28.9
WP_003310329.1\|120109_121315_+	AAA family ATPase	A7KUV6	Bacillus_phage	1.9e-67	44.7
WP_000733263.1\|121332_121581_+	hypothetical protein	NA	NA	NA	NA
WP_000427813.1\|121583_122021_+	hypothetical protein	A7KV30	Bacillus_phage	2.3e-23	39.4
WP_000209660.1\|122042_122477_+	GatB/YqeY domain-containing protein	NA	NA	NA	NA
WP_000593824.1\|122531_123497_+	hypothetical protein	A0A173GBG1	Bacillus_phage	6.9e-57	46.1
WP_000220506.1\|123523_125059_+	nicotinate phosphoribosyltransferase	A0A218KC49	Bacillus_phage	4.0e-192	67.8
WP_014895378.1\|125166_126048_+	nucleotide excision repair endonuclease	A0A218KC00	Bacillus_phage	9.9e-18	41.7
WP_003254066.1\|126178_126640_+	hypothetical protein	A0A1I9S5V4	Bacillus_phage	3.4e-54	67.1
WP_001008937.1\|126636_126846_+	hypothetical protein	NA	NA	NA	NA
WP_000996769.1\|126861_127512_+	tellurium resistance protein TerE	S5M8H7	Bacillus_phage	1.4e-29	38.2
WP_000290289.1\|127563_128166_+	TerD family protein	A0A2I7QY15	Vibrio_phage	7.4e-25	40.6
WP_001207091.1\|128170_128398_+	hypothetical protein	NA	NA	NA	NA
WP_000429546.1\|128531_129281_+	hypothetical protein	S5MAL1	Bacillus_phage	1.6e-40	42.0
WP_003310334.1\|129300_130371_+	phosphoesterase	NA	NA	NA	NA
WP_000886924.1\|130390_131116_+	NAD-dependent protein deacylase	A0A068EPD4	Bacillus_phage	1.7e-31	32.5
WP_000260123.1\|131325_131847_+	hypothetical protein	G3MBS8	Bacillus_virus	3.0e-14	33.8
WP_000145790.1\|131932_133117_+	NupC family nucleoside transporter	NA	NA	NA	NA
WP_000394584.1\|133350_134247_+	S8 family peptidase	A0A127AWU5	Bacillus_phage	1.1e-61	46.6
WP_000013355.1\|134376_135015_+	sigma-70 family RNA polymerase sigma factor	Q0SPI3	Clostridium_phage	9.3e-10	35.9
WP_000393454.1\|135343_135730_+	Replication termination protein	NA	NA	NA	NA
WP_000469986.1\|135747_136026_+	hypothetical protein	NA	NA	NA	NA
WP_001235407.1\|136064_137162_-	tyrosine recombinase XerS	A0A166YH27	Gordonia_phage	2.0e-07	30.8
WP_000634706.1\|137346_137709_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	1.7e-29	51.3
WP_000019971.1\|137690_139775_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	G3MBF2	Bacillus_virus	2.3e-267	64.6
WP_000626116.1\|139793_140822_+	class 1b ribonucleoside-diphosphate reductase subunit beta	G3MBF3	Bacillus_virus	5.4e-108	59.6
WP_000404326.1\|140854_141106_+	thioredoxin family protein	NA	NA	NA	NA
WP_014895379.1\|141105_141288_+	hypothetical protein	NA	NA	NA	NA
WP_000386879.1\|141553_141859_+	hypothetical protein	NA	NA	NA	NA
WP_000138198.1\|141851_142142_+	hypothetical protein	A0A0S2SXU6	Bacillus_phage	1.5e-23	60.2
WP_000337749.1\|142143_142398_+	hypothetical protein	NA	NA	NA	NA
WP_000130747.1\|142394_143156_+	hypothetical protein	X2JMW4	Bacillus_phage	7.3e-86	62.2
WP_000107146.1\|143275_144508_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	2.1e-66	58.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP009346

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

115 : 14578

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000538150.1\|115_913_-	N-acetylmuramoyl-L-alanine amidase	A0A160LKP9	Bacillus_phage	1.5e-137	100.0
WP_001173934.1\|928_1810_-	hypothetical protein	A0A160LKP6	Bacillus_phage	1.7e-171	100.0
WP_000159134.1\|1813_2728_-	hypothetical protein	A0A161JRA8	Bacillus_phage	9.9e-146	100.0
WP_000819106.1\|2740_3253_-	hypothetical protein	A0A160LKQ7	Bacillus_phage	1.3e-91	100.0
WP_001162469.1\|3200_3953_-	N-acetylmuramoyl-L-alanine amidase	A0A160LKR7	Bacillus_phage	3.4e-136	100.0
WP_001113796.1\|3952_4567_-	hypothetical protein	A0A160LKP5	Bacillus_phage	7.7e-78	100.0
WP_000384937.1\|4570_4846_-	hypothetical protein	A0A169E435	Bacillus_phage	1.7e-48	100.0
WP_001057983.1\|5173_5605_-	hypothetical protein	A0A160LKQ5	Bacillus_phage	6.4e-55	100.0
WP_000339993.1\|5684_5891_-	hypothetical protein	A0A160LKQ4	Bacillus_phage	2.5e-12	100.0
WP_000523935.1\|5894_6125_-	hypothetical protein	A0A160LLA6	Bacillus_phage	7.2e-37	100.0
WP_000068587.1\|6166_7237_-	hypothetical protein	A0A160LKS4	Bacillus_phage	2.7e-203	100.0
WP_000558559.1\|7236_7491_-	hypothetical protein	A0A160LKS3	Bacillus_phage	1.9e-38	100.0
WP_001013356.1\|7804_8443_-	hypothetical protein	A0A161J814	Bacillus_phage	3.0e-125	100.0
WP_014905374.1\|8423_8732_-	hypothetical protein	A0A160LKS9	Bacillus_phage	5.8e-58	100.0
WP_003257741.1\|8788_9373_-	hypothetical protein	A0A160LKS6	Bacillus_phage	5.3e-76	100.0
WP_003310637.1\|9360_9798_-	hypothetical protein	A0A160LKS8	Bacillus_phage	1.4e-25	100.0
WP_000957403.1\|10383_10584_-	LexA repressor	A0A161ISH4	Bacillus_phage	1.9e-30	100.0
WP_014905375.1\|10599_12804_-	hypothetical protein	A0A160LKS5	Bacillus_phage	0.0e+00	100.0
WP_001284666.1\|12790_13528_-	hypothetical protein	A0A160LKS7	Bacillus_phage	1.1e-131	100.0
WP_000991481.1\|13586_13811_-	hypothetical protein	A0A160LLB3	Bacillus_phage	4.0e-32	100.0
WP_000430104.1\|13882_14386_-	hypothetical protein	A0A160LKT4	Bacillus_phage	2.4e-85	100.0
WP_000040626.1\|14401_14578_-	helix-turn-helix domain-containing protein	Q7WSG8	Bacillus_phage	1.5e-23	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage