CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP009606	Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence	1 crisprs	RT,cas14j,csa3	0	1	0
NZ_CP009604	Bacillus cereus strain S2-8 plasmid pBFR_1, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	0 crisprs	NA	0	0	2
NZ_CP009605	Bacillus cereus strain S2-8 chromosome, complete genome	5 crisprs	csa3,RT,cas3,DEDDh,cas14j,WYL,DinG,cas14k	15	22	8

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009606_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009606_1

133184-133331

Orphan

Consensus_repeat	Method
ATGGCTATAAGCTTTTATTTCAAATTTTATAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009606_1

>merge|NZ_CP009606|1|133184-133331|CRISPRCasFinder
ATGGCTACTACTTCTTATTTGAAACTATGTAGCCTTATTATGGCTATAAGCTTTTATTTCAAATTTTATAGCTTTATCACGGCTATTACTTCTTATTTGAAACTATAGCCTTATCATGGCTATAAGCTCTTATTTCAAATTTTATAGC

>NZ_CP009606|1|1|133184-133331|CRISPRCasFinder
ATGGCTACTACTTCTTATTTGAAACTATGTAGC	CTTATTATGGCTATAAGCTTTTATTTCAAATTTTATAGCTTTATCACGGCTATTACTTCTTATTTGAAACTATAGCCTTATC
ATGGCTATAAGCTCTTATTTCAAATTTTATAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009606.1\|WP_001118185.1\|134184_135894_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_000747957.1\|114327_115878_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379384
NZ_CP009606.1\|WP_001245660.1\|118153_119971_+\|maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|238828
NZ_CP009606.1\|WP_000676621.1\|149917_150157_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_000829615.1\|129595_130933_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_000421395.1\|137996_138287_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_033693694.1\|144527_147128_+\|membrane-protein	unknown	unknown	gnl\|CDD\|367360
NZ_CP009606.1\|WP_000442644.1\|131132_132830_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366598
NZ_CP009606.1\|WP_000241151.1\|144012_144495_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_000753850.1\|148377_148974_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_001271974.1\|147155_148367_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|381612
NZ_CP009606.1\|WP_000413214.1\|127857_129552_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_000239390.1\|136887_137994_+\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|372237
NZ_CP009606.1\|WP_000890575.1\|126889_127369_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP009606.1\|WP_000914978.1\|141042_142875_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP009606.1\|WP_000192357.1\|138327_138732_+\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|372239
NZ_CP009606.1\|WP_000520256.1\|124137_125847_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_001006724.1\|112128_112539_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009606.1\|WP_002037656.1\|122038_123013_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP009606.1\|WP_002170371.1\|113102_113789_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009606.1\|WP_000747957.1\|114327_115878_+\|hypothetical-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	0.00141548
NZ_CP009606.1\|WP_000239390.1\|136887_137994_+\|conjugal-transfer-protein	gnl\|CDD\|372237	pfam12642, TpcC, Conjugative transposon protein TcpC. This family of proteins are annotated as conjugative transposon protein TcpC. The transfer clostridial plasmid (tcp) locus is part of some conjugative antibiotic resistance and virulence plasmids. TcpC was one of five genes whose products had low-level sequence identity to Tn916 proteins, having similarity to ORF13 homologs from Tn916, Tn5397, and CW459tet. This family of proteins is found in bacteria. Proteins in this family are typically between 302 and 351 amino acids in length.	2.64357e-24
NZ_CP009606.1\|WP_000890575.1\|126889_127369_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	0.004994
NZ_CP009606.1\|WP_001271974.1\|147155_148367_+\|lytic-transglycosylase	gnl\|CDD\|381612	cd16891, CwlT-like, CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	1.70716e-60
NZ_CP009606.1\|WP_000192357.1\|138327_138732_+\|conjugal-transfer-protein	gnl\|CDD\|372239	pfam12648, TcpE, TcpE family. This family of proteins includes TcpE a conjugative transposon membrane protein.This family of proteins is found in bacteria. Proteins in this family are typically between 122 and 168 amino acids in length.	1.83057e-14
NZ_CP009606.1\|WP_001245660.1\|118153_119971_+\|maturase	gnl\|CDD\|238828	cd01651, RT_G2_intron, RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin. RT transcribes DNA using RNA as template. Proteins in this subfamily are found in bacterial and mitochondrial group II introns. Their most probable ancestor was a retrotransposable element with both gag-like and pol-like genes. This subfamily of proteins appears to have captured the RT sequences from transposable elements, which lack long terminal repeats (LTRs).	1.22882e-90
NZ_CP009606.1\|WP_000914978.1\|141042_142875_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	1.61752e-120
NZ_CP009606.1\|WP_000442644.1\|131132_132830_-\|hypothetical-protein	gnl\|CDD\|366598	pfam01371, Trp_repressor, Trp repressor protein. This protein binds to tryptophan and represses transcription of the Trp operon.	0.000799364
NZ_CP009606.1\|WP_002037656.1\|122038_123013_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	9.95647e-16
NZ_CP009606.1\|WP_033693694.1\|144527_147128_+\|membrane-protein	gnl\|CDD\|367360	pfam03154, Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.	1.81565e-12

>NZ_CP009606.1|WP_000442644.1|131132_132830_-|hypothetical-protein
MERVIALFSDALLLAAPIYEENKQLWAKWQKYYNEVQENHDKLVTSANISPSFSTLVSWLGQKQEQGISLLHIYANLDKYKIEIQNVLDKIIEQEFGEKFEAAEPTQISNPEHGHIEERIADMPDEYYPVSNDAMYYQLRDGIAKNQFEEDEAAAKPVLPLETKNSSGVAQLSSHKDEDLRLVNTNEAERWSILVDGVISNMDDLTADCLDTITIQWLNQAKSPDEFIDFSYENVLELCNMPKASANGVEYYRAEDKIKVAQRIAALASIFIYLNDDNEVVVLNDQAETGEKFEVKREVIKRLFVLDSVVLWRDKNTNEYMGIESCKIKPGSFLSGYLYGSNSTTALLSKKALEYNSYRHKFHKRLIRYLSWQWRIRQQYSTLKRPYSIGGEKGLLSVMGITPTKGRPTRTREQLENILNDLEKENVISHWAYAEELDETKIGERNWFKNYYSKLGIIILPPKELMNNIYSMVKKKAIDMQEKQEDHYIAETVKQTPEGSEDVIREKIMYQHMHQNKTMREIADEIGLSPATLSRFCNNKMKRISKSVNEKLKKWYERQMIIESM
>NZ_CP009606.1|WP_000829615.1|129595_130933_+|hypothetical-protein
MAENISMLQIIDRDNLCKLFTKSFYIPEPYREAVIQGVINNANNITLERATELVSKSFSPIDLLKSKNYKEKQGYAIWRGFFTEWIINVQYNSFVNKEPVLMTIVNPDPTSKCDLLHVIKAGDFIKCVAGPDIKTGQINYALDQYERICKSKYDIPFFDADRNFSEENIQRLTKRQRERFDNLQKQYPRKKIIHPIFSNQDMIHITYDFLHYAAFNELPSQRTTQNTPITKEERKDIFIKAIKGAEVLKNKEKIPTSFIDCKLELEQERQNTTKAEVKAKANNETASIKNFDSKNDKVDSIDSKSTNKLQNLKDTVAYKLGKGAIKYAGKFFVEGAKQEIIRNLDSIGRGLSNGLSKIFRGDSRINESKGSNINSMDNRNKGSLVAKEMETSDSHSKQNAVMKEINYPEKRESPGPHWVSEHTRNDGQVKVRAHPRGISDGKDKD
>NZ_CP009606.1|WP_000413214.1|127857_129552_+|hypothetical-protein
MEKLKVLFQNTLYIAYPLLTGVEGSERVLNKWQQFYQDVERDLQAIYNSTYSSQTFERLVKWVSKKEALGLSAIDILPKLDNHKEEIFECLKDDLYMEFGIKLPVIKKELPLDSEAKSEYIERSNAGFMYHLSDTIAKNKFTDDQDKNVRIAQLQDKQNSLVVVSSHDDGDMKLQREELKRWNTLIDSTFLTRVMDDLTADCLDIVTELWVKSAENDKTIVPVHYEQILDMCNMKQIKNGKAYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNEEDPNETLAYKKQRIRRLFVMDEIIIAKDIDTDKTLGIESMNVTPGSFLSKYLYGSEKLTGLLSKKALEYNSKQQRYHKRLTRYLSWRWRIQQSYQHLTHSYSIGGPKGLLQVMEISMNRKPSLIRQVFEKTLDDLMRDQVIQEWKYSPEIDEEKCKGKNWFENYWLKLKVIISPTNELVKLQQELITKKNKQQVPLVIEMEEKPSVIEEKPVSILNQEIPNSIEFYIEKMNTYKEKNNKSIRGLAKEIDISYSTLSRMLSGQRKRLNDDTKNKLDKWIERQEVMNLL
>NZ_CP009606.1|WP_000890575.1|126889_127369_+|CPBP-family-intramembrane-metalloprotease
MLEKLNRFMFDLPIIWFVLLIVFGSFLLVMPLDLFLPAIKQHPIKEEPAIIQILVGVFAAPVYETVIFQVFLFWVLSCIPLIKDRDYLIILIASIIFGLIHSDGITYIVATAIIGVLYNYAYWVYQKKNENVEVTISAFWIVVLIHSLHNSIAVIASQL
>NZ_CP009606.1|WP_000520256.1|124137_125847_-|hypothetical-protein
MGKSFVIRNQRSLNGETTNAVLVTLKSWQKFVETFEEKYYSYKDTYLEDILQHMTYEDRIADVDGFVEKAKPSFSRRAISALAEKTGRKHKLYGITNADLEVFLYLHKKCFTNGIIPNVTVHMMWEDYKQYKEELAYIQHSQFYIALKKLSLHNIISIKNGVDGRYTIKLTHFTNEETKKANPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHRETTLKRSLDKLDERGNKTHFGGMYRYLHKKYPHQIHAVIDELTTVVPSTGTPLFKICKMQKGVKNTKRYTTLYLSIHPDFLCTKESGNVHHRDPFTPKATYARKARFIEDLLQEMNIGELSADMDKFIHVLKHTSHRQIRSVIRGLRDMIDSKEGFPKKIVYTLKKLLYQTSQYKILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYAMYSLRNIKKIFKSVYALLKQKFAVPANEESYNRNYLKYQEETLFRKYAYDQGVNVHAYVALEIKMREKLKNRGHKDRTIPSDIREWFIEEIDRLPQEHLRVIELSQSFNLLEFMRTFERLVRAGVTIKSADQVLNAIAIK
>NZ_CP009606.1|WP_002037656.1|122038_123013_-|tyrosine-type-recombinase/integrase
MIILNETISLEENLKAFSTYLSEKGRKHSTIQRYAYDIKDFYRWLNENELLLHIKSWNEISVHDYQAYFSMLENKREYSLKTRHRIWVVLKKLHTFLGIVSPLDDIHLSLIPDQSLNDNDFITELEEKLLKQTVLSTKGLTERQAKYRPLIMDRNACIINLIVNYGLSLQELVSLNMSHIQFARNTLTVSGENGVTRSVFLTAEDTKQLYKYYSTIPESVRPRQHTDNPLFVAFDFNRGTYRWVYENDAPKALSEVAIQKMIRLEVKRAELGRRISAQQMRNTFIFRLIKQGINEDELVNKIGFKTKVSLKRYYQYLMLSKKTR
>NZ_CP009606.1|WP_001245660.1|118153_119971_+|maturase
MRNPNEVLNSLNTKANNANYKYKRLYRNLYNPEFYYMAYSKIYAKEGNMTKGTDGNNIDGMSIERINTLIDRIKNETYQPYPAKRVYIDKANGGKRPLGIPSTDDKIVQEIIRSILESIYEQTFSDNSHGFRPKKSCHTALIQIQRTYRGVRWFVEGDIKGFFDNINHLTLINILRKRIDDEKFIRLIWKFLRAGYLEEWTYNNTFSGTPQGGIISPILSNIYLNELDQFMNNYKQQFDKGIRRKETRDYGYLSEKKYRLRKKHVNSWGQMSEEEKREVKTQWNELHKKQLSIHSKDQMDADYKRIVYTRYADDFLIGIIGSKEDATQLKENLTIFLKEKLDLELSQEKTLITHSQKLAQFLGYDITISREQSTAKTTHGRTKRLYSYTPKLYVPKSKWIKNLLQKDALVIENKIGTWKAKHRTYLKDNDDLEILSIYNAEIRGLYEYYKLANNVSVLNKYKYIMEYSMYKTFANKYNTSVKKILNKYKINGKFGIQYKTKNGEKIRYLYDKGFQRQKHTDNKPEVDILPNTLKMSGRTSLIKRLLAEECEMCGKKNQAIEMHHIRKLKDLKGKKMWEQMMISRKRKTMALCQQCHIDLHLGKLD
>NZ_CP009606.1|WP_000747957.1|114327_115878_+|hypothetical-protein
MKKSFDHAVKYIVGENDRGVYFNRSDIFTVLFLYEQRTVSQIQLRKFYELISGEPISRTTFSSKLTKWAKMKLIKKENISVRKKRGFTLDFVSIASKGTEVLYRLKLITDYNTSFVTKRQYEHNIAITQFVLNLLEAESQNEHTGAIVGGNGDYLFPLNSIVKQNLHLPNLMYSDSNDVYFLYEDEEYREMFQPELQPVSFQPDLPQLVYSFRPSKEFYLDSKGNPLIIPDWVLTCNDSIINIEVDTGTENIPFLENKLKKYLDIAASNPSKQFYVLFSVIDDSYHTISTYKKRTTRVTNLKKAFSNIPRLSVVNNLNVYVSNMGGSALVINNILHEIREINSLNKSHLFKKIAERLNINSSFPYSVEWISNKNEIQAKGIQHSKLLELTDDILVLRKKAPDEEKKSLDYLEILCILTILKVGEVNTHFKLQQLSGLLAMQNQHRTLNPIKILGIYEADELEHGQQAIFTDLYHNSIAPENILLATSAELLNFTAAFYSLKERVKQEFGECSSKEC
>NZ_CP009606.1|WP_002170371.1|113102_113789_-|hypothetical-protein
MLQFDLRGEKMRNWNTEYGLITKIIQSEFETDFLYTQVINTLSNEHEIIPIKFAALDPYKTYNMAQVSRILRIKSNQLRYLINKYGEYIQLIKKRAKYAISFKALYRIYLVNLCLTKKLISLGEFNKIMTTHVSYSDYIDMKLTSYTDKFVELNYKTSQLNENESEFYVLFLQISEITTELIKEIAEYNMTLTSPFLSVDNRERNKLVNKKRDHEVLFNKLSILYKNL
>NZ_CP009606.1|WP_001006724.1|112128_112539_-|hypothetical-protein
MNEVLSEKYKQNKFTPEVVEMFADIIEEDEILYNVFHYIGSQVNKQYQETKYMRGISINEIVENVVIDRRVKKPKGKSYSLEIERTNISRRSAEGSVGTLAAMSLITEKIMHPYKFLISTIRGQQILIELEKRKNK
>NZ_CP009606.1|WP_001118185.1|134184_135894_+|hypothetical-protein
MAKPFVIKNKRSLNGETTTPVIVTIKSWQRLVEALEGKYYSFKDTYLEDIVKSMSYEERIADEEGFVAKAKPSFSLKMKKIVDKVSEFDKNEGRKHKLYGITNADLEVFLFLHKKCNTYGELSHVSIHMLWEDYKNYKEAFAHIHHSQFYVALKKLSFHNIITIENEYSGKYKITLTDFMNKETNKANAYTFISPIVFTKEFFELSIAAKKLFMDVAMQQKRETTLKRSLFKVDEQGNSTHFGGMYHYLHKKYPHQIRAVLDELETKLSATGSPLFKICKLEKGKRNKKQYTTLHLSVHPDFLCAKEEGAEYRDPFTPRDTYKRKVKFIENLLVEMNIAEFAKDMNQFINVLKHSCHRQIRQVVRGLREMIDRQEGYPKKLVYTLSKLLKQSSQYRVLDTAAKTGIYPLITHNVPKHDQEEAIFKFGTHFAIYSLRNVQKLFRKAHDLLHAKYAVPVTIDAYHRNYMQYQEESLFRKYAYEQGVNINAYTALEIEIRELLKSSGHKGNQIPSDIRELFIEKIDKLPKEKIRVIEVPEDFDLIQFLHSLEAYYRSTKEVPHTVDQLLPAM
>NZ_CP009606.1|WP_000239390.1|136887_137994_+|conjugal-transfer-protein
MVKKKSQKNPEKKKFTFFKKAKTKTTEILDMQQENSEALKEKKKRKTREKVPAITGRKVGKVTFWFVMGFVVVGSSLSFIQLAGPPRAVAVQEKKEEPVKIKMSEAELIAYANNFAANYFNWKVDMNVAEERRKRLEKFLVEGSDEQGGLNRDTLKNASSTLVKSEAVEVRQKGNEAEVTLKIIQKLEPVNNPAPGTTQAPDTPKEPKEVTRYFSIPILMEKGKMVVPNNPTIVHGEREKAPYKIATFKSEGREINTDAEIKKVEQFLQSVFKVYTEGTPEEIAYYFEKSNITNGLKGIMTFNKLENLRIYEDKDKGYRVLVDAKLKDNDSNLEYTYSYDLNLVNKDNKFSISSMKKFENTLEKVEGK
>NZ_CP009606.1|WP_000421395.1|137996_138287_+|hypothetical-protein
MELLGLDMVAQQLPAITDAAVLGNINFGVNIKNWLVAQLGPIFLVCAIIGVIVLLVKRQMAGLIGWLVLCAIVSVFVFSPDVFKDLGTKLYNLVFK
>NZ_CP009606.1|WP_000192357.1|138327_138732_+|conjugal-transfer-protein
MTQKPTRKEVRTYNSIWDIPKSLYGIRDITLPFPVPYRQLGIFVGTLLVIIFLDQFLPLGENVFFKYLILPGGIAYFFGNVELDGKSPHKFIYRFFAFTFERKKLSRYKDTTGNIGSYQYKTVVRFKDDSIKKK
>NZ_CP009606.1|WP_000914978.1|141042_142875_+|group-II-intron-reverse-transcriptase/maturase
MLKKTKLRHSEYYDMQRKYDELYSNSLNGNNFYKLIDIIGSEENIRLAYRNIKTNKGSNTAGVDNLTIKDIWHLNDTKIIHEVRKRLNNYQPQAVKRVLIPKEGSDKKRPLGIPTIWDRLVQQSILQVLEPICEAKFHNHSYGFRPNRSTHHALSRVVSLINIGHQHYCVDIDIKGFFDNVCHKKLLRQMWTLGIRDKSLLCVISKILKSEIEGEGIPNKGTPQGGIISPLLSNIVLNELDWWISSQWETYKPHRISTRHLGFRQYARKYTNLKCGYVVRYADDFKIMCRTYDEAQRFYHATVDFLKSRLGLEINPKKSKVVNLKKNSSVFLGFKIKVVKQGKAKFGYIAKTSMSDKAITKAKRQLKERIKGIQKEPTSEKVTQFNSTLLGIQNYFKYAVTIYMDLTEVNYSLRRVIRTRLRNNMKHMKFCETSVNFKRKTKGIQPNTKIYVVQNTPLLPVTGIHHKNPWNFSQVICNYTETGRNKVHSNLKAIPKDVLNQVMRTYSKNKSIEYNDNRISKYVAQYGKCYVTGEEIGIERVHCHHIVPIKQGGDDKYNNLVIVDWFIHKLIHMTNLNKITHYLRSFKLNKKQMDKLNVLRTKAGNEPIVT
>NZ_CP009606.1|WP_000241151.1|144012_144495_+|hypothetical-protein
MVKTKLKKLMLSSLCAGALILSAACGNSETNVGEEKDKQGHTPREMMLDFVKADLQHDYKTIRKLVVDGEKNKILDPNKGPQNNLSYKDYTVKEYVVDKDTIMYNFISKKPPKNIDKAVKWIRVVRTDDGFKVRSYTGPERNEIDEVANTKPTNEFSSKD
>NZ_CP009606.1|WP_033693694.1|144527_147128_+|membrane-protein
MKKFITLLLLICTLLLAFNLLFKAAPVYAEEEPRPSLIDDIIPKNKEKLKYEEYPPSSYGIDVYTPEGGFGESLKFWKWKDNIKEQIVATIFILISIGWSVNLAISSFVTSMVGQSMSLNIVADVGDKLGDVISKAAGFNGSWGNGIYSELIGLMLALLACWVIWVGFVQRRQSEMLGGLLKTLGILVFTLAFFANSSYIIKGLNTFSEQVNKTVLDSTQSISGASEGYSSGVDSITDLTHTLLIKQPYTLLQFGTTDMKKIGDERIKKMLTTTDPDERKALLKDEVEVQKNQTLSLDATFERGALVLLLGAINLPLWIVLGLCSMAMLFYQLMFIIVALMSPVMLLMALVPAWTGTAKKFLSELFRTLLMKVAIGFLVTLMFWVSSILFSATDKYGYLVVAALQVLSFLGVWLYRKTIFDAITTVPASAGAARASDAMSNIRQKYRDVRRGSKTVGRGVAVAGAAGLASAAVAGKVGKSGYSKFKQLKENYADRKEKVADGKRKEKEQMQAEKEKNINQMKKEENLGVRDRKGNQEQERVKEEVAATKENPELAVRGQHQDNNPEMQQAELKDKEEDVKADVQPVAQSNDELNNKEEDVKAQVRPVANQNSSGLENKQEDVKAEAKPGATIKTPTGQTKPITTPLSGTTPLQSSPMESKPITTPQSGTTPLQSSPMESKPITTPQSGTTPLQSNPMESKPITTPQSGPTPLQSNPMESKPITTPQSGPTPSPANPVESKPITTPQSGPTPSSANPIESKPITTPQSGPTPSPANPVESKPITTPQSEPTPANPMESKPVTTSHVSTPQKQVEVKSVNQQQTKSVPKVNNQQQVKEGAAIKKVETKAQTQQEALKNVKAKETIKPK
>NZ_CP009606.1|WP_001271974.1|147155_148367_+|lytic-transglycosylase
MSAEPNRDFENEHHPEAELGNAKPALKKAGHSLGKAAGKGSKIAGKAVAQVSKKVAVKVAQKAATVAVAKPLLIIAGVILAVVAGLGIVIFLLTATMGEDEVSPGGIGGPFTPGTASVSPEVMRWEPLVRKYAAQHGIEAMTPLILALIQQESSGTQLDVMQSSESQGYGPGYFTDPEESIKYGLMHFADCHKKSNGDPNITLQCYNYGTGYANYALSNGGYTHANARAFSAEQTAKTGYKCASWRSAEAVANNWCYGDPDYVPHVLRYYQGGSGGGPVAGGDELFKKVMDEAIKYQGWPYVWGGRTPQSSFDCSGLIQWVYGQAGINLVGTAETQFKMTQRTNDPQPGDLIFFQGTYKPGISHIGIYVGNNRMFHAGDPIGYADLNTPYWQQHFAGYGKVAR
>NZ_CP009606.1|WP_000753850.1|148377_148974_+|hypothetical-protein
MKKTTILLIVLLIGSIGLNFKINADNAQLKDEKAKLSKKIQKVESQYKDTEKELQALKSNNQQQVKEAAERFLKAFRTYDTGKGESYITNVEAYITPNAKKELTPPGAPNPPASSTAEEKDKKKLAFKSEYIGGELYYAFIDTTKANVLAKVKSKMIINGVSSENMSLMQINLIYDGNKKLWLVDKVIPLADLRDQMP
>NZ_CP009606.1|WP_000676621.1|149917_150157_+|hypothetical-protein
MKGKINKITQSLQLEIFKMLTNSPSLRLILRGAGVTFVIIFGTALTKQPTVFSINFVMIILGFFLIFMPYIFRNYKKLN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009606_1	1.1\|133217\|82\|NZ_CP009606\|CRISPRCasFinder	133217-133298	82	NZ_CP009595	Bacillus cereus strain 3a plasmid pBFC_3, complete sequence	266982-267063	22	0.732
NZ_CP009606_1	1.1\|133217\|82\|NZ_CP009606\|CRISPRCasFinder	133217-133298	82	NZ_CP009606	Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence	133217-133298	22	0.732
NZ_CP009606_1	1.1\|133217\|82\|NZ_CP009606\|CRISPRCasFinder	133217-133298	82	NZ_CP053994	Bacillus cereus strain FDAARGOS_780 plasmid unnamed1, complete sequence	206988-207069	22	0.732
NZ_CP009606_1	1.1\|133217\|82\|NZ_CP009606\|CRISPRCasFinder	133217-133298	82	NZ_CP053992	Bacillus cereus strain FDAARGOS_781 plasmid unnamed2, complete sequence	190004-190085	22	0.732
NZ_CP009606_1	1.1\|133217\|82\|NZ_CP009606\|CRISPRCasFinder	133217-133298	82	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	191569-191650	22	0.732
NZ_CP009606_1	1.1\|133217\|82\|NZ_CP009606\|CRISPRCasFinder	133217-133298	82	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	99749-99830	23	0.72

1. spacer 1.1|133217|82|NZ_CP009606|CRISPRCasFinder matches to NZ_CP009595 (Bacillus cereus strain 3a plasmid pBFC_3, complete sequence) position: , mismatch: 22, identity: 0.732

cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	CRISPR spacer
cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	Protospacer
************************************************************

2. spacer 1.1|133217|82|NZ_CP009606|CRISPRCasFinder matches to NZ_CP009606 (Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence) position: , mismatch: 22, identity: 0.732

cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	CRISPR spacer
cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	Protospacer
************************************************************

3. spacer 1.1|133217|82|NZ_CP009606|CRISPRCasFinder matches to NZ_CP053994 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed1, complete sequence) position: , mismatch: 22, identity: 0.732

cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	CRISPR spacer
cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	Protospacer
************************************************************

4. spacer 1.1|133217|82|NZ_CP009606|CRISPRCasFinder matches to NZ_CP053992 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed2, complete sequence) position: , mismatch: 22, identity: 0.732

cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	CRISPR spacer
cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	Protospacer
************************************************************

5. spacer 1.1|133217|82|NZ_CP009606|CRISPRCasFinder matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 22, identity: 0.732

cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	CRISPR spacer
cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	Protospacer
************************************************************

6. spacer 1.1|133217|82|NZ_CP009606|CRISPRCasFinder matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 23, identity: 0.72

cttattatggctataagcttttatttcaaattttatagctttatcacggctattacttct	CRISPR spacer
cttattatggctataagcttttatttcaaattttatagctttatcacggcaattacttct	Protospacer
************************************************** *********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 20796

Bacillus_phage(54.17%)

portal,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144405013.1\|257_1127_+	hypothetical protein	B4XYS6	Lactobacillus_phage	1.1e-24	47.4
WP_000412107.1\|1139_1418_+	hypothetical protein	NA	NA	NA	NA
WP_042631203.1\|1395_2688_+	replicative DNA helicase	D2XR44	Bacillus_phage	4.1e-89	41.4
WP_001257508.1\|2684_2957_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.5e-25	65.5
WP_042631156.1\|2967_3534_+	hypothetical protein	A0A2H4J8I5	uncultured_Caudovirales_phage	1.8e-09	35.0
WP_042631157.1\|3530_3953_+	hypothetical protein	A0A1B1P8A6	Bacillus_phage	2.9e-15	54.2
WP_080335271.1\|3961_4096_+	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	2.1e-12	79.1
WP_042631158.1\|4085_4514_+	hypothetical protein	A0A1S5SDX2	Streptococcus_phage	3.3e-11	36.9
WP_042631159.1\|4510_4705_+	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.1e-19	75.0
WP_000201627.1\|4771_5020_+	glutaredoxin family protein	B5LPN1	Bacillus_virus	5.9e-37	92.7
WP_042631160.1\|5211_5709_+	hypothetical protein	M4W9N7	Bacillus_phage	2.6e-15	35.2
WP_042631161.1\|5747_5957_+	hypothetical protein	I1TLG8	Bacillus_phage	3.9e-34	97.1
WP_000678895.1\|5995_6304_+	hypothetical protein	A0A2H4J3B9	uncultured_Caudovirales_phage	5.5e-08	51.0
WP_042631162.1\|6343_6538_+	hypothetical protein	NA	NA	NA	NA
WP_042631163.1\|6574_6853_+	hypothetical protein	NA	NA	NA	NA
WP_080335273.1\|6946_7237_+	hypothetical protein	B5LPN7	Bacillus_virus	3.6e-41	87.5
WP_042631165.1\|7354_7543_+	hypothetical protein	NA	NA	NA	NA
WP_000650110.1\|7539_7806_+	hypothetical protein	NA	NA	NA	NA
WP_042631166.1\|7835_8096_+	hypothetical protein	NA	NA	NA	NA
WP_042631204.1\|8128_8458_+	hypothetical protein	NA	NA	NA	NA
WP_042631167.1\|8653_9070_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	1.9e-48	70.1
WP_042631168.1\|9305_9692_+	ArpU family transcriptional regulator	D2XQ27	Bacillus_virus	1.7e-62	96.9
WP_042631169.1\|10870_11128_+	hypothetical protein	NA	NA	NA	NA
WP_000401823.1\|11409_11652_+	hypothetical protein	A0A1B1P743	Bacillus_phage	1.8e-22	68.8
WP_157404518.1\|11666_11822_+	hypothetical protein	NA	NA	NA	NA
WP_042631170.1\|12286_12547_+	hypothetical protein	NA	NA	NA	NA
WP_000810408.1\|12615_13410_+	hypothetical protein	D2XPX8	Bacillus_virus	2.0e-65	68.1
WP_000178976.1\|13381_14701_+\|terminase	PBSX family phage terminase large subunit	A0A0S2MVC1	Bacillus_phage	3.5e-176	69.4
WP_042631171.1\|14700_16233_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	2.4e-96	41.5
WP_042631172.1\|16219_17146_+	hypothetical protein	A0A1B1P7D7	Bacillus_phage	1.1e-46	36.1
WP_042631173.1\|17192_18398_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	3.1e-78	45.5
WP_042631174.1\|18413_19331_+	hypothetical protein	A5GYL9	Lactococcus_phage	1.2e-45	34.8
WP_042631175.1\|19347_19530_+	hypothetical protein	NA	NA	NA	NA
WP_042631176.1\|19535_19925_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	2.7e-20	40.8
WP_042631177.1\|19924_20317_+	DUF3599 family protein	NA	NA	NA	NA
WP_042631178.1\|20301_20796_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	6.9e-37	48.8

DBSCAN-SWA_2

25636 : 51322

Bacillus_phage(45.0%)

plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042631182.1\|25636_26518_+\|tail	phage tail family protein	A0A2P1JTW0	Anoxybacillus_phage	4.8e-73	47.6
WP_042631183.1\|26529_28377_+	hypothetical protein	A0A2P1JTV8	Anoxybacillus_phage	1.2e-129	56.6
WP_001985685.1\|28386_28653_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_042631206.1\|28713_30330_+\|plate	BppU family phage baseplate upper protein	D2XPZ7	Bacillus_virus	3.6e-74	58.4
WP_042631184.1\|30345_31017_+	hypothetical protein	A0A1B1P882	Bacillus_phage	1.4e-51	61.7
WP_042631185.1\|31127_31487_-	DUF1413 domain-containing protein	NA	NA	NA	NA
WP_042631207.1\|31652_31889_+	hypothetical protein	A0A1B1P887	Bacillus_phage	1.4e-16	63.2
WP_042631186.1\|31890_32094_+	hypothetical protein	A0A1B1P886	Bacillus_phage	1.6e-32	95.5
WP_042631187.1\|32090_33155_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	4.8e-200	96.6
WP_042631188.1\|33197_33554_-	YolD-like family protein	NA	NA	NA	NA
WP_042631189.1\|33664_33862_-	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	1.4e-12	56.2
WP_042631190.1\|33985_34822_+	nucleotide excision repair endonuclease	NA	NA	NA	NA
WP_042631191.1\|35376_36672_+	cell division protein FtsK	B3RH36	Bacillus_virus	5.7e-107	44.9
WP_080335274.1\|36613_37189_+	hypothetical protein	B3RH37	Bacillus_virus	1.5e-67	63.2
WP_042631192.1\|37208_37697_+	hypothetical protein	A6XML4	Bacillus_virus	6.7e-16	53.8
WP_042631193.1\|37781_38381_+	hypothetical protein	NA	NA	NA	NA
WP_042631194.1\|38457_39048_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	3.9e-10	45.1
WP_042631195.1\|39092_39356_-	hypothetical protein	NA	NA	NA	NA
WP_033691956.1\|39451_39811_-	hypothetical protein	NA	NA	NA	NA
WP_042631196.1\|39803_40631_-	AAA family ATPase	F0PIG8	Enterococcus_phage	2.3e-53	41.1
WP_000923178.1\|42225_42579_+	hypothetical protein	NA	NA	NA	NA
WP_000468107.1\|42680_43442_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_042631197.1\|43498_44638_-	excalibur calcium-binding domain-containing protein	A0A0A7AR49	Bacillus_phage	4.8e-41	52.5
WP_042631198.1\|44827_45172_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	5.4e-20	46.4
WP_144405014.1\|45914_46808_+	hypothetical protein	A0A1B1P895	Bacillus_phage	2.4e-51	38.8
WP_042631200.1\|47302_47647_-	helix-turn-helix transcriptional regulator	D2XQ11	Bacillus_virus	7.9e-56	97.4
WP_042631201.1\|48113_48884_+	antirepressor	A0A1B1P8B0	Bacillus_phage	8.2e-69	100.0
WP_000572096.1\|49342_49543_+	hypothetical protein	NA	NA	NA	NA
WP_000387974.1\|49544_50480_+	hypothetical protein	S6C475	Thermus_phage	3.4e-101	59.8
WP_000002672.1\|50494_51322_+	recombination protein RecT	S6AVW6	Thermus_phage	2.5e-100	68.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP009605

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009605_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009605_1

609971-611059

Orphan

Consensus_repeat	Method
TTGAGGTCCAGTNGCACC	CRT

24 spacers

The CRISPR arrays of NZ_CP009605_1

>merge|NZ_CP009605|1|609971-611059|CRT
TTGAGGACCAGTAGCGCCAGTAGCACCCGTTGGCCCTTGAACGCCTTGAGGACCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAACACCTTGAGGTCCAGTGGCACCAGTAGCACCTGCTGGTCCTTGAACGCCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCAGTGGCACCGGTAGCGCCTGCTGGTCCTTGAACGCCTTGAGGTCCGGTAGCACCGGTAGCGCCTGCTGGTCCTTGAACGCCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCGGTAGCACCGGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAGCACCTTGAGGTCCAGTAGCACCGGTAGTACCTGCTGGTCCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCAGTAGCACCCGTGTTACCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGCCCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGCCCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAACACCTTGAGGTCCAGTGGCACCGGTAGCACCTGCTGGTCCTTGAACACCTTGAGATCCAGTGGCACCGGTAGCACCCGCTGGTCCTTGAACACCCTGAGGTCCAGTAGCACCAGTAGCACCCGCTGGTCCTTGAACACCCTGAGGTCCAGTAGCACCCGCTGGTCCTTGAGCGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACACCCTGAGGTCCAGTAGCACCTGTGTTACCTTGAACACCTTGAGGTCCAGTGGCACCAGTAGCACCTGTGTTACCTTGAACACCTTGAGGTCCAGTGGCACC

>NZ_CP009605|1|1|609971-611059|CRT
TTGAGGACCAGTAGCGCC	AGTAGCACCCGTTGGCCCTTGAACGCC
TTGAGGACCAGTAGCGCC	AGTAGCACCTGCTGGTCCTTGAACACC
TTGAGGTCCAGTGGCACC	AGTAGCACCTGCTGGTCCTTGAACGCC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGTCCTTGAACGCC
TTGAGGTCCAGTGGCACC	AGTAGCACCTGCTGGTCCTTGAGCACC
TTGAGGTCCAGTGGCACC	GGTAGCGCCTGCTGGTCCTTGAACGCC
TTGAGGTCCGGTAGCACC	GGTAGCGCCTGCTGGTCCTTGAACGCC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGTCCTTGAGCACC
TTGAGGTCCGGTAGCACC	GGTAGCACCTGCTGGTCCTTGAGCACC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGTCCTTGAGCACC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGTCCTTGAGCACC
TTGAGGTCCAGTAGCGCC	AGTAGCACCTGCTGGTCCTTGAGCACC
TTGAGGTCCAGTAGCACC	GGTAGTACCTGCTGGTCCTTGAACACC
TTGAGGTCCAGTGGCACC	GGTAGCACCAGTAGCACCCGTGTTACCTTGAACACC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGCCCTTGAACACC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGCCCTTGAACACC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGTCCTTGAACACC
TTGAGGTCCAGTGGCACC	GGTAGCACCTGCTGGTCCTTGAACACC
TTGAGATCCAGTGGCACC	GGTAGCACCCGCTGGTCCTTGAACACC
CTGAGGTCCAGTAGCACC	AGTAGCACCCGCTGGTCCTTGAACACC
CTGAGGTCCAGTAGCACC	CGCTGGTCCTTGAGCGCC
TTGAGGTCCAGTAGCGCC	AGTAGCACCTGTGTTACCTTGAACACC
CTGAGGTCCAGTAGCACC	TGTGTTACCTTGAACACC
TTGAGGTCCAGTGGCACC	AGTAGCACCTGTGTTACCTTGAACACC
TTGAGGTCCAGTGGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009605.1\|WP_000135328.1\|619363_620698_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP009605.1\|WP_000640848.1\|603461_604373_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP009605.1\|WP_000957281.1\|602712_603465_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP009605.1\|WP_000704625.1\|604386_606243_+\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP009605.1\|WP_000504940.1\|608013_608967_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP009605.1\|WP_000438185.1\|614270_615227_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP009605.1\|WP_000312272.1\|615496_616120_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP009605.1\|WP_001179101.1\|601390_602554_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP009605.1\|WP_000228316.1\|600731_601274_+\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP009605.1\|WP_000534160.1\|622531_622840_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_000450309.1\|613191_614157_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP009605.1\|WP_002036934.1\|620745_622470_+\|terminase-large-subunit	unknown	unknown	gnl\|CDD\|226974
NZ_CP009605.1\|WP_000813896.1\|608988_609213_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP009605.1\|WP_001983561.1\|622857_623898_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|274862
NZ_CP009605.1\|WP_000656783.1\|618925_619315_+\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP009605.1\|WP_000391400.1\|616212_617487_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP009605.1\|WP_000814422.1\|607586_607832_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_000460300.1\|617479_618751_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP009605.1\|WP_001989514.1\|600078_600420_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_000734623.1\|606591_607524_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112

Protein	Function_ID	Function_description	E-value
NZ_CP009605.1\|WP_000640848.1\|603461_604373_+\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.78514e-142
NZ_CP009605.1\|WP_000957281.1\|602712_603465_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	4.52687e-82
NZ_CP009605.1\|WP_000704625.1\|604386_606243_+\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	2.89059e-142
NZ_CP009605.1\|WP_000504940.1\|608013_608967_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NZ_CP009605.1\|WP_000438185.1\|614270_615227_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NZ_CP009605.1\|WP_000312272.1\|615496_616120_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60
NZ_CP009605.1\|WP_001179101.1\|601390_602554_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP009605.1\|WP_000228316.1\|600731_601274_+\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP009605.1\|WP_000450309.1\|613191_614157_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13
NZ_CP009605.1\|WP_002036934.1\|620745_622470_+\|terminase-large-subunit	gnl\|CDD\|226974	COG4626, COG4626, Phage terminase-like protein, large subunit [General function prediction only].	1.38804e-82
NZ_CP009605.1\|WP_000813896.1\|608988_609213_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP009605.1\|WP_001983561.1\|622857_623898_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	4.65842e-20
NZ_CP009605.1\|WP_000656783.1\|618925_619315_+\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP009605.1\|WP_000391400.1\|616212_617487_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP009605.1\|WP_000135328.1\|619363_620698_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP009605.1\|WP_000460300.1\|617479_618751_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP009605.1\|WP_000734623.1\|606591_607524_+\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.48927e-35

>NZ_CP009605.1|WP_000813896.1|608988_609213_+|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP009605.1|WP_000504940.1|608013_608967_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP009605.1|WP_000814422.1|607586_607832_-|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYIQNQFCSAYKIITGKTIYPFQ
>NZ_CP009605.1|WP_000734623.1|606591_607524_+|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVAKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP009605.1|WP_000704625.1|604386_606243_+|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNGKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFSKQLLEAKDEEELLRLFDEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIALATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP009605.1|WP_000640848.1|603461_604373_+|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP009605.1|WP_000957281.1|602712_603465_+|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP009605.1|WP_001179101.1|601390_602554_+|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWNSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NZ_CP009605.1|WP_000228316.1|600731_601274_+|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP009605.1|WP_001989514.1|600078_600420_+|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS
>NZ_CP009605.1|WP_000450309.1|613191_614157_-|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NZ_CP009605.1|WP_000438185.1|614270_615227_+|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NZ_CP009605.1|WP_000312272.1|615496_616120_-|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP009605.1|WP_000391400.1|616212_617487_+|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP009605.1|WP_000460300.1|617479_618751_+|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP009605.1|WP_000656783.1|618925_619315_+|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP009605.1|WP_000135328.1|619363_620698_+|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP009605.1|WP_002036934.1|620745_622470_+|terminase-large-subunit
MGKTLLFERRVIHPQNTHKKIKFCAESMRKQYPLSHNPIIDYYNKIESGEIVVGNKVKRIYKKLVSDVYNNDSEYEYDSNRANHVIEFIENYCKHSKAKWAGKPIDLELWQQAFLAATFGFVHKIDGTRKYREAFLVVARKNGKSTLSSGICLYLQVADGEGGSEVYAVATKEQQAKIVWSESKRMVKKSPALSKRIKTLVKELTAGFNDSVLKPVGSDSDTLDGLNVHGASLDEIHAWKDKNLYDVIVDGTSAREQPLILMITTAGTVRESVYDMKYDEVEMLLNGLEDKDGYTDDRFLPVIYELDKREEWTDKTKWAKANPGLGTIKKIDNLETKINKAKANSLLVSNLLTKDFNIRETSSEAWLTFEQLNNVATYNIKELKPSYGIGGADLLATTDLTAAKVIFMVANDPHIYVKQMYWLPEDLLEKRSKEDKIPYDLWYEQGLLRTTPGNSVHYKYVTEWFIEMRDEYGIYIPWIGYDRWSENYWVEEMEGYFGKESMIPIAQGKQTLSSPMKHIGLFIYNEFYDWSYLRKNDLLISILKLLGMNSLLLIDRYGGSLKELIVYAKWMFVK
>NZ_CP009605.1|WP_000534160.1|622531_622840_-|hypothetical-protein
MGRYPTITIIKELDNSEYTIYSFGPTIDICEQYPEMYERWRFKILKDKTTFEEGYVLLDDLPKEDFQLFYKCAFKIYKQVDEHGGMENIKNIDLPNQISFII
>NZ_CP009605.1|WP_001983561.1|622857_623898_-|WXG100-family-type-VII-secretion-target
MVQIKVTPEMLEEVANHANNTRIALESIHNNLCNEIDRLCFQWIGASNQQFVQMFNDARPKAFTAINSIIQVEEDLKRIAEKFRNADDQDVTMEEGAMCGKPSSEEKGFDGKKLARDIAGEVSGEYDVRRAWDGIDPSTGEKLSTLERFLAGGMAVAGVTPVGKIAKIGKGVKMTAKAAEAVNTAKNAEHASDITKFYSGGRSFVVQFMEGEQRVAKMYDEIRGNASDIAAISKNTGWSDKRIQRIKDHVFIKDHQLPDNRVGKFDPDFGIARAWQRLEQGIHHENDIKLLKHEYFESRFEGIFKVDYATAHAKTVESGRPWKAPDSEPFNPLDEHFKIPLDKAFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009605_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009605_2

823194-823295

Orphan

Consensus_repeat	Method
ACATTCTCAAAAGAAACCTAAATT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP009605_2

>merge|NZ_CP009605|2|823194-823295|CRISPRCasFinder
ACATTCTCAAAAGAAACCTAAATTGTCAAGGAAGGAAAGGAGACAATCCACGGCTACTTCGGGGCATGTAAATATACCACATTCTCAAAAGAAACCTAAACT

>NZ_CP009605|2|1|823194-823295|CRISPRCasFinder
ACATTCTCAAAAGAAACCTAAATT	GTCAAGGAAGGAAAGGAGACAATCCACGGCTACTTCGGGGCATGTAAATATACC
ACATTCTCAAAAGAAACCTAAACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009605.1\|WP_000544596.1\|825618_826128_-\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP009605.1\|WP_000813610.1\|813171_813699_+\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
NZ_CP009605.1\|WP_002036901.1\|827057_828302_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP009605.1\|WP_000646398.1\|817685_818684_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP009605.1\|WP_000417231.1\|821900_822554_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_000137564.1\|830057_831845_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009605.1\|WP_000129211.1\|831961_832753_-\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225073
NZ_CP009605.1\|WP_000351706.1\|826120_826972_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP009605.1\|WP_001102724.1\|814691_815786_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP009605.1\|WP_000164883.1\|816040_817507_-\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP009605.1\|WP_000798800.1\|828401_828632_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_001226323.1\|823858_824803_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP009605.1\|WP_000571882.1\|818793_819198_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP009605.1\|WP_000933357.1\|821616_821796_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP009605.1\|WP_000592015.1\|814506_814695_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NZ_CP009605.1\|WP_000915215.1\|828888_830022_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP009605.1\|WP_000236550.1\|824847_825525_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP009605.1\|WP_000473537.1\|832968_834510_+\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_CP009605.1\|WP_000275806.1\|813833_814433_+\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NZ_CP009605.1\|WP_000445383.1\|819665_821285_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675

Protein	Function_ID	Function_description	E-value
NZ_CP009605.1\|WP_000544596.1\|825618_826128_-\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	1.96654e-76
NZ_CP009605.1\|WP_000813610.1\|813171_813699_+\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	6.28806e-55
NZ_CP009605.1\|WP_002036901.1\|827057_828302_+\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.50317e-96
NZ_CP009605.1\|WP_000646398.1\|817685_818684_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	2.34296e-150
NZ_CP009605.1\|WP_000137564.1\|830057_831845_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009605.1\|WP_000129211.1\|831961_832753_-\|arylamine-N-acetyltransferase	gnl\|CDD\|225073	COG2162, NhoA, Arylamine N-acetyltransferase [Secondary metabolites biosynthesis, transport, and catabolism].	1.31671e-47
NZ_CP009605.1\|WP_000351706.1\|826120_826972_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50852e-87
NZ_CP009605.1\|WP_001102724.1\|814691_815786_-\|hypothetical-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	4.37294e-18
NZ_CP009605.1\|WP_000164883.1\|816040_817507_-\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP009605.1\|WP_001226323.1\|823858_824803_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	1.4382e-149
NZ_CP009605.1\|WP_000571882.1\|818793_819198_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	3.50044e-15
NZ_CP009605.1\|WP_000933357.1\|821616_821796_-\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.00840603
NZ_CP009605.1\|WP_000592015.1\|814506_814695_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	6.04814e-06
NZ_CP009605.1\|WP_000915215.1\|828888_830022_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.16238e-58
NZ_CP009605.1\|WP_000236550.1\|824847_825525_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.44935e-21
NZ_CP009605.1\|WP_000473537.1\|832968_834510_+\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_CP009605.1\|WP_000275806.1\|813833_814433_+\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.20741e-71
NZ_CP009605.1\|WP_000445383.1\|819665_821285_+\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	4.68308e-107

>NZ_CP009605.1|WP_000417231.1|821900_822554_+|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSARSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFVLYIFTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>NZ_CP009605.1|WP_000933357.1|821616_821796_-|hypothetical-protein
MLNLIPSVTILDPIETPKPIQAPATVPIGPPKTVPTAAATPSLAPAKALTAVVPTPIAA
>NZ_CP009605.1|WP_000445383.1|819665_821285_+|FAD-dependent-monooxygenase
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHLSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKTLENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARILGGELSFYHELVSYEQNEQGVIATIRNRETEKESVIHCDYVIAADGAKSKIREQLGISAEGRGTIGGYYMNIYFEADVSEFMQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVEPEIVSVLPWKAAESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKAKPKLLETYHEERYPVAKLTTAYASSLLFRAANREEGSLNKMDGLAVTAGYHYSSDAIIDDAVTPHRMDIVQLNGRPGTRAPHFIGMYEEKEVSVLDLLGNDFVLLTGAENDSWAESAHTVSAKLGVNIKVYRVGLSGDFIAQENIFSELYGLSDGGAVLIRPDAFIGWRSEKEVVNLDVVLEEVMSNLLCDF
>NZ_CP009605.1|WP_000571882.1|818793_819198_-|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFYPTLTGSKTPTSEFSESKEFR
>NZ_CP009605.1|WP_000646398.1|817685_818684_-|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFGKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>NZ_CP009605.1|WP_000164883.1|816040_817507_-|YdiU-family-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYATEQEEYCVPPAPTNRPYRTFCGT
>NZ_CP009605.1|WP_001102724.1|814691_815786_-|hypothetical-protein
MNVQLQGNEQITKLFNDWYLAMLKQDVSQATNLKHEIEENELNFEEDENLALYYSLLDFRYKVLVDSLSISKDCFDKIDSYLISSNHPLAYYYHFFKGIYATLTTDFNLASEHYEQAKLLLVNNTDNLEHAEFYYRMAIFHYHFYQPIESIEYATKAKAIFDKHTGYEVKVGLCKNTLGASFVYLKQYEQAEEQYNSAIHLLQKSNEKELILSVRNNLGWLYASQNLSTLAIRHLSEVTEKKPTHFKALFLQAREHSKLDETSIAEGLIQKGVKICTELNNEEYIYHFKILNELNNNVASEELETIILKGITFFDKELLYNYTQEYSEKLAVKFYSENNHIKASEYFHKALQAKEKTFEKGALK
>NZ_CP009605.1|WP_000592015.1|814506_814695_-|Phr-family-secreted-Rap-phosphatase-inhibitor
MIKKISSVFLGLSVFGILATGIHSSFTYQAGHADLPAPQRPDLVQSVDASKDYNSTTTEKVL
>NZ_CP009605.1|WP_000275806.1|813833_814433_+|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDPNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVARRKLVVEELEKVGSEGSRGIAELMRK
>NZ_CP009605.1|WP_000813610.1|813171_813699_+|GrpB-family-protein
MKQRITIEEYNIKWESEFNKLQTLINDVMEDSILSIEHVGSTSIKGLAAKPVLDIDIVIEDYGFFPKVVTKLGAIGYYHQAEWSYKGREAFGRKDAFVPWDGESTDWMEHHLYVCDKESEELRRHIAFRDYLREYEDVAVEYGHLKEELARETKSRTSYSEGKTAFITNILEKIN
>NZ_CP009605.1|WP_001226323.1|823858_824803_+|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLKKIHSMNENIPLVQLLWYYPNENNEIVEWSSITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARKNGLLIHPYTINEKPDMRLLIKWGATGMFTNYPDRLHSVLKEK
>NZ_CP009605.1|WP_000236550.1|824847_825525_-|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDVIFVFGGSHPGNWQAPLEAYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMENGVPKGAILFEKNSLHSIANVIEAKKIFDFTKINRLLFVCKNLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPKKEVQGLEEYVSYYYNLA
>NZ_CP009605.1|WP_000544596.1|825618_826128_-|DUF3916-domain-containing-protein
MHEKKIRGMKRKTNAMIKRIEEHTKMFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIKPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISICPTPQMLRFQEVIYDEDTIDEKEIWFIGELS
>NZ_CP009605.1|WP_000351706.1|826120_826972_-|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHDVSFNPLPNSFNKVPTTFITRNDIFRSAALQKFMEVTHNA
>NZ_CP009605.1|WP_002036901.1|827057_828302_+|MFS-transporter
MEEDGGIIVLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFVGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVEEEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRVALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMNIHTITSGVLYSISALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYAYAWLCIVVLLSISAVSLYRRNKKIKES
>NZ_CP009605.1|WP_000798800.1|828401_828632_-|hypothetical-protein
MKNTDKRNRLDDMMFHYRVTKNNIVLIEYYGKQIMILKGTAAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNEHQ
>NZ_CP009605.1|WP_000915215.1|828888_830022_+|serine-hydrolase
MLKKWLIVFFIFAVFSGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANVKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKRTFVILFSNVQNGMNDAFNQEFRKMANDLIEAKGA
>NZ_CP009605.1|WP_000137564.1|830057_831845_-|oligoendopeptidase-F
MTELKDRLQVADKEKWNLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSVDENTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTSNDGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIDTTKKNIQSLHTYNKLRKEKLNVDELRQYDLSVDLVQGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NZ_CP009605.1|WP_000129211.1|831961_832753_-|arylamine-N-acetyltransferase
MTDFQKQFFARLNIEEKQKVSFEDLPNIMYAMAQTVPFENLNVLEKNFKEISKENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNATNSIWAVDSGHIATILKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEITEKGNYMLEMRKNNEFLDQSSTDDWTLGYAFYIEEVDEEKANAAQKIIVEHEGSPFNKVPLIVKLTEDGHASLTKDSLTIAKTGKKMKERVTDVQYKNLLHSKFGITL
>NZ_CP009605.1|WP_000473537.1|832968_834510_+|alpha-amylase
MFKKITIVGLSVVLFLPSIYGKSKVYADTINNGTLMQYFEWYAPSDGNHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009605_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009605_3

1691377-1691504

Orphan

Consensus_repeat	Method
CGTTTTATGATCTTCTAATTGTTTATTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009605_3

>merge|NZ_CP009605|3|1691377-1691504|CRISPRCasFinder
AGATTTATGTTCATCTATCTGTCTCGTTAAAATCGTTTTATGATCTTCTAATTGTTTATTTACCATCAACTGATTTTCAGATATCTGTTTATTTAAAGCCGTTTTATGATCTTCTAATTGTTTATTTA

>NZ_CP009605|3|2|1691377-1691504|CRISPRCasFinder
AGATTTATGTTCATCTATCTGTCTCGTTA	AAATCGTTTTATGATCTTCTAATTGTTTATTTACCATCAACTGATTTTCAGATATCTGTTTATTTAAAGC
CGTTTTATGATCTTCTAATTGTTTATTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009605.1\|WP_000682210.1\|1695189_1695489_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_001012119.1\|1693190_1693733_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP009605.1\|WP_000778967.1\|1690197_1690425_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_001247276.1\|1684065_1684419_-\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|377521
NZ_CP009605.1\|WP_000803282.1\|1694529_1694652_-\|DUF3983-domain-containing-protein	unknown	unknown	gnl\|CDD\|289882
NZ_CP009605.1\|WP_000166181.1\|1693732_1694215_-\|ArpU-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273725
NZ_CP009605.1\|WP_000447741.1\|1684420_1684714_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_001170291.1\|1692026_1692977_-\|nucleoside-hydrolase	unknown	unknown	gnl\|CDD\|238257
NZ_CP009605.1\|WP_000234871.1\|1684719_1685874_-\|phage-major-capsid-protein	unknown	unknown	gnl\|CDD\|273690
NZ_CP009605.1\|WP_033687868.1\|1686620_1687766_-\|phage-portal-protein	unknown	unknown	gnl\|CDD\|273677
NZ_CP009605.1\|WP_000401406.1\|1685877_1686621_-\|Clp-protease-ClpP	unknown	unknown	gnl\|CDD\|132927
NZ_CP009605.1\|WP_000456896.1\|1701299_1701902_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_001164498.1\|1698535_1699108_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380352
NZ_CP009605.1\|WP_000301144.1\|1689438_1689750_-\|terminase	unknown	unknown	gnl\|CDD\|377461
NZ_CP009605.1\|WP_157404513.1\|1697883_1698030_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_002036424.1\|1695573_1695840_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_033688511.1\|1699390_1699639_-\|DUF3947-family-protein	unknown	unknown	gnl\|CDD\|289880
NZ_CP009605.1\|WP_000666395.1\|1689875_1690211_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|366837
NZ_CP009605.1\|WP_000997570.1\|1683722_1684064_-\|HK97-gp10-family-phage-protein	unknown	unknown	gnl\|CDD\|377415
NZ_CP009605.1\|WP_000621028.1\|1687774_1689442_-\|terminase-large-subunit	unknown	unknown	gnl\|CDD\|226974

Protein	Function_ID	Function_description	E-value
NZ_CP009605.1\|WP_001012119.1\|1693190_1693733_-\|site-specific-integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.4499e-64
NZ_CP009605.1\|WP_001247276.1\|1684065_1684419_-\|phage-head-closure-protein	gnl\|CDD\|377521	pfam05521, Phage_H_T_join, Phage head-tail joining protein.	3.17948e-21
NZ_CP009605.1\|WP_000803282.1\|1694529_1694652_-\|DUF3983-domain-containing-protein	gnl\|CDD\|289882	pfam13137, DUF3983, Protein of unknown function (DUF3983). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are approximately 40 amino acids in length. There is a conserved AWRN sequence motif.	2.62458e-05
NZ_CP009605.1\|WP_000166181.1\|1693732_1694215_-\|ArpU-family-transcriptional-regulator	gnl\|CDD\|273725	TIGR01637, Putative_autolysin_regulatory_protein_ArpU, phage transcriptional regulator, ArpU family. This model represents a family of phage proteins, including ArpU, called a putative autolysin regulatory protein. ArpU was described as a regulator of cellular muramidase-2 of Enterococcus hirae but appears to have been cloned from a prophage. This family appears related to the RinA family of bacteriophage transcriptional activators and to some sporulation-specific sigma factors. We propose that this is a phage transcriptional activator family. [Mobile and extrachromosomal element functions, Prophage functions, Regulatory functions, DNA interactions].	8.34417e-16
NZ_CP009605.1\|WP_001170291.1\|1692026_1692977_-\|nucleoside-hydrolase	gnl\|CDD\|238257	cd00455, nuc_hydro, nuc_hydro: Nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains eukaryotic, bacterial and archeal proteins similar to the inosine-uridine preferring nucleoside hydrolase from Crithidia fasciculata, the xanthosine-inosine-uridine-adenosine-preferring nucleoside hydrolase RihC from Salmonella enterica serovar Typhimurium, the purine-specific inosine-adenosine-guanosine-preferring nucleoside hydrolase from Trypanosoma vivax and, pyrimidine-specific uridine-cytidine preferring nucleoside hydrolases such as URH1 from Saccharomyces cerevisiae, RihA and RihB from Escherichia coli. Nucleoside hydrolases are of interest as a target for antiprotozoan drugs as, no nucleoside hydrolase activity or genes encoding these enzymes have been detected in humans and, parasitic protozoans lack de novo purine synthesis relying on nucleoside hydrolase to scavenge purine and/or pyrimidines from the environment. .	3.49646e-118
NZ_CP009605.1\|WP_000234871.1\|1684719_1685874_-\|phage-major-capsid-protein	gnl\|CDD\|273690	TIGR01554, prophage_Lp3_protein_18, phage major capsid protein, HK97 family. This model family represents the major capsid protein component of the heads (capsids) of bacteriophage HK97, phi-105, P27, and related phage. This model represents one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease. [Mobile and extrachromosomal element functions, Prophage functions].	3.65585e-10
NZ_CP009605.1\|WP_033687868.1\|1686620_1687766_-\|phage-portal-protein	gnl\|CDD\|273677	TIGR01537, portal_protein, phage portal protein, HK97 family. This model represents one of several distantly related families of phage portal protein. This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage head (capsid) and the tail proteins. It functions as a dodecamer of a single polypeptide of average mol. wt. of 40-90 KDa. [Mobile and extrachromosomal element functions, Prophage functions].	4.47165e-46
NZ_CP009605.1\|WP_000401406.1\|1685877_1686621_-\|Clp-protease-ClpP	gnl\|CDD\|132927	cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease. Clp protease (caseinolytic protease; ClpP; Peptidase S14) is a highly conserved serine protease present throughout in bacteria and eukaryota, but seems to be absent in archaea, mollicutes and some fungi. This subfamily only contains bacterial sequences. Clp proteases are involved in a number of cellular processes such as degradation of misfolded proteins, regulation of short-lived proteins and housekeeping removal of dysfunctional proteins. They are also implicated in the control of cell growth, targeting DNA-binding protein from starved cells. ClpP has also been linked to the tight regulation of virulence genes in the pathogens Listeria monocytogenes and Salmonella typhimurium. This enzyme belong to the family of ATP-dependent proteases; the functional Clp protease is comprised of two components: a proteolytic component and one of several regulatory ATPase components, both of which are required for effective levels of protease activity in the presence of ATP, although the proteolytic subunit alone does possess some catalytic activity. Active site consists of the triad Ser, His and Asp; some members have lost all of these active site residues and are therefore inactive, while others may have one or two large insertions. ClpP seems to prefer hydrophobic or non-polar residues at P1 or P1' positions in its substrate. The protease exists as a tetradecamer made up of two heptameric rings stacked back-to-back such that the catalytic triad of each subunit is located at the interface between three monomers, thus making oligomerization essential for function.	6.05378e-73
NZ_CP009605.1\|WP_001164498.1\|1698535_1699108_+\|cupin-domain-containing-protein	gnl\|CDD\|380352	cd02223, cupin_Bh2720-like, Bacillus halodurans Bh2720 and related proteins, cupin domain. This family includes bacterial, archaeal, and eukaryotic proteins similar to Bh2720, a Bacillus halodurans protein of unknown function with a cupin beta-barrel fold.	1.24003e-59
NZ_CP009605.1\|WP_000301144.1\|1689438_1689750_-\|terminase	gnl\|CDD\|377461	pfam05119, Terminase_4, Phage terminase, small subunit.	1.95205e-07
NZ_CP009605.1\|WP_033688511.1\|1699390_1699639_-\|DUF3947-family-protein	gnl\|CDD\|289880	pfam13135, DUF3947, Protein of unknown function (DUF3947). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	7.05076e-05
NZ_CP009605.1\|WP_000666395.1\|1689875_1690211_-\|HNH-endonuclease	gnl\|CDD\|366837	pfam01844, HNH, HNH endonuclease. His-Asn-His (HNH) proteins are a very common family of small nucleic acid-binding proteins that are generally associated with endonuclease activity.	3.20102e-06
NZ_CP009605.1\|WP_000997570.1\|1683722_1684064_-\|HK97-gp10-family-phage-protein	gnl\|CDD\|377415	pfam04883, HK97-gp10_like, Bacteriophage HK97-gp10, putative tail-component. This family of proteins is found in the caudovirales. It may be a tail component.	5.27309e-06
NZ_CP009605.1\|WP_000621028.1\|1687774_1689442_-\|terminase-large-subunit	gnl\|CDD\|226974	COG4626, COG4626, Phage terminase-like protein, large subunit [General function prediction only].	3.28529e-114

>NZ_CP009605.1|WP_000778967.1|1690197_1690425_-|hypothetical-protein
MKLTKQEQAVAIGTFIAMLGQDLVNERIDKQKLEGAIPIFNELEDNTTPKQKREAMVSLLGKTMDEFLVTNDERI
>NZ_CP009605.1|WP_000666395.1|1689875_1690211_-|HNH-endonuclease
MKEYKTKQQKRKFYDSGEWKQLREQVKKRDNYECQECKRNGRVQTDTNEYSESAKRKKIQLVVHHIKELEHHPELALDKDNLETVCVDCHNKEHGRVFEKKINKWEHDEKW
>NZ_CP009605.1|WP_000301144.1|1689438_1689750_-|terminase
MAVSIVRLKEQLMNSIDITDLVEVEKVERYIDLVKAFRKINKTINKEGESVTIKNGSQVFVKAHPLISERNKINSSLIALGRDIKLTPKVGASNSGYDSSDLV
>NZ_CP009605.1|WP_000621028.1|1687774_1689442_-|terminase-large-subunit
MIRQKYVDEYIALYRSGKIKFNKERELLIEYLEKYVLNRDDLYFDDEMIEKCIRFGEKWYFPLQSFQKFLIAFVFLFYKKNGRVFYRKFLWMLGRGGGKNGLMTVILHFLISELHGIPEYNISVVANSEEQAKTSPDEIHKCVKRNEVLQRAFKTTLTQTISKSTGSVVKFRTSNGDTKDGLRDGAVMFDEVHQYESNKDVRVHISGLGKKKNPREFYIGTDGYVRDGFLDKLKEKAMKVLNGEARPNALFPFICKLNDEKEVDDIDNWEMANPMLSQPLSEYAEGLLETIKEEYEDLEDDPSNREEFMTKRMNLPVTNLERSVAKWSEILATNRPFPDLYAQECIGALDFASIRDFAACGLLFRQNGEYIFKTHSFVRKEFVDIYYGYSKKAGEFKKQKFAPIKEWEEQGLLTVVDEPTINPQHIVDWFVEMREQYGIKKIIADNFRMEAIRPLLVAEGFEIEVIRNPKAIHSLLAPRIEMAFANKQIVFDDNPLMRWYTQNVLVVIKGDGNKIYEKKEPVRRKTDGFQCFVHALYRADEIQEATDFVIGNIKF
>NZ_CP009605.1|WP_033687868.1|1686620_1687766_-|phage-portal-protein
MMTIGWLGSVFKRNKELEFMLDLDVITDTANRLHMKRLAIDTCVSFLGRTISQSEFRVRNGKAFKKDELYYRLNVRPNKNMTASTFWERFVRKLIYDNECLVIQADDGDLLIADGFQHNEYAVFEDTFTDVRVKDYTFKRSFKQSEVIHLKYRNDKLSPLIDGLFADYGDLFGRILNSQKRKNQVRGTVDMDMIGAKTEEQIAKLQEFIDNMYKSIGSKDIAIVPQQKGINYNEIYNGVANGPSVEEINKVTNGFLNQVAMAIGIPIALIYGEMADVEKQTKNYMLFTVRPLLKKLSDEANVKFFEMSEYLLGRKIEVKAVSYQSIFDLATSIDKLISSSAFTGNEIRTEVDYEESDDPNLNIHHITKNYTKLNESEGGEK
>NZ_CP009605.1|WP_000401406.1|1685877_1686621_-|Clp-protease-ClpP
MEHVNMNKLLNLKRDIRFESKGENEYKLTVYGSIGGWFSENNAEVVRRKIQDVKAEKIHVHINSGGGSAFDGVAICNQLKQHSAEIIVHIDGWAASAASVIAMAGDKIIMPSNTMMMIHQASTFEYGNADLFEKTARDLRKIDSALAASYKKRFVGTDEELKQLLKDETWLTAEEAVALGLADEIADEIEIDDTQEDEEVEVVENFKEDLVAKYMKQPNNQNPKEPIQEPVNTKQNLSTLFLTLGGK
>NZ_CP009605.1|WP_000234871.1|1684719_1685874_-|phage-major-capsid-protein
MVIKFNNFEEKKLAFAKATQEGTAEEQSAALNSMIEALATDVRSDILNQVNESMVDRSIMQSRGANVLTSEEMKFFNAVVEDGGFKSTETLPKTTQERIFDDLVQGHPLLEHIGLENLGAVTEFIYGDPEGAAVWGPLFGDIKGQLNATFRKESITQLKLTAFIPLANDMLKLGPVWVERYVRTMIMEAMSVGLERGFVAGTGKNEPIGLLKDPSGSVTNGVYPDKKVAGTLTFEPGRKTINELKGVVKLLAKKLNPDGKTDADRPKNIAGKVVMVTNPFDTFDIQANATIQNAAGVYVTSLPFNPIPTESVFVPQGQVVFFVKGEYIAAMGGTEPIKKYEETLALEDATVYIAKQYATGKPKDKYTSQVYTLKLEEVTPPTQG
>NZ_CP009605.1|WP_000447741.1|1684420_1684714_-|hypothetical-protein
METIISNEILQQFKDRMHLGDDEDDNLRRILFASNKALIKDCGAYDINKDETFKELVFERSRYVYNDALEYFTKNFLTEINSFGITKALEEIKLDGD
>NZ_CP009605.1|WP_001247276.1|1684065_1684419_-|phage-head-closure-protein
MRPFQYKKPLNTGDCRNRIIIEQPEVIKDDLNQEVETGNWQEVKKAWAMIKTVKGSEYIEASASQSTRIYRFVIPYTTGITELMRIKMKNRIFDIIEPPMNDDEMYQTLTIIAKEHV
>NZ_CP009605.1|WP_000997570.1|1683722_1684064_-|HK97-gp10-family-phage-protein
MNDFASELARELQRYANVVEEELLTAQEEVADVAVSKLRQSGPKKTGAYRKGWRKKKEGNSVVVHNTKGQLTHLLENGHAKAGGGRVPAQVHIRPVEEYVINELPRRVERALE
>NZ_CP009605.1|WP_001170291.1|1692026_1692977_-|nucleoside-hydrolase
MQKKVLLFTDLGIDDAFAILYTFFRKDIQLVGIVADYGNVSRENVIRNINYLKYIAGREEIPVFLGASVPLTGILIQYFPEVHGKVGLGPIIPPEISYPVYPLNDIYQIIESNLEDLTIINLGRLSSLATTFVLNLETMRNVRECICMGGAFFYPGNVTAVAEANFYADPYAANLILQHAKNLTIIPLNVTQHAIVTPEMVQQIDAFHGNTQDLAGLIIKPMLDYYYNFYSKSNPGISGSPMHDFVTVWYLLNREAVSLSRVPIKVIPDQGEGFGQSIADFRFVTNPGYKTHNVAFQFDYERFRKDIMETFLKKRV
>NZ_CP009605.1|WP_001012119.1|1693190_1693733_-|site-specific-integrase
MNFVQPIRDPEKIQQIKEYLKEKSERNYILFVMGINTGLRISDILKLKVGDLKGSHISIREMKTGKQKRIQITAALRRELKWYIEDMEDYEYLIKSRQGKNRPIGRSMAYKILSTTAAKFDLEEIGTHTLRKTFGYHMYMQTKNIALLMEIFNHSSERVTLRYIGVNQDAMDKAMTRFKI
>NZ_CP009605.1|WP_000166181.1|1693732_1694215_-|ArpU-family-transcriptional-regulator
MTKQLSFLPKIDRTATQEELEGVLESVRIHRQFGMMRKEMKVTPSYEIREHGPTHTVGKPLEDVAIANIQQSKREEWLERMSVRIDQFLNRLGNGRAGSIQRDIIYKRYLEEEDVCDYMVYNEIGMSERTYRRWKSKAFYKLAFALGLEVYETEETGGNE
>NZ_CP009605.1|WP_000803282.1|1694529_1694652_-|DUF3983-domain-containing-protein
MKPLKKRKIRKAIARRTKEVEKYQVNKAWRNIFVQAGILK
>NZ_CP009605.1|WP_000682210.1|1695189_1695489_+|hypothetical-protein
MKHNINLWSFIFSFVCIAFFLLYLEVCTPEMNASFINIVYFHPLFFVLIFSIGTFFAGIIGFSKVDNWIAMLRSIVTVLLTLLLSVFLTLTLIVGYALS
>NZ_CP009605.1|WP_002036424.1|1695573_1695840_-|hypothetical-protein
MDMRKVKEFTGKVGAEFMSFLLEDDTLHSAYYSHVEVVMDNGKKKMLCIKDDTGLKGIAEGQTRAEAIKKAKKFLKRQEEKQRAASKS
>NZ_CP009605.1|WP_157404513.1|1697883_1698030_+|hypothetical-protein
MNKTLKYILIFFCAVFYIAMISGIIYLNFVQEHFIPPSKKSKIEHKHL
>NZ_CP009605.1|WP_001164498.1|1698535_1699108_+|cupin-domain-containing-protein
MQHNPRYYYQSQSSMDSIWNNNNWIYAWNPYYYSYNNNALDHNRYPYCENFRLTDYGTRPFVLNINQATKQNNTYRTAIWTGKNLQVTLMSINVGDDIGLEVHPTTDQFIRIEEGQGLVLMGDNKDKLDFQEIAYDDYAIMIPAGKWHNVINTGNKPLKIYAIYAPPEHPYGTVHETKAIAMSTEPNRYY
>NZ_CP009605.1|WP_033688511.1|1699390_1699639_-|DUF3947-family-protein
MLYSNISNQIRVHSHGAVGTHAITHSAAHSTVQAVHQALQMQQQMYESMQPYYISSGYYTPTVISGEEIYFSIIPYGTVYDL
>NZ_CP009605.1|WP_000456896.1|1701299_1701902_-|hypothetical-protein
MEYVEKATKDIRENWFGDHVAEIQGEEGLQVIYWGKPGTNMYRTKFVLAGYNVFISGDIGEAVYNLTCPATLENIKGFNLGYFTEKLTAFCEERWNFDEEKAKIELDEYWKEYDINETREDGREVYDRIISAIDESSSMEGYYFWLSDVYHSSSLDSDTLEDLWNFGKRLPRRLIGYWLGLQMAIGQLEKNKPAAEAVTL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009605_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009605_4

2978656-2978911

Orphan

Consensus_repeat	Method
TTCTCATGCGGAAGGTAAACATACA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009605_4

>merge|NZ_CP009605|4|2978656-2978911|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCACATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTTCTCTCATGCCGAAGGATCAAAAACGAAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTATTCTCATGCGGAAGGTAAACATACAATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTCTTCTCATGCGGAAGGTAATCATACA

>NZ_CP009605|4|3|2978656-2978911|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCA	CATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTT
CTCTCATGCCGAAGGATCAAAAACG	AAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTA
TTCTCATGCGGAAGGTAAACATACA	ATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTC
TTCTCATGCGGAAGGTAATCATACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009605.1\|WP_000872722.1\|2977289_2978030_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP009605.1\|WP_001004743.1\|2974211_2974970_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009605.1\|WP_001087866.1\|2970148_2970838_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP009605.1\|WP_001079105.1\|2979607_2980501_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP009605.1\|WP_000003393.1\|2985092_2986919_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009605.1\|WP_000191105.1\|2982519_2983098_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP009605.1\|WP_000673188.1\|2980516_2981314_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP009605.1\|WP_001081482.1\|2981332_2981971_-\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP009605.1\|WP_000360638.1\|2983676_2984570_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP009605.1\|WP_001271203.1\|2969465_2970152_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009605.1\|WP_000427733.1\|2974976_2975912_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP009605.1\|WP_001180009.1\|2982001_2982373_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009605.1\|WP_000043381.1\|2983278_2983677_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP009605.1\|WP_000428855.1\|2973229_2974075_+\|O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP009605.1\|WP_000932921.1\|2970989_2972090_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP009605.1\|WP_042631241.1\|2972255_2973107_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP009605.1\|WP_000799201.1\|2988295_2989840_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP009605.1\|WP_000612273.1\|2986969_2988214_-\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP009605.1\|WP_000651510.1\|2968772_2969453_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009605.1\|WP_000654054.1\|2976054_2977215_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033

Protein	Function_ID	Function_description	E-value
NZ_CP009605.1\|WP_000872722.1\|2977289_2978030_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP009605.1\|WP_001004743.1\|2974211_2974970_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.00939e-20
NZ_CP009605.1\|WP_001087866.1\|2970148_2970838_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.33577e-17
NZ_CP009605.1\|WP_001079105.1\|2979607_2980501_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	7.41091e-101
NZ_CP009605.1\|WP_000003393.1\|2985092_2986919_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009605.1\|WP_000191105.1\|2982519_2983098_+\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NZ_CP009605.1\|WP_000673188.1\|2980516_2981314_-\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP009605.1\|WP_001081482.1\|2981332_2981971_-\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP009605.1\|WP_000360638.1\|2983676_2984570_+\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	5.36453e-93
NZ_CP009605.1\|WP_001271203.1\|2969465_2970152_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.87129e-112
NZ_CP009605.1\|WP_000427733.1\|2974976_2975912_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	2.03742e-22
NZ_CP009605.1\|WP_000043381.1\|2983278_2983677_+\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NZ_CP009605.1\|WP_000428855.1\|2973229_2974075_+\|O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.13671e-149
NZ_CP009605.1\|WP_000932921.1\|2970989_2972090_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.01776e-55
NZ_CP009605.1\|WP_042631241.1\|2972255_2973107_+\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	2.03292e-18
NZ_CP009605.1\|WP_000799201.1\|2988295_2989840_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP009605.1\|WP_000612273.1\|2986969_2988214_-\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.92237e-59
NZ_CP009605.1\|WP_000651510.1\|2968772_2969453_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	6.29242e-108
NZ_CP009605.1\|WP_000654054.1\|2976054_2977215_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	3.44134e-99

>NZ_CP009605.1|WP_000872722.1|2977289_2978030_+|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP009605.1|WP_000654054.1|2976054_2977215_+|rod-shape-determining-protein-RodA
MKDLNSQYQIDYVLLCILFAIGTVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGVIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFVTAVTLTYIFFTHTKFFKTHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIAIFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP009605.1|WP_000427733.1|2974976_2975912_+|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQDIDYYKTSLLKACEWYENATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP009605.1|WP_001004743.1|2974211_2974970_+|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP009605.1|WP_000428855.1|2973229_2974075_+|O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP009605.1|WP_042631241.1|2972255_2973107_+|hypothetical-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGDTGATGLTGPTGATGLTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP009605.1|WP_000932921.1|2970989_2972090_-|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQDAVAAGEELSPRDLFYYANECMDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGLWEKAVESCVKSFRYAIPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSIFDQQKKSL
>NZ_CP009605.1|WP_001087866.1|2970148_2970838_-|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMEMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSSL
>NZ_CP009605.1|WP_001271203.1|2969465_2970152_-|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLAVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMASQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP009605.1|WP_000651510.1|2968772_2969453_-|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTFLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS
>NZ_CP009605.1|WP_001079105.1|2979607_2980501_-|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFAAMIPSDMQEVLRQT
>NZ_CP009605.1|WP_000673188.1|2980516_2981314_-|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYDRLAETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPAAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP009605.1|WP_001081482.1|2981332_2981971_-|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP009605.1|WP_001180009.1|2982001_2982373_-|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP009605.1|WP_000191105.1|2982519_2983098_+|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP009605.1|WP_000043381.1|2983278_2983677_+|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP009605.1|WP_000360638.1|2983676_2984570_+|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP009605.1|WP_000003393.1|2985092_2986919_-|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP009605.1|WP_000612273.1|2986969_2988214_-|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP009605.1|WP_000799201.1|2988295_2989840_-|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLFDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009605_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009605_5

4383731-4383828

Orphan

Consensus_repeat	Method
AGAAGAAGTAACGGAAGAGGAAAAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009605_5

>merge|NZ_CP009605|5|4383731-4383828|CRISPRCasFinder
AAGAGAAGGAATAGAAGAAGTAACGGAAGAGGAAAAGGTCAAAGCAAAAGCAGCGGCGTTAGCGAAGCAGAAAAGAGAAGGAACAGAAGAAGTAACGG

>NZ_CP009605|5|4|4383731-4383828|CRISPRCasFinder
AAGAGAAGGAATAGAAGAAGTAACGG	AAGAGGAAAAGGTCAAAGCAAAAGCAGCGGCGTTAGCGAAGCAGAA
AAGAGAAGGAACAGAAGAAGTAACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009605.1\|WP_000367499.1\|4391297_4392818_+\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP009605.1\|WP_000578703.1\|4378772_4379426_+\|DUF975-family-protein	unknown	unknown	gnl\|CDD\|283754
NZ_CP009605.1\|WP_001012801.1\|4387073_4387598_+\|NADH-quinone-oxidoreductase-subunit-J	unknown	unknown	gnl\|CDD\|235844
NZ_CP009605.1\|WP_000064677.1\|4372648_4373191_+\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NZ_CP009605.1\|WP_000568466.1\|4387934_4389797_+\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP009605.1\|WP_000573430.1\|4385630_4386632_+\|NADH-quinone-oxidoreductase-subunit-NuoH	unknown	unknown	gnl\|CDD\|235692
NZ_CP009605.1\|WP_003169771.1\|4393313_4394024_+\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP009605.1\|WP_000157696.1\|4375000_4375861_+\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535
NZ_CP009605.1\|WP_000100078.1\|4387590_4387905_+\|NADH-quinone-oxidoreductase-subunit-NuoK	unknown	unknown	gnl\|CDD\|180218
NZ_CP009605.1\|WP_000621436.1\|4384530_4385631_+\|NADH-quinone-oxidoreductase-subunit-NuoD	unknown	unknown	gnl\|CDD\|183437
NZ_CP009605.1\|WP_001032600.1\|4375980_4377390_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_CP009605.1\|WP_000743637.1\|4379498_4382228_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP009605.1\|WP_000940742.1\|4393031_4393268_+\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP009605.1\|WP_000998905.1\|4389793_4391296_+\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP009605.1\|WP_000236331.1\|4382877_4383396_+\|NADH-quinone-oxidoreductase-subunit-NuoB	unknown	unknown	gnl\|CDD\|235797
NZ_CP009605.1\|WP_000847214.1\|4377410_4377812_+\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|234796
NZ_CP009605.1\|WP_000179275.1\|4382518_4382887_+\|NADH-quinone-oxidoreductase-subunit-NuoA	unknown	unknown	gnl\|CDD\|169084
NZ_CP009605.1\|WP_000578791.1\|4377933_4378725_+\|DUF975-family-protein	unknown	unknown	gnl\|CDD\|283754
NZ_CP009605.1\|WP_000027518.1\|4373202_4374711_+\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NZ_CP009605.1\|WP_000677187.1\|4386657_4387077_+\|NADH-quinone-oxidoreductase-subunit-NuoI	unknown	unknown	gnl\|CDD\|235637

Protein	Function_ID	Function_description	E-value
NZ_CP009605.1\|WP_000367499.1\|4391297_4392818_+\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	2.58817e-149
NZ_CP009605.1\|WP_000578703.1\|4378772_4379426_+\|DUF975-family-protein	gnl\|CDD\|283754	pfam06161, DUF975, Protein of unknown function (DUF975). Family of uncharacterized bacterial proteins.	2.83585e-25
NZ_CP009605.1\|WP_001012801.1\|4387073_4387598_+\|NADH-quinone-oxidoreductase-subunit-J	gnl\|CDD\|235844	PRK06638, PRK06638, NADH-quinone oxidoreductase subunit J.	2.80828e-52
NZ_CP009605.1\|WP_000064677.1\|4372648_4373191_+\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	1.87168e-60
NZ_CP009605.1\|WP_000568466.1\|4387934_4389797_+\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP009605.1\|WP_000573430.1\|4385630_4386632_+\|NADH-quinone-oxidoreductase-subunit-NuoH	gnl\|CDD\|235692	PRK06076, PRK06076, NADH-quinone oxidoreductase subunit NuoH.	5.27016e-149
NZ_CP009605.1\|WP_003169771.1\|4393313_4394024_+\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	2.74368e-34
NZ_CP009605.1\|WP_000157696.1\|4375000_4375861_+\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	3.15452e-155
NZ_CP009605.1\|WP_000100078.1\|4387590_4387905_+\|NADH-quinone-oxidoreductase-subunit-NuoK	gnl\|CDD\|180218	PRK05715, PRK05715, NADH-quinone oxidoreductase subunit NuoK.	2.37043e-40
NZ_CP009605.1\|WP_000621436.1\|4384530_4385631_+\|NADH-quinone-oxidoreductase-subunit-NuoD	gnl\|CDD\|183437	PRK12322, PRK12322, NADH-quinone oxidoreductase subunit D.	0
NZ_CP009605.1\|WP_001032600.1\|4375980_4377390_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_CP009605.1\|WP_000743637.1\|4379498_4382228_-\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	2.10661e-109
NZ_CP009605.1\|WP_000940742.1\|4393031_4393268_+\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	6.5641e-24
NZ_CP009605.1\|WP_000998905.1\|4389793_4391296_+\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	3.12888e-179
NZ_CP009605.1\|WP_000236331.1\|4382877_4383396_+\|NADH-quinone-oxidoreductase-subunit-NuoB	gnl\|CDD\|235797	PRK06411, PRK06411, NADH-quinone oxidoreductase subunit NuoB.	2.04128e-108
NZ_CP009605.1\|WP_000847214.1\|4377410_4377812_+\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|234796	PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated.	3.13571e-56
NZ_CP009605.1\|WP_000179275.1\|4382518_4382887_+\|NADH-quinone-oxidoreductase-subunit-NuoA	gnl\|CDD\|169084	PRK07756, PRK07756, NADH-quinone oxidoreductase subunit A.	2.47153e-71
NZ_CP009605.1\|WP_000578791.1\|4377933_4378725_+\|DUF975-family-protein	gnl\|CDD\|283754	pfam06161, DUF975, Protein of unknown function (DUF975). Family of uncharacterized bacterial proteins.	2.65038e-23
NZ_CP009605.1\|WP_000027518.1\|4373202_4374711_+\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NZ_CP009605.1\|WP_000677187.1\|4386657_4387077_+\|NADH-quinone-oxidoreductase-subunit-NuoI	gnl\|CDD\|235637	PRK05888, PRK05888, NADH-quinone oxidoreductase subunit NuoI.	1.93886e-55

>NZ_CP009605.1|WP_000236331.1|4382877_4383396_+|NADH-quinone-oxidoreductase-subunit-NuoB
MVINFEELHPNERAELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIRYEAKTGKQVTNK
>NZ_CP009605.1|WP_000179275.1|4382518_4382887_+|NADH-quinone-oxidoreductase-subunit-NuoA
MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDNLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL
>NZ_CP009605.1|WP_000743637.1|4379498_4382228_-|EAL-domain-containing-protein
MKKQAHVSILISITLLSIVIHYVAMPFLYEYSFPFQILIGMSTLFIDIIACSYILYFSNMKEGLPRLFWTILCVGTLSYFIGDIVVAYQRLILKDYYTFVDPSDFFYLLFLISFAFAFLYEIIYNRDLLEKLFMICDICIIVTAQFTLSYYLLIERTIHVFTTSYIDIFVQLTYPMADLLFLLIGINLLFRPLSLLPKKVGALLGSALLLYATTDAIYAFIKYFTPEYSMFTVTPLYQVTLVLVAIACIIHTKEPEKQEQILLTPKLGESIRLSLPYISVVMLIVFILVEYVFAPIVVIGLIITFSFVLIRHSLVRKQNKLLLLAQMQFNSELEKQIELRTEDLVEQKNELYHNQQMFKSLYEHHPDPIFTLDLYGNFLKVNNAGTTLLGYQTNELLNQPYYSLIYEEDLEEIINTFHRVKKGHSISLEIRAYHKNRDIYYLHVTAVPIFLKDHISGVYLMIKDITESKQQQEQINFLAYRDTLTELANRRAFHQYVEQAIARSKISKRPFAVMFLDLDRFKIINDTLGHRVGDLLLIAVAKRLERMATPNMKLARLAGDEFTILIENYNKRPDVKKMADTIVEAMNEPFEIENQHLQISPSIGIAIYPEAGEDPLSILQHADMAMYEAKNRGKNGSSLYTKELYKKMERKARIEKDLPLALVNKEFYLVYQPQIDITTKKIIGAEALLRWKHPLLGDIPPCEFIPIVEETPQVIPLGHWVLQESCRQLTIWHSFGYKDLNISVNLSAKEFQQDHLIENISQILTDVKVDPKYVTLELTERIAMIDEKETLSRLKQLKEYGIQTSIDDFGTGYSSLAYLSIFPIDTLKVPREFTQLADHRPEERAIVSTILSLANTLNLSVVAEGIETEKQLKFLQRNNCKYMQGYYFSKPLTSQQFIKFLQKTPSMNQ
>NZ_CP009605.1|WP_000578703.1|4378772_4379426_+|DUF975-family-protein
MIGDLKGEALDSLEGKWGLAVGATLLISILISAFSFSVDFIFSQFWDWKEVKNSLSVDVITILVIGPLTLGGYYLALHIIREKDARIGNIFRWFTGGSKFIKSFLLYIVVNIYIFLWCLLFIIPGIIKSFSYAMTYFIINDHPEYSINQAITESRRMMDGHKMEYFILCLSFIGWFILSCITLGIGFLWLIPYFYTTSAAFYEEIAEEYYEKEIPAL
>NZ_CP009605.1|WP_000578791.1|4377933_4378725_+|DUF975-family-protein
MIGEMKREALHSLKGKWGLGVGSTILYHIVSYVVSMAVMLILLIPGVIIVLLASISAGSIEEDVMAIGAAITFGIFYCLMIILSYAAYGITTYGHTNLFLQISKREDARVDYLFEGFRGFKRMMKTMWAMLAILLYTGTWVPMLGMIVFGLLGFLDENANPSFIIVFFILLAISFIVMAILYFSYSMTYYVMVEKPEYSVSQAMKESKNLMKGHKLDLFLLWLSFIGWALLAILTLGIGFLWLSPYVSTTTAHFYRYISKDEL
>NZ_CP009605.1|WP_000847214.1|4377410_4377812_+|F0F1-ATP-synthase-subunit-epsilon
MKTFPVSIVTPDGPVYEKEVEMVSVKAESGEMGILPGHIPTVAPLKISAVRLKNGGHTDYVAVSGGFIEVRPDKVTVLSSSAEEANHIDIHRANEAKRRAEQRMQDKQAHVDFKRAEMALQRAVNRLNVSDMK
>NZ_CP009605.1|WP_001032600.1|4375980_4377390_+|F0F1-ATP-synthase-subunit-beta
MNKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGTSINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILEGKYDDLPEDAFRLVGGIEEVIENAKKMMA
>NZ_CP009605.1|WP_000157696.1|4375000_4375861_+|F0F1-ATP-synthase-subunit-gamma
MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKGINHPMLNARPVKRTGYIVITSDRGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNIIDEVVGLSDHPSFTDIKDLASRAIAMFADGAYDELYIYYNHYVSKISQEVTENKILPLTDVASDKPTTAYEFEPSEEEILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAITQEITEIVGGAAALE
>NZ_CP009605.1|WP_000027518.1|4373202_4374711_+|F0F1-ATP-synthase-subunit-alpha
MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADDDKFAAAINGFKKVFVASE
>NZ_CP009605.1|WP_000064677.1|4372648_4373191_+|F0F1-ATP-synthase-subunit-delta
MSNGIVAKRYAVALFKIAKEKHVLEMFEEELRLVQNVYEKNGELHSFLTQPNISKEQKKTFLANVFGSVSESILNTLYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKFNIAEAFAKRTGKDAIRVKNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR
>NZ_CP009605.1|WP_000621436.1|4384530_4385631_+|NADH-quinone-oxidoreductase-subunit-NuoD
MIRTEEMLLNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYVICHAVETMMGLEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGAVSPFLYAFREREMIINLLNELCGARLTFNYMRVGGVKWDAPDGWIEKVEEFVPYMREQLAGYHDLVSGNEIFLNRVKGVGIYSAEEAISYSLSGANLRCTGVNWDLRKDEPYSIYDRFDFDIPVGSVGDAWDRYVCRMQEIEESLKIVEQAVQQFPKEGAVLAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDGKKEPYRLKFRRPSFYNLQILPKLLKGENIANLITILGGVDIVLGEVDG
>NZ_CP009605.1|WP_000573430.1|4385630_4386632_+|NADH-quinone-oxidoreductase-subunit-NuoH
MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF
>NZ_CP009605.1|WP_000677187.1|4386657_4387077_+|NADH-quinone-oxidoreductase-subunit-NuoI
MKGLFKGLKYTLGNLSKKKVTYDYPNQPLPLPDRFRGIQKFYPEKCIVCNQCSNICPTDCIQLTGKKHPDPTKKGKIIDTYDINFEICILCDLCTEVCPTEAIVMTNNFELAEYSRDDLFKNLQWLDENDENVRKENKA
>NZ_CP009605.1|WP_001012801.1|4387073_4387598_+|NADH-quinone-oxidoreductase-subunit-J
MNGEFIAFFILSLSAIIGGVLMLNLTKVMHMMLALVLTFLSIAGLYFLLSAEFIGVAQILLYSGAITIIMIFGIMLTKHNAENESRLTLRKWIIFFAVVAFGAVMYFAVNNIDFANESAQGSLPLHEKNTLQIGTLLYSKYIIPFELTSVILLVALVGAIILAKKDEKEEDSNE
>NZ_CP009605.1|WP_000100078.1|4387590_4387905_+|NADH-quinone-oxidoreductase-subunit-NuoK
MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNLVAFSKLGLFPNLTGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVHVDEMDTLKG
>NZ_CP009605.1|WP_000568466.1|4387934_4389797_+|NADH-quinone-oxidoreductase-subunit-L
MIDYVWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFICAVLVLIERLSTVPVKHNWVWLRTGDIDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGEERLPTFYAYLGLFTFAMLGLVISPNLLQLYIFWELVGLGSFLLIGFYFFKEEARAAAKKAFIMTRIGDVGLFIGMILIFWHAGSFEYDAIFRAIHTGDLTPTMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASAVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGVFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTAALFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFILAVIAAFLTAFYMFRLYFLVFTGEAKTKEDVHESPRIMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVAFKVQEAHGPVWIMIVATLVSLAGIALAYFIYGKKSIARDWAGGEEAPLYKILKEKYYVDELYNTTVIPITKGIAHVLRLFEVYVVEGIAVLIGSLVKGISAIGSRLQNGNVQVYGTVTAVSLAVLFIILLYTGGDLR
>NZ_CP009605.1|WP_000998905.1|4389793_4391296_+|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLALTPKKESRTVRALGLFGTVLPFGMAIVLACTYASGRDLSLFDEKVKWIKFGDFAAVDKRWFSIYYELGIDGLSLVMMVLTALLAMLAAIAAFTIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSVLFAKTGTTNITELKEILASVGAGGGMVVPSSLQFGLFLAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGQGLFPEYFREFATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLAALNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAAGVLGIILTAVYVLRATLQVTFGKKEWEAKADIHGWEYVPILLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP009605.1|WP_000367499.1|4391297_4392818_+|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAVVLAIVSLITLYGEPAGDILNGSFVLDGFSKGFKTLLLGGAALILCTAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFVTLFVGLELLSLSSYILVGIRKKNRASNEAAMKYVINGGIGTAITLFGMSYLYGITGSTNIVDMQKVFAGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGAATPVTAFLGTISKMAGFLLIIRLFLMVFASVSVQGDMQSLYGRMSIYIAVLASITMIIGNVVALKQYNVKRLFAYSGIAHAGYLLVPLVALSSFTMDSMWFYMLAYMLMNIGAFAIIHGLILQSDKENITIFTGLYKRSPFTAIVMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVISFVYYFRILQQMFFRTGEVEEKIRLPLNIKIVMSFCAISIVILGIVPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP009605.1|WP_000940742.1|4393031_4393268_+|DUF1146-domain-containing-protein
MAHLLGQQALIAIVSHLLFITITWWALQGIHIERLMKPGKVMQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP009605.1|WP_003169771.1|4393313_4394024_+|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIASLEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKEKANIQKWELEQSPDGYKATSYKKFSSYEERVVVTWSKENTKENTFIIFEVSGAKWDPKYIQKTNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQIEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009605_1	1.1\|609989\|27\|NZ_CP009605\|CRT	609989-610015	27	NZ_CP009605.1	609944-609970	0	1.0
NZ_CP009605_1	1.1\|609989\|27\|NZ_CP009605\|CRT	609989-610015	27	NZ_CP009605.1	609728-609754	1	0.963
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	611132-611158	0	1.0
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	611312-611338	0	1.0
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742418-2742444	0	1.0
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742832-2742858	0	1.0
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	611087-611113	1	0.963
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	611177-611203	1	0.963
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	611267-611293	1	0.963
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742373-2742399	1	0.963
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	611672-611698	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742175-2742201	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742229-2742255	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742328-2742354	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742463-2742489	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742544-2742570	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742661-2742687	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742796-2742822	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742877-2742903	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2742922-2742948	2	0.926
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP009605.1	2743003-2743029	2	0.926
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	611132-611158	1	0.963
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	611312-611338	1	0.963
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	611672-611698	1	0.963
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	2742418-2742444	1	0.963
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	2742832-2742858	1	0.963
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	611177-611203	2	0.926
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	611762-611788	2	0.926
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	611978-612004	2	0.926
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	612068-612094	2	0.926
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP009605.1	2742373-2742399	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611132-611158	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611312-611338	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611672-611698	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742328-2742354	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742418-2742444	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742463-2742489	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742832-2742858	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742877-2742903	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742922-2742948	1	0.963
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611087-611113	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611177-611203	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611267-611293	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611762-611788	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	611978-612004	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	612068-612094	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742274-2742300	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742373-2742399	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742508-2742534	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742625-2742651	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742706-2742732	2	0.926
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP009605.1	2742751-2742777	2	0.926
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	NZ_CP009605.1	609773-609799	2	0.926
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	NZ_CP009605.1	609773-609799	2	0.926
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	NZ_CP009605.1	609773-609799	2	0.926
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	NZ_CP009605.1	609773-609799	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611132-611158	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611312-611338	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611672-611698	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742328-2742354	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742418-2742444	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742463-2742489	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742832-2742858	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742877-2742903	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742922-2742948	1	0.963
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611087-611113	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611177-611203	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611267-611293	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611762-611788	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	611978-612004	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	612068-612094	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742274-2742300	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742373-2742399	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742508-2742534	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742625-2742651	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742706-2742732	2	0.926
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP009605.1	2742751-2742777	2	0.926
NZ_CP009605_1	1.14\|610574\|36\|NZ_CP009605\|CRT	610574-610609	36	NZ_CP009605.1	611888-611923	2	0.944
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611177-611203	0	1.0
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611132-611158	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611312-611338	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742175-2742201	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742229-2742255	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742328-2742354	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742418-2742444	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742463-2742489	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742832-2742858	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742877-2742903	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2743003-2743029	1	0.963
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	609728-609754	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611087-611113	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611267-611293	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611762-611788	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	611978-612004	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	612068-612094	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742274-2742300	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742373-2742399	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742508-2742534	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742625-2742651	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742706-2742732	2	0.926
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NZ_CP009605.1	2742751-2742777	2	0.926
NZ_CP009605_1	1.21\|610898\|18\|NZ_CP009605\|CRT	610898-610915	18	NZ_CP009605.1	611771-611788	0	1.0
NZ_CP009605_1	1.21\|610898\|18\|NZ_CP009605\|CRT	610898-610915	18	NZ_CP009605.1	611987-612004	0	1.0
NZ_CP009605_1	1.21\|610898\|18\|NZ_CP009605\|CRT	610898-610915	18	NZ_CP009605.1	612077-612094	0	1.0
NZ_CP009605_1	1.21\|610898\|18\|NZ_CP009605\|CRT	610898-610915	18	NZ_CP009605.1	2742328-2742345	1	0.944
NZ_CP009605_1	1.21\|610898\|18\|NZ_CP009605\|CRT	610898-610915	18	NZ_CP009605.1	2742463-2742480	1	0.944
NZ_CP009605_1	1.21\|610898\|18\|NZ_CP009605\|CRT	610898-610915	18	NZ_CP009605.1	2742877-2742894	1	0.944
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611357-611383	0	1.0
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611447-611473	0	1.0
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611492-611518	0	1.0
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611222-611248	1	0.963
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611402-611428	1	0.963
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611537-611563	1	0.963
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611933-611959	1	0.963
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612527-612553	1	0.963
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	611717-611743	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612023-612049	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612104-612130	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612149-612175	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612194-612220	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612275-612301	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612392-612418	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612437-612463	2	0.926
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	NZ_CP009605.1	612482-612508	2	0.926
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611366-611383	0	1.0
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611456-611473	0	1.0
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611501-611518	0	1.0
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611591-611608	0	1.0
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611231-611248	1	0.944
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611411-611428	1	0.944
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611546-611563	1	0.944
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611636-611653	1	0.944
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	611942-611959	1	0.944
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	612113-612130	1	0.944
NZ_CP009605_1	1.23\|610979\|18\|NZ_CP009605\|CRT	610979-610996	18	NZ_CP009605.1	612536-612553	1	0.944
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611357-611383	0	1.0
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611447-611473	0	1.0
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611492-611518	0	1.0
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611222-611248	1	0.963
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611402-611428	1	0.963
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611537-611563	1	0.963
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611933-611959	1	0.963
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612527-612553	1	0.963
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	611717-611743	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612023-612049	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612104-612130	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612149-612175	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612194-612220	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612275-612301	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612392-612418	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612437-612463	2	0.926
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	NZ_CP009605.1	612482-612508	2	0.926

1. spacer 1.1|609989|27|NZ_CP009605|CRT matches to position: 609944-609970, mismatch: 0, identity: 1.0

agtagcacccgttggcccttgaacgcc	CRISPR spacer
agtagcacccgttggcccttgaacgcc	Protospacer
***************************

2. spacer 1.1|609989|27|NZ_CP009605|CRT matches to position: 609728-609754, mismatch: 1, identity: 0.963

agtagcacccgttggcccttgaacgcc	CRISPR spacer
agtagcacccgttggcccttgaacacc	Protospacer
************************.**

3. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 611132-611158, mismatch: 0, identity: 1.0

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
***************************

4. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 611312-611338, mismatch: 0, identity: 1.0

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
***************************

5. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742418-2742444, mismatch: 0, identity: 1.0

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
***************************

6. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742832-2742858, mismatch: 0, identity: 1.0

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
***************************

7. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 611087-611113, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
***********************.***

8. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 611177-611203, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgaacacc	Protospacer
*********.*****************

9. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 611267-611293, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
***********************.***

10. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742373-2742399, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggcccttgaacacc	Protospacer
***************.***********

11. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 611672-611698, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgagcgcc	Protospacer
**********************.*.**

12. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742175-2742201, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgaatacc	Protospacer
*********.*************.***

13. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742229-2742255, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgccggtccttgaacacc	Protospacer
*********.**.**************

14. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742328-2742354, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.************.****

15. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742463-2742489, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.************.****

16. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742544-2742570, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgccggtccttgaatacc	Protospacer
************.**********.***

17. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742661-2742687, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgccggtccttgaatacc	Protospacer
************.**********.***

18. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742796-2742822, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggcccttgaatacc	Protospacer
***************.*******.***

19. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742877-2742903, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.************.****

20. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2742922-2742948, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggcccttgagcacc	Protospacer
***************.******.****

21. spacer 1.2|610034|27|NZ_CP009605|CRT matches to position: 2743003-2743029, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgaatacc	Protospacer
*********.*************.***

22. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 611132-611158, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
************************.**

23. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 611312-611338, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
************************.**

24. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 611672-611698, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacctgctggtccttgagcgcc	Protospacer
**********************.****

25. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 2742418-2742444, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
************************.**

26. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 2742832-2742858, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
************************.**

27. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 611177-611203, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacccgctggtccttgaacacc	Protospacer
*********.**************.**

28. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 611762-611788, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.************.****

29. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 611978-612004, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.************.****

30. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 612068-612094, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.************.****

31. spacer 1.3|610079|27|NZ_CP009605|CRT matches to position: 2742373-2742399, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agtagcacctgctggcccttgaacacc	Protospacer
***************.********.**

32. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611132-611158, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

33. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611312-611338, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

34. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611672-611698, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgagcgcc	Protospacer
************************.**

35. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742328-2742354, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.*****************

36. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742418-2742444, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

37. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742463-2742489, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.*****************

38. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742832-2742858, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

39. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742877-2742903, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.*****************

40. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742922-2742948, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggcccttgagcacc	Protospacer
***************.***********

41. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611087-611113, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
**********************..***

42. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611177-611203, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgaacacc	Protospacer
*********.************.****

43. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611267-611293, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
**********************..***

44. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611762-611788, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.**************.**

45. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 611978-612004, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.**************.**

46. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 612068-612094, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.**************.**

47. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742274-2742300, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgccggtccttgagcacc	Protospacer
*********.**.**************

48. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742373-2742399, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggcccttgaacacc	Protospacer
***************.******.****

49. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742508-2742534, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
*********.*****.***********

50. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742625-2742651, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
*********.*****.***********

51. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742706-2742732, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgccggtccttgagcacc	Protospacer
*********.**.**************

52. spacer 1.5|610169|27|NZ_CP009605|CRT matches to position: 2742751-2742777, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
*********.*****.***********

53. spacer 1.8|610304|27|NZ_CP009605|CRT matches to position: 609773-609799, mismatch: 2, identity: 0.926

ggtagcacctgctggtccttgagcacc	CRISPR spacer
ggtagcaccagccggtccttgagcacc	Protospacer
********* **.**************

54. spacer 1.9|610349|27|NZ_CP009605|CRT matches to position: 609773-609799, mismatch: 2, identity: 0.926

ggtagcacctgctggtccttgagcacc	CRISPR spacer
ggtagcaccagccggtccttgagcacc	Protospacer
********* **.**************

55. spacer 1.10|610394|27|NZ_CP009605|CRT matches to position: 609773-609799, mismatch: 2, identity: 0.926

ggtagcacctgctggtccttgagcacc	CRISPR spacer
ggtagcaccagccggtccttgagcacc	Protospacer
********* **.**************

56. spacer 1.11|610439|27|NZ_CP009605|CRT matches to position: 609773-609799, mismatch: 2, identity: 0.926

ggtagcacctgctggtccttgagcacc	CRISPR spacer
ggtagcaccagccggtccttgagcacc	Protospacer
********* **.**************

57. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611132-611158, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

58. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611312-611338, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

59. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611672-611698, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgagcgcc	Protospacer
************************.**

60. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742328-2742354, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.*****************

61. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742418-2742444, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

62. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742463-2742489, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.*****************

63. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742832-2742858, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
**********************.****

64. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742877-2742903, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
*********.*****************

65. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742922-2742948, mismatch: 1, identity: 0.963

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggcccttgagcacc	Protospacer
***************.***********

66. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611087-611113, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
**********************..***

67. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611177-611203, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgaacacc	Protospacer
*********.************.****

68. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611267-611293, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
**********************..***

69. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611762-611788, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.**************.**

70. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 611978-612004, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.**************.**

71. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 612068-612094, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
*********.**************.**

72. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742274-2742300, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgccggtccttgagcacc	Protospacer
*********.**.**************

73. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742373-2742399, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacctgctggcccttgaacacc	Protospacer
***************.******.****

74. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742508-2742534, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
*********.*****.***********

75. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742625-2742651, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
*********.*****.***********

76. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742706-2742732, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgccggtccttgagcacc	Protospacer
*********.**.**************

77. spacer 1.12|610484|27|NZ_CP009605|CRT matches to position: 2742751-2742777, mismatch: 2, identity: 0.926

agtagcacctgctggtccttgagcacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
*********.*****.***********

78. spacer 1.14|610574|36|NZ_CP009605|CRT matches to position: 611888-611923, mismatch: 2, identity: 0.944

ggtagcaccagtagcacccgtgttaccttgaacacc	CRISPR spacer
ggtagcaccagtagcgcccgtgttaccttgaatacc	Protospacer
***************.****************.***

79. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611177-611203, mismatch: 0, identity: 1.0

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgaacacc	Protospacer
***************************

80. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611132-611158, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
*********.*****************

81. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611312-611338, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
*********.*****************

82. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742175-2742201, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgaatacc	Protospacer
***********************.***

83. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742229-2742255, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgccggtccttgaacacc	Protospacer
************.**************

84. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742328-2742354, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
**********************.****

85. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742418-2742444, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
*********.*****************

86. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742463-2742489, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
**********************.****

87. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742832-2742858, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaacacc	Protospacer
*********.*****************

88. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742877-2742903, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcacc	Protospacer
**********************.****

89. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2743003-2743029, mismatch: 1, identity: 0.963

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgaatacc	Protospacer
***********************.***

90. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 609728-609754, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgttggcccttgaacacc	Protospacer
***********.***.***********

91. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611087-611113, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
*********.*************.***

92. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611267-611293, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggtccttgaatacc	Protospacer
*********.*************.***

93. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611762-611788, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
**********************.*.**

94. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 611978-612004, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
**********************.*.**

95. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 612068-612094, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggtccttgagcgcc	Protospacer
**********************.*.**

96. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742274-2742300, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgccggtccttgagcacc	Protospacer
************.*********.****

97. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742373-2742399, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacctgctggcccttgaacacc	Protospacer
*********.*****.***********

98. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742508-2742534, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
***************.******.****

99. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742625-2742651, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
***************.******.****

100. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742706-2742732, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgccggtccttgagcacc	Protospacer
************.*********.****

101. spacer 1.20|610853|27|NZ_CP009605|CRT matches to position: 2742751-2742777, mismatch: 2, identity: 0.926

agtagcacccgctggtccttgaacacc	CRISPR spacer
agtagcacccgctggcccttgagcacc	Protospacer
***************.******.****

102. spacer 1.21|610898|18|NZ_CP009605|CRT matches to position: 611771-611788, mismatch: 0, identity: 1.0

cgctggtccttgagcgcc	CRISPR spacer
cgctggtccttgagcgcc	Protospacer
******************

103. spacer 1.21|610898|18|NZ_CP009605|CRT matches to position: 611987-612004, mismatch: 0, identity: 1.0

cgctggtccttgagcgcc	CRISPR spacer
cgctggtccttgagcgcc	Protospacer
******************

104. spacer 1.21|610898|18|NZ_CP009605|CRT matches to position: 612077-612094, mismatch: 0, identity: 1.0

cgctggtccttgagcgcc	CRISPR spacer
cgctggtccttgagcgcc	Protospacer
******************

105. spacer 1.21|610898|18|NZ_CP009605|CRT matches to position: 2742328-2742345, mismatch: 1, identity: 0.944

cgctggtccttgagcgcc	CRISPR spacer
cgctggtccttgagcacc	Protospacer
***************.**

106. spacer 1.21|610898|18|NZ_CP009605|CRT matches to position: 2742463-2742480, mismatch: 1, identity: 0.944

cgctggtccttgagcgcc	CRISPR spacer
cgctggtccttgagcacc	Protospacer
***************.**

107. spacer 1.21|610898|18|NZ_CP009605|CRT matches to position: 2742877-2742894, mismatch: 1, identity: 0.944

cgctggtccttgagcgcc	CRISPR spacer
cgctggtccttgagcacc	Protospacer
***************.**

108. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611357-611383, mismatch: 0, identity: 1.0

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacacc	Protospacer
***************************

109. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611447-611473, mismatch: 0, identity: 1.0

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacacc	Protospacer
***************************

110. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611492-611518, mismatch: 0, identity: 1.0

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacacc	Protospacer
***************************

111. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611222-611248, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacgcc	Protospacer
************************.**

112. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611402-611428, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacgcc	Protospacer
************************.**

113. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611537-611563, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacgcc	Protospacer
************************.**

114. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611933-611959, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcacc	Protospacer
**********************.****

115. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612527-612553, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcacc	Protospacer
**********************.****

116. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 611717-611743, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacccgtgttaccttgaacgcc	Protospacer
*********.**************.**

117. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612023-612049, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

118. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612104-612130, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcgcctgtgttaccttgagcacc	Protospacer
******.***************.****

119. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612149-612175, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

120. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612194-612220, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcgcccgtgttaccttgaacacc	Protospacer
******.**.*****************

121. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612275-612301, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcgcccgtgttaccttgaacacc	Protospacer
******.**.*****************

122. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612392-612418, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

123. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612437-612463, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

124. spacer 1.22|610934|27|NZ_CP009605|CRT matches to position: 612482-612508, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

125. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611366-611383, mismatch: 0, identity: 1.0

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacacc	Protospacer
******************

126. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611456-611473, mismatch: 0, identity: 1.0

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacacc	Protospacer
******************

127. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611501-611518, mismatch: 0, identity: 1.0

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacacc	Protospacer
******************

128. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611591-611608, mismatch: 0, identity: 1.0

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacacc	Protospacer
******************

129. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611231-611248, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacgcc	Protospacer
***************.**

130. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611411-611428, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacgcc	Protospacer
***************.**

131. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611546-611563, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacgcc	Protospacer
***************.**

132. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611636-611653, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgaacgcc	Protospacer
***************.**

133. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 611942-611959, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgagcacc	Protospacer
*************.****

134. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 612113-612130, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgagcacc	Protospacer
*************.****

135. spacer 1.23|610979|18|NZ_CP009605|CRT matches to position: 612536-612553, mismatch: 1, identity: 0.944

tgtgttaccttgaacacc	CRISPR spacer
tgtgttaccttgagcacc	Protospacer
*************.****

136. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611357-611383, mismatch: 0, identity: 1.0

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacacc	Protospacer
***************************

137. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611447-611473, mismatch: 0, identity: 1.0

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacacc	Protospacer
***************************

138. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611492-611518, mismatch: 0, identity: 1.0

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacacc	Protospacer
***************************

139. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611222-611248, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacgcc	Protospacer
************************.**

140. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611402-611428, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacgcc	Protospacer
************************.**

141. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611537-611563, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgaacgcc	Protospacer
************************.**

142. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611933-611959, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcacc	Protospacer
**********************.****

143. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612527-612553, mismatch: 1, identity: 0.963

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcacc	Protospacer
**********************.****

144. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 611717-611743, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacccgtgttaccttgaacgcc	Protospacer
*********.**************.**

145. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612023-612049, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

146. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612104-612130, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcgcctgtgttaccttgagcacc	Protospacer
******.***************.****

147. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612149-612175, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

148. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612194-612220, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcgcccgtgttaccttgaacacc	Protospacer
******.**.*****************

149. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612275-612301, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcgcccgtgttaccttgaacacc	Protospacer
******.**.*****************

150. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612392-612418, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

151. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612437-612463, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

152. spacer 1.24|611015|27|NZ_CP009605|CRT matches to position: 612482-612508, mismatch: 2, identity: 0.926

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccttgagcgcc	Protospacer
**********************.*.**

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	3	0.889
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	3	0.889
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	3	0.889
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	3	0.889
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	3	0.889
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	3	0.889
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	3	0.889
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	3	0.889
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	3	0.889
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	3	0.889
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	3	0.889
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	3	0.889
NZ_CP009605_1	1.1\|609989\|27\|NZ_CP009605\|CRT	609989-610015	27	GU323708	Lactobacillus phage phiPYB5, complete genome	19349-19375	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	4	0.852
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13201-13227	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	KU716095	Mycobacterium phage Myxus, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	KX585252	Mycobacterium phage HortumSL17, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	MK977713	Mycobacterium phage Tubs, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	MN369763	Mycobacterium phage Aliter, complete genome	4831-4857	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	KX664447	Mycobacterium phage Phaeder, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	KU613353	Mycobacterium phage Catalina, complete genome	4904-4930	4	0.852
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	NC_042314	Mycobacterium virus PackMan, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	KU716095	Mycobacterium phage Myxus, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	KX585252	Mycobacterium phage HortumSL17, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	MK977713	Mycobacterium phage Tubs, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	MN369763	Mycobacterium phage Aliter, complete genome	4831-4857	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	KX664447	Mycobacterium phage Phaeder, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	KU613353	Mycobacterium phage Catalina, complete genome	4904-4930	4	0.852
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	NC_042314	Mycobacterium virus PackMan, complete genome	4903-4929	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650050-650076	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650050-650076	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650050-650076	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650050-650076	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	4	0.852
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	4	0.852
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13201-13227	4	0.852
NZ_CP009605_1	1.15\|610628\|27\|NZ_CP009605\|CRT	610628-610654	27	NC_048807	Erwinia phage pEp_SNUABM_01, complete genome	38734-38760	4	0.852
NZ_CP009605_1	1.16\|610673\|27\|NZ_CP009605\|CRT	610673-610699	27	NC_048807	Erwinia phage pEp_SNUABM_01, complete genome	38734-38760	4	0.852
NZ_CP009605_1	1.20\|610853\|27\|NZ_CP009605\|CRT	610853-610879	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	4	0.852
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	MN163280	Klebsiella phage KpGranit, complete genome	83375-83401	4	0.852
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	MN163280	Klebsiella phage KpGranit, complete genome	84578-84604	4	0.852
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	MN163280	Klebsiella phage KpGranit, complete genome	83375-83401	4	0.852
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	MN163280	Klebsiella phage KpGranit, complete genome	84578-84604	4	0.852
NZ_CP009605_1	1.2\|610034\|27\|NZ_CP009605\|CRT	610034-610060	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	572907-572933	5	0.815
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	5	0.815
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	5	0.815
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	560480-560506	5	0.815
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	MG298964	Streptomyces phage Alsaber, complete genome	22215-22241	5	0.815
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	KX815338	Streptomyces phage Joe, complete genome	21965-21991	5	0.815
NZ_CP009605_1	1.5\|610169\|27\|NZ_CP009605\|CRT	610169-610195	27	MN694348	Marine virus AFVG_250M382, complete genome	6005-6031	5	0.815
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	560480-560506	5	0.815
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	560480-560506	5	0.815
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	560480-560506	5	0.815
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	560480-560506	5	0.815
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380841-380867	5	0.815
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	560480-560506	5	0.815
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	MG298964	Streptomyces phage Alsaber, complete genome	22215-22241	5	0.815
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	KX815338	Streptomyces phage Joe, complete genome	21965-21991	5	0.815
NZ_CP009605_1	1.12\|610484\|27\|NZ_CP009605\|CRT	610484-610510	27	MN694348	Marine virus AFVG_250M382, complete genome	6005-6031	5	0.815
NZ_CP009605_1	1.13\|610529\|27\|NZ_CP009605\|CRT	610529-610555	27	MN693147	Marine virus AFVG_25M514, complete genome	19819-19845	5	0.815
NZ_CP009605_1	1.13\|610529\|27\|NZ_CP009605\|CRT	610529-610555	27	MN693499	Marine virus AFVG_25M513, complete genome	19828-19854	5	0.815
NZ_CP009605_1	1.15\|610628\|27\|NZ_CP009605\|CRT	610628-610654	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13201-13227	5	0.815
NZ_CP009605_1	1.16\|610673\|27\|NZ_CP009605\|CRT	610673-610699	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13201-13227	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	572907-572933	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	5	0.815
NZ_CP009605_1	1.17\|610718\|27\|NZ_CP009605\|CRT	610718-610744	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	572907-572933	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9185-9211	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9015-9041	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9787-9813	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4484-4510	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17317-17343	5	0.815
NZ_CP009605_1	1.18\|610763\|27\|NZ_CP009605\|CRT	610763-610789	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14917-14943	5	0.815
NZ_CP009605_1	1.19\|610808\|27\|NZ_CP009605\|CRT	610808-610834	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58609-58635	5	0.815
NZ_CP009605_1	1.22\|610934\|27\|NZ_CP009605\|CRT	610934-610960	27	MN693673	Marine virus AFVG_250M950, complete genome	35648-35674	5	0.815
NZ_CP009605_1	1.24\|611015\|27\|NZ_CP009605\|CRT	611015-611041	27	MN693673	Marine virus AFVG_250M950, complete genome	35648-35674	5	0.815
NZ_CP009605_1	1.3\|610079\|27\|NZ_CP009605\|CRT	610079-610105	27	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	1449835-1449861	6	0.778
NZ_CP009605_1	1.4\|610124\|27\|NZ_CP009605\|CRT	610124-610150	27	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	1449835-1449861	6	0.778
NZ_CP009605_1	1.6\|610214\|27\|NZ_CP009605\|CRT	610214-610240	27	NC_017074	Selenomonas ruminantium subsp. lactilytica TAM6421 plasmid pSRC5, complete sequence	33034-33060	6	0.778
NZ_CP009605_1	1.7\|610259\|27\|NZ_CP009605\|CRT	610259-610285	27	NC_017074	Selenomonas ruminantium subsp. lactilytica TAM6421 plasmid pSRC5, complete sequence	33034-33060	6	0.778
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	MG298964	Streptomyces phage Alsaber, complete genome	22215-22241	6	0.778
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	KX815338	Streptomyces phage Joe, complete genome	21965-21991	6	0.778
NZ_CP009605_1	1.8\|610304\|27\|NZ_CP009605\|CRT	610304-610330	27	MN694348	Marine virus AFVG_250M382, complete genome	6005-6031	6	0.778
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	MG298964	Streptomyces phage Alsaber, complete genome	22215-22241	6	0.778
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	KX815338	Streptomyces phage Joe, complete genome	21965-21991	6	0.778
NZ_CP009605_1	1.9\|610349\|27\|NZ_CP009605\|CRT	610349-610375	27	MN694348	Marine virus AFVG_250M382, complete genome	6005-6031	6	0.778
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	MG298964	Streptomyces phage Alsaber, complete genome	22215-22241	6	0.778
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	KX815338	Streptomyces phage Joe, complete genome	21965-21991	6	0.778
NZ_CP009605_1	1.10\|610394\|27\|NZ_CP009605\|CRT	610394-610420	27	MN694348	Marine virus AFVG_250M382, complete genome	6005-6031	6	0.778
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	MG298964	Streptomyces phage Alsaber, complete genome	22215-22241	6	0.778
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	KX815338	Streptomyces phage Joe, complete genome	21965-21991	6	0.778
NZ_CP009605_1	1.11\|610439\|27\|NZ_CP009605\|CRT	610439-610465	27	MN694348	Marine virus AFVG_250M382, complete genome	6005-6031	6	0.778
NZ_CP009605_1	1.13\|610529\|27\|NZ_CP009605\|CRT	610529-610555	27	MN693404	Marine virus AFVG_25M515, complete genome	20154-20180	6	0.778
NZ_CP009605_1	1.14\|610574\|36\|NZ_CP009605\|CRT	610574-610609	36	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79808-79843	6	0.833
NZ_CP009605_1	1.14\|610574\|36\|NZ_CP009605\|CRT	610574-610609	36	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84313-84348	6	0.833
NZ_CP009605_1	1.15\|610628\|27\|NZ_CP009605\|CRT	610628-610654	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	381406-381432	6	0.778
NZ_CP009605_1	1.16\|610673\|27\|NZ_CP009605\|CRT	610673-610699	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	381406-381432	6	0.778
NZ_CP009605_1	1.14\|610574\|36\|NZ_CP009605\|CRT	610574-610609	36	MN101228	Klebsiella phage KPN4, complete genome	25927-25962	8	0.778

1. spacer 1.5|610169|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

2. spacer 1.5|610169|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

3. spacer 1.5|610169|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

4. spacer 1.5|610169|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

5. spacer 1.5|610169|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

6. spacer 1.5|610169|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

7. spacer 1.12|610484|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

8. spacer 1.12|610484|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

9. spacer 1.12|610484|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

10. spacer 1.12|610484|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

11. spacer 1.12|610484|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

12. spacer 1.12|610484|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** *******************  **

13. spacer 1.1|609989|27|NZ_CP009605|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacccgttggcccttgaacgcc	CRISPR spacer
agtagcaccagtaggcccttgaagtcc	Protospacer
********* ** **********  **

14. spacer 1.2|610034|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

15. spacer 1.2|610034|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

16. spacer 1.2|610034|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

17. spacer 1.2|610034|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

18. spacer 1.2|610034|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

19. spacer 1.2|610034|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
* .****** ************** **

20. spacer 1.2|610034|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

21. spacer 1.3|610079|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

22. spacer 1.3|610079|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

23. spacer 1.3|610079|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

24. spacer 1.3|610079|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

25. spacer 1.3|610079|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

26. spacer 1.3|610079|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
*** ******************.  **

27. spacer 1.3|610079|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgaacgcc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
* .****** ************** **

28. spacer 1.5|610169|27|NZ_CP009605|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggcccttgaggtcc	Protospacer
*** ***********.*******  **

29. spacer 1.6|610214|27|NZ_CP009605|CRT matches to KU716095 (Mycobacterium phage Myxus, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

30. spacer 1.6|610214|27|NZ_CP009605|CRT matches to KX585252 (Mycobacterium phage HortumSL17, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

31. spacer 1.6|610214|27|NZ_CP009605|CRT matches to MK977713 (Mycobacterium phage Tubs, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

32. spacer 1.6|610214|27|NZ_CP009605|CRT matches to MN369763 (Mycobacterium phage Aliter, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

33. spacer 1.6|610214|27|NZ_CP009605|CRT matches to KX664447 (Mycobacterium phage Phaeder, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

34. spacer 1.6|610214|27|NZ_CP009605|CRT matches to KU613353 (Mycobacterium phage Catalina, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

35. spacer 1.6|610214|27|NZ_CP009605|CRT matches to NC_042314 (Mycobacterium virus PackMan, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

36. spacer 1.7|610259|27|NZ_CP009605|CRT matches to KU716095 (Mycobacterium phage Myxus, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

37. spacer 1.7|610259|27|NZ_CP009605|CRT matches to KX585252 (Mycobacterium phage HortumSL17, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

38. spacer 1.7|610259|27|NZ_CP009605|CRT matches to MK977713 (Mycobacterium phage Tubs, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

39. spacer 1.7|610259|27|NZ_CP009605|CRT matches to MN369763 (Mycobacterium phage Aliter, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

40. spacer 1.7|610259|27|NZ_CP009605|CRT matches to KX664447 (Mycobacterium phage Phaeder, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

41. spacer 1.7|610259|27|NZ_CP009605|CRT matches to KU613353 (Mycobacterium phage Catalina, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

42. spacer 1.7|610259|27|NZ_CP009605|CRT matches to NC_042314 (Mycobacterium virus PackMan, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
gggagcgcctgctgggccttgaagtcc	Protospacer
** ************ *******  **

43. spacer 1.8|610304|27|NZ_CP009605|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agcagcaccagctggtccttgagctcc	Protospacer
.*.****** ************** **

44. spacer 1.8|610304|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

45. spacer 1.8|610304|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

46. spacer 1.8|610304|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

47. spacer 1.8|610304|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

48. spacer 1.8|610304|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

49. spacer 1.8|610304|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

50. spacer 1.9|610349|27|NZ_CP009605|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agcagcaccagctggtccttgagctcc	Protospacer
.*.****** ************** **

51. spacer 1.9|610349|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

52. spacer 1.9|610349|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

53. spacer 1.9|610349|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

54. spacer 1.9|610349|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

55. spacer 1.9|610349|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

56. spacer 1.9|610349|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

57. spacer 1.10|610394|27|NZ_CP009605|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agcagcaccagctggtccttgagctcc	Protospacer
.*.****** ************** **

58. spacer 1.10|610394|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

59. spacer 1.10|610394|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

60. spacer 1.10|610394|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

61. spacer 1.10|610394|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

62. spacer 1.10|610394|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

63. spacer 1.10|610394|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

64. spacer 1.11|610439|27|NZ_CP009605|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agcagcaccagctggtccttgagctcc	Protospacer
.*.****** ************** **

65. spacer 1.11|610439|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

66. spacer 1.11|610439|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

67. spacer 1.11|610439|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

68. spacer 1.11|610439|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

69. spacer 1.11|610439|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

70. spacer 1.11|610439|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** *******************  **

71. spacer 1.12|610484|27|NZ_CP009605|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 4, identity: 0.852

agtagcacctgctggtccttgagcacc	CRISPR spacer
agttgcacctgctggcccttgaggtcc	Protospacer
*** ***********.*******  **

72. spacer 1.15|610628|27|NZ_CP009605|CRT matches to NC_048807 (Erwinia phage pEp_SNUABM_01, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggcccttg-aacacc	CRISPR spacer
tttagcacctgctggcccttgcaacag-	Protospacer
  ******************* ****

73. spacer 1.16|610673|27|NZ_CP009605|CRT matches to NC_048807 (Erwinia phage pEp_SNUABM_01, complete genome) position: , mismatch: 4, identity: 0.852

ggtagcacctgctggcccttg-aacacc	CRISPR spacer
tttagcacctgctggcccttgcaacag-	Protospacer
  ******************* ****

74. spacer 1.20|610853|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacccgctggtccttgaacacc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
* .****** ************** **

75. spacer 1.22|610934|27|NZ_CP009605|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccctgtggacc	Protospacer
******************.** . ***

76. spacer 1.22|610934|27|NZ_CP009605|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccctgtggacc	Protospacer
******************.** . ***

77. spacer 1.24|611015|27|NZ_CP009605|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccctgtggacc	Protospacer
******************.** . ***

78. spacer 1.24|611015|27|NZ_CP009605|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agtagcacctgtgttaccctgtggacc	Protospacer
******************.** . ***

79. spacer 1.2|610034|27|NZ_CP009605|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgaacacc	CRISPR spacer
tggcgcacctgcgggtcctcgaacacc	Protospacer
 *  ******** ******.*******

80. spacer 1.3|610079|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgaacgcc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** *********.****

81. spacer 1.4|610124|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
. .****** ************** **

82. spacer 1.4|610124|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** *********.****

83. spacer 1.4|610124|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

84. spacer 1.4|610124|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

85. spacer 1.4|610124|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

86. spacer 1.4|610124|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

87. spacer 1.4|610124|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

88. spacer 1.4|610124|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

89. spacer 1.5|610169|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** ***********.**

90. spacer 1.5|610169|27|NZ_CP009605|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
cgcagcaccggctggtccttcagcacg	Protospacer
 *.****** ********** *****

91. spacer 1.5|610169|27|NZ_CP009605|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
*   **.************ *******

92. spacer 1.5|610169|27|NZ_CP009605|CRT matches to KX815338 (Streptomyces phage Joe, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
*   **.************ *******

93. spacer 1.5|610169|27|NZ_CP009605|CRT matches to MN694348 (Marine virus AFVG_250M382, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
acctgcacctgctggtgctggagcacc	Protospacer
* . ************ ** *******

94. spacer 1.8|610304|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** ***********.**

95. spacer 1.8|610304|27|NZ_CP009605|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
cgcagcaccggctggtccttcagcacg	Protospacer
 *.****** ********** *****

96. spacer 1.9|610349|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** ***********.**

97. spacer 1.9|610349|27|NZ_CP009605|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
cgcagcaccggctggtccttcagcacg	Protospacer
 *.****** ********** *****

98. spacer 1.10|610394|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** ***********.**

99. spacer 1.10|610394|27|NZ_CP009605|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
cgcagcaccggctggtccttcagcacg	Protospacer
 *.****** ********** *****

100. spacer 1.11|610439|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** ***********.**

101. spacer 1.11|610439|27|NZ_CP009605|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgagcacc	CRISPR spacer
cgcagcaccggctggtccttcagcacg	Protospacer
 *.****** ********** *****

102. spacer 1.12|610484|27|NZ_CP009605|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
tggcgcacctgcaggtccttgagcgcc	Protospacer
 *  ******** ***********.**

103. spacer 1.12|610484|27|NZ_CP009605|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
cgcagcaccggctggtccttcagcacg	Protospacer
 *.****** ********** *****

104. spacer 1.12|610484|27|NZ_CP009605|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
*   **.************ *******

105. spacer 1.12|610484|27|NZ_CP009605|CRT matches to KX815338 (Streptomyces phage Joe, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
*   **.************ *******

106. spacer 1.12|610484|27|NZ_CP009605|CRT matches to MN694348 (Marine virus AFVG_250M382, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgctggtccttgagcacc	CRISPR spacer
acctgcacctgctggtgctggagcacc	Protospacer
* . ************ ** *******

107. spacer 1.13|610529|27|NZ_CP009605|CRT matches to MN693147 (Marine virus AFVG_25M514, complete genome) position: , mismatch: 5, identity: 0.815

ggtagtacctgctggtccttgaacacc	CRISPR spacer
gccagtacctgctggtccttgaccata	Protospacer
* .******************* **.

108. spacer 1.13|610529|27|NZ_CP009605|CRT matches to MN693499 (Marine virus AFVG_25M513, complete genome) position: , mismatch: 5, identity: 0.815

ggtagtacctgctggtccttgaacacc	CRISPR spacer
gccagtacctgctggtccttgaccata	Protospacer
* .******************* **.

109. spacer 1.15|610628|27|NZ_CP009605|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggcccttgaacacc	CRISPR spacer
agttgcacctgctggcccttgaggtcc	Protospacer
.** ******************.  **

110. spacer 1.16|610673|27|NZ_CP009605|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggcccttgaacacc	CRISPR spacer
agttgcacctgctggcccttgaggtcc	Protospacer
.** ******************.  **

111. spacer 1.17|610718|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
. .****** ************** **

112. spacer 1.17|610718|27|NZ_CP009605|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
tggcgcacctgcgggtcctcgaacacc	Protospacer
 *  ******** ******.*******

113. spacer 1.17|610718|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

114. spacer 1.17|610718|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

115. spacer 1.17|610718|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

116. spacer 1.17|610718|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

117. spacer 1.17|610718|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

118. spacer 1.17|610718|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

119. spacer 1.18|610763|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
. .****** ************** **

120. spacer 1.18|610763|27|NZ_CP009605|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
tggcgcacctgcgggtcctcgaacacc	Protospacer
 *  ******** ******.*******

121. spacer 1.18|610763|27|NZ_CP009605|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

122. spacer 1.18|610763|27|NZ_CP009605|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

123. spacer 1.18|610763|27|NZ_CP009605|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

124. spacer 1.18|610763|27|NZ_CP009605|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

125. spacer 1.18|610763|27|NZ_CP009605|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

126. spacer 1.18|610763|27|NZ_CP009605|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

ggtagcacctgctggtccttgaacacc	CRISPR spacer
agttgcacctgctggtccttgaggccc	Protospacer
.** ******************.  **

127. spacer 1.19|610808|27|NZ_CP009605|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

ggtagcacccgctggtccttgaacacc	CRISPR spacer
atcagcaccggctggtccttgaactcc	Protospacer
. .****** ************** **

128. spacer 1.22|610934|27|NZ_CP009605|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agcctcacctctgttaccttgaacact	Protospacer
**.  ***** ***************.

129. spacer 1.24|611015|27|NZ_CP009605|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

agtagcacctgtgttaccttgaacacc	CRISPR spacer
agcctcacctctgttaccttgaacact	Protospacer
**.  ***** ***************.

130. spacer 1.3|610079|27|NZ_CP009605|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 6, identity: 0.778

agtagcacctgctggtccttgaacgcc	CRISPR spacer
cgccgcacctgcgggtccttgaacggg	Protospacer
 *. ******** ************

131. spacer 1.4|610124|27|NZ_CP009605|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgaacgcc	CRISPR spacer
cgccgcacctgcgggtccttgaacggg	Protospacer
 *. ******** ************

132. spacer 1.6|610214|27|NZ_CP009605|CRT matches to NC_017074 (Selenomonas ruminantium subsp. lactilytica TAM6421 plasmid pSRC5, complete sequence) position: , mismatch: 6, identity: 0.778

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
ttgaacgcctgctggcccttgaacgct	Protospacer
   *.**********.**********.

133. spacer 1.7|610259|27|NZ_CP009605|CRT matches to NC_017074 (Selenomonas ruminantium subsp. lactilytica TAM6421 plasmid pSRC5, complete sequence) position: , mismatch: 6, identity: 0.778

ggtagcgcctgctggtccttgaacgcc	CRISPR spacer
ttgaacgcctgctggcccttgaacgct	Protospacer
   *.**********.**********.

134. spacer 1.8|610304|27|NZ_CP009605|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

135. spacer 1.8|610304|27|NZ_CP009605|CRT matches to KX815338 (Streptomyces phage Joe, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

136. spacer 1.8|610304|27|NZ_CP009605|CRT matches to MN694348 (Marine virus AFVG_250M382, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
acctgcacctgctggtgctggagcacc	Protospacer
. . ************ ** *******

137. spacer 1.9|610349|27|NZ_CP009605|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

138. spacer 1.9|610349|27|NZ_CP009605|CRT matches to KX815338 (Streptomyces phage Joe, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

139. spacer 1.9|610349|27|NZ_CP009605|CRT matches to MN694348 (Marine virus AFVG_250M382, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
acctgcacctgctggtgctggagcacc	Protospacer
. . ************ ** *******

140. spacer 1.10|610394|27|NZ_CP009605|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

141. spacer 1.10|610394|27|NZ_CP009605|CRT matches to KX815338 (Streptomyces phage Joe, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

142. spacer 1.10|610394|27|NZ_CP009605|CRT matches to MN694348 (Marine virus AFVG_250M382, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
acctgcacctgctggtgctggagcacc	Protospacer
. . ************ ** *******

143. spacer 1.11|610439|27|NZ_CP009605|CRT matches to MG298964 (Streptomyces phage Alsaber, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

144. spacer 1.11|610439|27|NZ_CP009605|CRT matches to KX815338 (Streptomyces phage Joe, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
atgcgcgcctgctggtcctggagcacc	Protospacer
.   **.************ *******

145. spacer 1.11|610439|27|NZ_CP009605|CRT matches to MN694348 (Marine virus AFVG_250M382, complete genome) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggtccttgagcacc	CRISPR spacer
acctgcacctgctggtgctggagcacc	Protospacer
. . ************ ** *******

146. spacer 1.13|610529|27|NZ_CP009605|CRT matches to MN693404 (Marine virus AFVG_25M515, complete genome) position: , mismatch: 6, identity: 0.778

ggtagtacctgctggtccttgaacacc	CRISPR spacer
accagtacctgctggtccttgaccata	Protospacer
. .******************* **.

147. spacer 1.14|610574|36|NZ_CP009605|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.833

ggtagcaccagtagcacccgtgttaccttgaacacc	CRISPR spacer
tgtagcaccagtagcaccagtgttaccctgcggacc	Protospacer
 ***************** ********.** . ***

148. spacer 1.14|610574|36|NZ_CP009605|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.833

ggtagcaccagtagcacccgtgttaccttgaacacc	CRISPR spacer
tgtagcaccagtagcaccagtgttaccctgcggacc	Protospacer
 ***************** ********.** . ***

149. spacer 1.15|610628|27|NZ_CP009605|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggcccttgaacacc	CRISPR spacer
accagcacctgctcgcccttgaaccac	Protospacer
. .********** **********  *

150. spacer 1.16|610673|27|NZ_CP009605|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

ggtagcacctgctggcccttgaacacc	CRISPR spacer
accagcacctgctcgcccttgaaccac	Protospacer
. .********** **********  *

151. spacer 1.14|610574|36|NZ_CP009605|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 8, identity: 0.778

ggtagcaccagtagcacccgtgttaccttgaacacc	CRISPR spacer
ctgagcaccagtagcacccgtgctaccctgtggacc	Protospacer
   *******************.****.** . ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1670584 : 1693733

Bacillus_phage(60.0%)

integrase,terminase,portal,capsid,tail,head,protease

attL 1665824:1665839|attR 1695036:1695051

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1665824:1665839	attL	NA	NA	NA	NA
WP_000753428.1\|1670584_1671649_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	1.1e-199	96.3
WP_000461726.1\|1671645_1671885_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	1.1e-32	93.7
WP_000398737.1\|1671884_1672121_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	2.2e-17	96.2
WP_001260148.1\|1672212_1677057_-	hypothetical protein	I7ILV8	Bacillus_phage	0.0e+00	44.6
WP_000094100.1\|1677053_1678538_-	hypothetical protein	A0A1B1P7W7	Bacillus_phage	4.4e-236	78.7
WP_000918779.1\|1678579_1682212_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	3.4e-189	86.8
WP_000415926.1\|1682442_1682799_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	5.7e-41	70.8
WP_001004912.1\|1682805_1683393_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	1.3e-87	82.6
WP_000172082.1\|1683393_1683723_-	hypothetical protein	D2XR22	Bacillus_phage	3.3e-51	91.7
WP_000997570.1\|1683722_1684064_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	1.7e-50	89.3
WP_001247276.1\|1684065_1684419_-\|head	phage head closure protein	A0A2H4JGG7	uncultured_Caudovirales_phage	6.6e-58	95.7
WP_000447741.1\|1684420_1684714_-	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	2.2e-43	88.7
WP_000234871.1\|1684719_1685874_-\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	1.6e-201	92.2
WP_000401406.1\|1685877_1686621_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.6e-130	97.2
WP_033687868.1\|1686620_1687766_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	6.9e-181	81.6
WP_000621028.1\|1687774_1689442_-\|terminase	terminase large subunit	D2XR15	Bacillus_phage	4.1e-307	91.4
WP_000301144.1\|1689438_1689750_-\|terminase	terminase	D2XR14	Bacillus_phage	8.8e-46	96.1
WP_000666395.1\|1689875_1690211_-	HNH endonuclease	D2XR61	Bacillus_phage	1.9e-54	92.8
WP_000778967.1\|1690197_1690425_-	hypothetical protein	D2XR60	Bacillus_phage	2.1e-28	91.2
WP_001104804.1\|1690908_1691631_-	hypothetical protein	NA	NA	NA	NA
WP_001170291.1\|1692026_1692977_-	nucleoside hydrolase	NA	NA	NA	NA
WP_001012119.1\|1693190_1693733_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	3.1e-86	89.4
1695036:1695051	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1698535 : 1710311

Bacillus_phage(92.86%)

integrase

attL 1693665:1693681|attR 1711133:1711149

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1693665:1693681	attL	NA	NA	NA	NA
WP_001164498.1\|1698535_1699108_+	cupin domain-containing protein	Q2Q459	Bacillus_phage	3.1e-89	84.7
WP_033688511.1\|1699390_1699639_-	DUF3947 family protein	NA	NA	NA	NA
WP_000456896.1\|1701299_1701902_-	hypothetical protein	A0A0S2SXN5	Bacillus_phage	4.6e-43	43.6
WP_000649313.1\|1701940_1702237_-	hypothetical protein	NA	NA	NA	NA
WP_000646514.1\|1702279_1702735_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.9e-20	48.2
WP_000885286.1\|1702750_1703176_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	4.2e-14	41.9
WP_000811853.1\|1703187_1703442_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	5.5e-38	91.7
WP_000805173.1\|1703456_1703630_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.1e-24	96.5
WP_000332469.1\|1703655_1703850_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	2.6e-24	84.4
WP_033687866.1\|1703864_1704668_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	1.6e-144	97.7
WP_000190242.1\|1704636_1705356_-	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	5.8e-93	85.9
WP_000522183.1\|1705730_1705997_-	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	2.0e-27	72.9
WP_001192728.1\|1706037_1706262_-	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	3.6e-09	45.1
WP_000367270.1\|1706448_1706799_+	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	4.8e-16	37.9
WP_001197705.1\|1707244_1708441_-	hypothetical protein	D2XQ10	Bacillus_virus	1.5e-80	45.8
WP_000675849.1\|1709201_1710311_+\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	1.8e-149	79.4
1711133:1711149	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1984189 : 1991292

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009879021.1\|1984189_1984774_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	1.9e-81	77.0
WP_000571536.1\|1984751_1985942_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	3.1e-147	64.1
WP_000156981.1\|1986060_1986243_-	hypothetical protein	A0A288WGN6	Bacillus_phage	4.1e-19	80.0
WP_001267640.1\|1986239_1986542_-	hypothetical protein	A0A288WG38	Bacillus_phage	2.4e-24	51.5
WP_000649834.1\|1986707_1986908_+	helix-turn-helix domain-containing protein	A0A288WG80	Bacillus_phage	9.0e-20	76.6
WP_000637732.1\|1986944_1987409_+	restriction endonuclease	Q331T5	Clostridium_botulinum_C_phage	7.0e-15	43.2
WP_000669607.1\|1988753_1989905_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000249923.1\|1990086_1991292_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	1.4e-51	47.4

DBSCAN-SWA_4

2306217 : 2314949

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001258549.1\|2306217_2307090_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	6.0e-68	46.6
WP_002036196.1\|2307230_2307344_-	hypothetical protein	W8CYT3	Bacillus_phage	2.1e-05	91.7
WP_000818985.1\|2307459_2308179_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000823559.1\|2308374_2308962_+	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_001231491.1\|2308986_2310060_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	7.2e-172	88.8
WP_002036191.1\|2310056_2310743_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-118	93.4
WP_000453764.1\|2310822_2312583_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-266	95.5
WP_001194301.1\|2312823_2313588_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755548.1\|2313686_2314949_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.6e-11	31.5

DBSCAN-SWA_5

2884682 : 2914075

Bacillus_phage(16.67%)

integrase,terminase,portal,capsid,protease

attL 2901809:2901823|attR 2910095:2910109

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000747596.1\|2884682_2885510_+\|protease	serine protease	U5Q0C0	Bacillus_phage	3.7e-43	67.7
WP_000598985.1\|2885550_2886156_-	DUF1648 domain-containing protein	NA	NA	NA	NA
WP_000448361.1\|2886247_2887171_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_000490297.1\|2887269_2887686_-	hypothetical protein	NA	NA	NA	NA
WP_000856455.1\|2887786_2889979_-	MMPL family transporter	NA	NA	NA	NA
WP_000727802.1\|2890089_2890737_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000772500.1\|2890796_2891846_-	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
WP_000714199.1\|2891884_2892685_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_000715491.1\|2892691_2893540_-	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	1.0e-11	24.4
WP_000720319.1\|2893536_2894520_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	9.3e-25	31.2
WP_000116798.1\|2894758_2896126_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_001035926.1\|2896297_2898685_-\|protease	M6 family metalloprotease domain-containing protein	NA	NA	NA	NA
WP_000276214.1\|2899028_2899163_+	DNA-binding anti-repressor SinI	NA	NA	NA	NA
WP_000578878.1\|2899242_2899566_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000053731.1\|2899641_2900235_-	camelysin	NA	NA	NA	NA
WP_000917469.1\|2900632_2901499_-	DUF4047 domain-containing protein	NA	NA	NA	NA
WP_000172840.1\|2901660_2902248_-	cell division protein FtsN	NA	NA	NA	NA
2901809:2901823	attL	NA	NA	NA	NA
WP_000767813.1\|2902310_2902880_-	signal peptidase I	NA	NA	NA	NA
WP_000247011.1\|2903071_2904358_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_000251855.1\|2904513_2904741_-	hypothetical protein	NA	NA	NA	NA
WP_000858633.1\|2905106_2905862_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000090210.1\|2906139_2906364_+	hypothetical protein	NA	NA	NA	NA
WP_002035993.1\|2906677_2907832_+\|integrase	tyrosine-type recombinase/integrase	A0A0M4S6G4	Salmonella_phage	4.3e-05	21.4
WP_000334962.1\|2907955_2908693_+	hypothetical protein	NA	NA	NA	NA
WP_000093742.1\|2908834_2909329_+	hypothetical protein	NA	NA	NA	NA
WP_002035988.1\|2909636_2911304_-\|capsid	phage major capsid protein	A0A1G5SCB8	Enterococcus_phage	1.2e-61	37.8
2910095:2910109	attR	NA	NA	NA	NA
WP_000896384.1\|2911365_2912667_-\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	4.6e-72	35.1
WP_000874865.1\|2912957_2913203_-	hypothetical protein	NA	NA	NA	NA
WP_000811159.1\|2913377_2913638_-	hypothetical protein	NA	NA	NA	NA
WP_001153942.1\|2913634_2914075_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA

DBSCAN-SWA_6

3615470 : 3656542

Bacillus_phage(84.44%)

integrase,terminase,holin,portal,tail,capsid,protease

attL 3608639:3608657|attR 3663334:3663352

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3608639:3608657	attL	NA	NA	NA	NA
WP_000604231.1\|3615470_3615689_+	winged helix-turn-helix transcriptional regulator	A0A1B1P7Q3	Bacillus_phage	9.2e-18	61.2
WP_000633248.1\|3615707_3615965_+	hypothetical protein	A0A1B2APX4	Phage_Wrath	4.0e-20	58.8
WP_000135310.1\|3615978_3616731_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	1.8e-97	72.4
WP_000787572.1\|3616747_3616978_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.8e-32	93.4
WP_001115042.1\|3617020_3617260_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
WP_000822943.1\|3617275_3618235_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	4.6e-170	92.2
WP_001049697.1\|3618330_3619095_-	hypothetical protein	NA	NA	NA	NA
WP_000614141.1\|3619386_3620187_+	hypothetical protein	NA	NA	NA	NA
WP_144405015.1\|3620465_3622598_-	hypothetical protein	Q9FZW3	Bacillus_phage	6.9e-25	45.1
WP_000962013.1\|3622654_3624271_-	hypothetical protein	A0A0K1LLF9	Bacillus_phage	1.4e-94	37.6
WP_000198630.1\|3624348_3625209_-\|tail	phage tail family protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.7e-70	56.0
WP_000113549.1\|3625213_3629725_-	hypothetical protein	Q0H230	Geobacillus_phage	3.2e-104	52.4
WP_000701647.1\|3629888_3630365_-	hypothetical protein	A0A1B1P772	Bacillus_phage	7.6e-41	54.9
WP_000301569.1\|3630439_3631024_-	hypothetical protein	A0A1B1P778	Bacillus_phage	2.9e-58	57.6
WP_000118162.1\|3631025_3631454_-	hypothetical protein	A0A1B1P769	Bacillus_phage	1.4e-57	74.5
WP_000664219.1\|3631434_3631818_-	hypothetical protein	A0A1B1P759	Bacillus_phage	3.6e-49	80.8
WP_001168000.1\|3631792_3632188_-	hypothetical protein	A0A1B1P760	Bacillus_phage	1.7e-46	79.1
WP_000369365.1\|3632171_3632465_-	hypothetical protein	A0A1B1P751	Bacillus_phage	5.4e-37	77.3
WP_080000553.1\|3632457_3632631_-	hypothetical protein	NA	NA	NA	NA
WP_000154580.1\|3632605_3633757_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.2e-203	93.5
WP_000423566.1\|3633784_3634531_-\|protease	Clp protease ClpP	Q8W605	Listeria_phage	3.5e-64	60.7
WP_000524275.1\|3634511_3635684_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	3.3e-202	90.9
WP_033687799.1\|3635698_3637381_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	9.8e-309	93.0
WP_001228912.1\|3637364_3637685_-	hypothetical protein	A0A1B1P762	Bacillus_phage	4.5e-45	85.8
WP_000587663.1\|3637791_3638100_-	hypothetical protein	A0A1B1P767	Bacillus_phage	1.3e-41	80.8
WP_000656806.1\|3638102_3638450_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	2.1e-24	53.1
WP_144405022.1\|3638939_3639212_-	hypothetical protein	NA	NA	NA	NA
WP_001055134.1\|3639412_3639955_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	2.8e-92	95.0
WP_000744464.1\|3639951_3640422_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	6.1e-59	72.3
WP_000758102.1\|3640784_3641066_-	hypothetical protein	NA	NA	NA	NA
WP_042631248.1\|3641182_3641929_-	site-specific DNA-methyltransferase	W8EBG5	Geobacillus_phage	2.9e-79	60.2
WP_049689347.1\|3642047_3642413_-	hypothetical protein	NA	NA	NA	NA
WP_000714747.1\|3642448_3642658_-	hypothetical protein	I1TLG8	Bacillus_phage	1.8e-31	91.3
WP_042631249.1\|3642695_3642878_-	hypothetical protein	A0A1B1P7C0	Bacillus_phage	1.5e-21	89.8
WP_000646516.1\|3642903_3643179_-	hypothetical protein	NA	NA	NA	NA
WP_042631161.1\|3643214_3643424_-	hypothetical protein	I1TLG8	Bacillus_phage	3.9e-34	97.1
WP_000778214.1\|3643462_3643978_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	D2XR49	Bacillus_phage	1.5e-82	90.1
WP_000974688.1\|3643999_3644191_-	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	1.2e-26	93.7
WP_001231314.1\|3644264_3644627_-	hypothetical protein	D2XR47	Bacillus_phage	8.1e-59	94.2
WP_000604168.1\|3644601_3644889_-	hypothetical protein	D2XR46	Bacillus_phage	4.9e-43	94.4
WP_000926804.1\|3644863_3645052_-	hypothetical protein	D2XR45	Bacillus_phage	1.0e-20	88.7
WP_000063901.1\|3645054_3646377_-	replicative DNA helicase	D2XR44	Bacillus_phage	1.7e-239	96.4
WP_000312163.1\|3646373_3647315_-	DnaD domain protein	D2XR43	Bacillus_phage	1.0e-137	85.0
WP_000857132.1\|3647597_3647882_-	hypothetical protein	D2XR42	Bacillus_phage	1.5e-44	93.6
WP_000215308.1\|3648063_3648285_-	hypothetical protein	NA	NA	NA	NA
WP_000537281.1\|3648297_3648885_-	hypothetical protein	D2XR41	Bacillus_phage	4.7e-109	100.0
WP_001274341.1\|3648926_3649136_-	hypothetical protein	D2XR40	Bacillus_phage	1.9e-28	92.8
WP_000405111.1\|3649171_3649363_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000172328.1\|3649532_3649952_+	helix-turn-helix transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	5.2e-33	54.5
WP_001021824.1\|3649966_3650401_+	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	1.6e-61	79.6
WP_148313026.1\|3650437_3651238_+	ribonuclease	NA	NA	NA	NA
WP_000377617.1\|3651220_3651403_-	hypothetical protein	D2XR40	Bacillus_phage	6.7e-14	62.1
WP_000286211.1\|3651565_3653116_+	recombinase family protein	D2XR37	Bacillus_phage	9.9e-223	85.8
WP_033687796.1\|3653100_3654201_-	sporulation protein YhbH	A0A140HLI1	Bacillus_phage	8.3e-22	44.1
WP_000353280.1\|3654646_3656542_-	PrkA family serine protein kinase	A0MN77	Thermus_phage	9.0e-101	36.2
3663334:3663352	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3865233 : 3873610

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088592.1\|3865233_3865821_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1
WP_001262436.1\|3865817_3866858_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000879029.1\|3866964_3868380_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_000055577.1\|3868364_3870584_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000666779.1\|3870567_3871251_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278820.1\|3871247_3871502_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170542.1\|3871494_3872214_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000625683.1\|3872302_3873610_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3

DBSCAN-SWA_8

3905396 : 3913345

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000719243.1\|3905396_3906902_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.2e-32	30.8
WP_000929883.1\|3906885_3907587_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_000833093.1\|3907731_3909057_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_000743898.1\|3909441_3910980_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.4e-21	31.2
WP_001029999.1\|3911387_3913022_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000917306.1\|3913060_3913345_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009606

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009603

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP009605

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection