CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP010581	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence	0 crisprs	NA	0	0	6
NZ_CP010582	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB51, complete sequence	0 crisprs	NA	0	0	0
NZ_CP010579	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB92, complete sequence	0 crisprs	cas14j,RT	0	0	1
NZ_CP010583	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB48, complete sequence	0 crisprs	NA	0	0	0
NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	1 crisprs	RT,cas14j,csa3	1	1	1
NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	1 crisprs	csa3	0	2	0
NZ_CP010577	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 chromosome, complete genome	4 crisprs	cas3,cas14k,csa3,WYL,c2c9_V-U4,DinG,RT,DEDDh	0	3	11

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8138 : 84811

Bacillus_phage(33.33%)

transposase,integrase

attL 22160:22177|attR 72079:72096

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044798485.1\|8138_8852_-\|transposase	transposase	NA	NA	NA	NA
WP_044798405.1\|12230_12458_-	hypothetical protein	NA	NA	NA	NA
WP_044798486.1\|12473_13565_-	methyltransferase	NA	NA	NA	NA
WP_175581940.1\|13667_13805_-	hypothetical protein	NA	NA	NA	NA
WP_044798410.1\|13826_14240_-	hypothetical protein	NA	NA	NA	NA
WP_044798403.1\|15190_16993_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_044798473.1\|17218_18817_-	S-layer homology domain-containing protein	A0A1J0MS59	Bacillus_phage	2.7e-45	57.5
WP_000282327.1\|19434_20628_-	DUF4046 domain-containing protein	NA	NA	NA	NA
22160:22177	attL	NA	NA	NA	NA
WP_000440576.1\|22898_24626_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044798401.1\|24953_26087_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D9J0Y9	Brochothrix_phage	1.3e-160	73.8
WP_044798487.1\|27199_28909_+	hypothetical protein	NA	NA	NA	NA
WP_044798488.1\|30136_31108_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	1.6e-37	31.4
WP_016078900.1\|31138_31534_+	helix-turn-helix transcriptional regulator	A0A0A8WJ60	Clostridium_phage	6.0e-07	38.1
WP_044798489.1\|31735_32245_-	hypothetical protein	NA	NA	NA	NA
WP_000914670.1\|32967_34380_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_044798491.1\|35884_36298_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_000282360.1\|36284_36671_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_042596280.1\|36692_37064_-	hypothetical protein	NA	NA	NA	NA
WP_044798323.1\|38993_40973_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.1e-27	32.4
WP_052574930.1\|41714_42233_-	hypothetical protein	NA	NA	NA	NA
WP_044798324.1\|42248_42764_-	hypothetical protein	NA	NA	NA	NA
WP_044798325.1\|42807_43173_-	hypothetical protein	NA	NA	NA	NA
WP_044798326.1\|43247_43517_-	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_044798327.1\|43513_43897_-	hypothetical protein	NA	NA	NA	NA
WP_000757467.1\|44058_44634_-	hypothetical protein	NA	NA	NA	NA
WP_044798328.1\|45679_47503_-	maturase	A0A0U4J920	Pseudomonas_phage	3.8e-24	34.3
WP_044798329.1\|49376_53396_-	type IV secretion system protein	NA	NA	NA	NA
WP_044798330.1\|53426_55535_-	DUF87 domain-containing protein	NA	NA	NA	NA
WP_044798331.1\|55537_56452_-	hypothetical protein	NA	NA	NA	NA
WP_021728120.1\|56452_56803_-	PrgI family protein	NA	NA	NA	NA
WP_044798332.1\|56869_57289_-	hypothetical protein	NA	NA	NA	NA
WP_044798333.1\|57402_57591_-	hypothetical protein	NA	NA	NA	NA
WP_000869334.1\|57647_57851_-	hypothetical protein	NA	NA	NA	NA
WP_000502626.1\|57964_58234_+	hypothetical protein	NA	NA	NA	NA
WP_001098031.1\|58323_59259_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_044798334.1\|59370_60684_-	DUF3854 domain-containing protein	NA	NA	NA	NA
WP_052574931.1\|60673_60883_-	hypothetical protein	NA	NA	NA	NA
WP_000784045.1\|62946_63498_-	hypothetical protein	NA	NA	NA	NA
WP_044798492.1\|63551_64262_-	hypothetical protein	NA	NA	NA	NA
WP_044798336.1\|64686_65406_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_044798338.1\|66276_67047_-	ANT(4')-I family aminoglycoside nucleotidyltransferase	NA	NA	NA	NA
WP_044798340.1\|69700_70870_+	MFS transporter	NA	NA	NA	NA
WP_044798339.1\|70948_71812_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
WP_044798338.1\|75967_76738_+	ANT(4')-I family aminoglycoside nucleotidyltransferase	NA	NA	NA	NA
72079:72096	attR	NA	NA	NA	NA
WP_044798336.1\|77608_78328_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_044798410.1\|78709_79123_+	hypothetical protein	NA	NA	NA	NA
WP_175581940.1\|79144_79282_+	hypothetical protein	NA	NA	NA	NA
WP_044798486.1\|79384_80476_+	methyltransferase	NA	NA	NA	NA
WP_044798405.1\|80491_80719_+	hypothetical protein	NA	NA	NA	NA
WP_044798493.1\|80790_84081_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_044798485.1\|84097_84811_+\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010580

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010580_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010580_1

53083-53304

Orphan

Consensus_repeat	Method
TCTCAGGCTTCGTCTCAG	CRT

5 spacers

The CRISPR arrays of NZ_CP010580_1

>merge|NZ_CP010580|1|53083-53304|CRT
TTTCAGGCTTCGTCTCAGGTTTAGTCTCAGGCTTCGTCTCAGGCTTCGTCTCAGGTTTAGTCTCAGGCTTCGTCTCAGGCTTCGTCTCAGGTTTAGTTTCAGGCTTCGCCTCAGGTTTAGTCTCAGGCTTCGTCTCAGGCTTCGTCTCAGGTTTAGTCTCAGGCTTCGTCTCAGGCTTAGTTTCAGGCTTCGTCTCAGGTTTAGTCTCAGGCTTAGTTTCAG

>NZ_CP010580|1|1|53083-53304|CRT
TTTCAGGCTTCGTCTCAG	GTTTAGTCTCAGGCTTCG
TCTCAGGCTTCGTCTCAG	GTTTAGTCTCAGGCTTCG
TCTCAGGCTTCGTCTCAG	GTTTAGTTTCAGGCTTCGCCTCAGGTTTAG
TCTCAGGCTTCGTCTCAG	GCTTCGTCTCAGGTTTAG
TCTCAGGCTTCGTCTCAG	GCTTAGTTTCAGGCTTCGTCTCAGGTTTAG
TCTCAGGCTTAGTTTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010580.1\|WP_044798519.1\|48864_49143_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_000364598.1\|55896_56421_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_044798530.1\|58629_58872_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP010580.1\|WP_044798525.1\|51102_51729_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP010580.1\|WP_044798522.1\|49799_50039_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_044798528.1\|56479_57607_-\|S-layer-homology-domain-containing-protein	unknown	unknown	gnl\|CDD\|306825
NZ_CP010580.1\|WP_012552622.1\|59791_60094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_043897570.1\|48157_48571_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_017154153.1\|50489_50744_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_044798518.1\|46489_48028_+\|PcfJ-domain-containing-protein	unknown	unknown	gnl\|CDD\|379539
NZ_CP010580.1\|WP_044798521.1\|49192_49720_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_044798531.1\|60979_61432_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_044798524.1\|50800_50989_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_001008787.1\|52249_52588_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_012552610.1\|59128_59302_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_044798529.1\|57633_58599_-\|DUF3895-domain-containing-protein	unknown	unknown	gnl\|CDD\|372438
NZ_CP010580.1\|WP_000064262.1\|54165_54570_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379188
NZ_CP010580.1\|WP_044798523.1\|50249_50435_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_048558683.1\|58855_59053_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010580.1\|WP_000453241.1\|60669_60918_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010580.1\|WP_044798525.1\|51102_51729_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.74739e-29
NZ_CP010580.1\|WP_000064262.1\|54165_54570_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	2.37212e-08
NZ_CP010580.1\|WP_044798528.1\|56479_57607_-\|S-layer-homology-domain-containing-protein	gnl\|CDD\|306825	pfam00395, SLH, S-layer homology domain.	9.26741e-09
NZ_CP010580.1\|WP_044798529.1\|57633_58599_-\|DUF3895-domain-containing-protein	gnl\|CDD\|372438	pfam13034, DUF3895, Protein of unknown function (DUF3895). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 110 amino acids in length. There are two completely conserved residues (Y and L) that may be functionally important.	8.928e-06
NZ_CP010580.1\|WP_044798530.1\|58629_58872_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	3.03536e-07
NZ_CP010580.1\|WP_044798518.1\|46489_48028_+\|PcfJ-domain-containing-protein	gnl\|CDD\|379539	pfam14284, PcfJ, PcfJ-like protein. The PcfJ-like protein family includes the E. faecalis PcfJ protein, which is functionally uncharacterized. It is found in bacteria and viruses, and is typically between 159 and 170 amino acids in length. There is a conserved HCV sequence motif.	2.20275e-07

>NZ_CP010580.1|WP_001008787.1|52249_52588_-|hypothetical-protein
MNFFFALIGYFILSTLLLLLFYIYSKQTDKKTRYLKALLSSLLGLIASIILIVVYKFNQDTINFTYGKIKDNYLDGLQGDIFSYNFSDNTLLIIISIITFIFFFYVGRKSSK
>NZ_CP010580.1|WP_044798525.1|51102_51729_-|recombinase-family-protein
MEHKIFGYVRISTDDQNEGRQIEKMKELGIMERDIIIDKKTGTNMDRENYQMLKHHLVRSGDTIVFDSLTRLGRNMENTLEEYKFFENNKINLKFIEEPYINLIHTDDHTTNDIIQVAIKKSTLTVLSAFAQKEREDTHKRQAEGIALARKNGKHLGRPAIPITDDFIKSYNRWKAGEITAVKAMAECNLKKDTFYKLAKKYQQELTK
>NZ_CP010580.1|WP_044798524.1|50800_50989_-|hypothetical-protein
MLKMGDKVVMHTCGEAQHYDGKVWTCTTDEFVRGEGVYTQNLVFLEGFSGCFLAKYLQKVIL
>NZ_CP010580.1|WP_017154153.1|50489_50744_-|hypothetical-protein
MAIEAHKCNVKGCNGLVVFENADFDLQNPETIKGVYALDDPTCNVCGKEFLVVPSYSVIDLDVETQEFEEIEPACITEWQNQKF
>NZ_CP010580.1|WP_044798523.1|50249_50435_-|hypothetical-protein
MNSHGGKRKGSGRPSMGVTKKVSVNLPEEVWDLIERECEDENKKLAQVFREAILKKYSKEN
>NZ_CP010580.1|WP_044798522.1|49799_50039_-|hypothetical-protein
MSNVLLKLTTDEPILPQYKRKNNPIKKLFISFINHYDRLNRWFGIQDSKSDQVWYYGTLFLMIFLPSVTYVLSKLYFGF
>NZ_CP010580.1|WP_044798521.1|49192_49720_-|hypothetical-protein
MKYCAYCGEKILTNPEQDLTKLKCTYCDAKLYDTKNRVLKIYDGNSRFKFNNLQKTVSLDDAKGSVEFLKSYNIFDLYLLLKEVREARSGHYTTFNIFKEASKCSKATKEDAKQFYKLSQTERQAYVYWTRRQCIIENILIEKQGFFPEAITQELLHEKYEQILKSKNRRMVLSN
>NZ_CP010580.1|WP_044798519.1|48864_49143_-|hypothetical-protein
MKIPFNTHTIYVTLDDDKIYELKSDYTKVEVSKIQNSSKESPVMVLHKSQFDFAKGYLLNKENPFKIDEEDAKTYQQIGFISVEELNEFIIV
>NZ_CP010580.1|WP_043897570.1|48157_48571_+|hypothetical-protein
MDAFSNERNVHFFKKGEIHVSKLDKQLIGFSEEQVFKLGYDVLTDSILIIRRFSSLIMNPSYIEIIDITHSQVISWISMISNSIHNISDHIKRKDSNYLREEIAKALRVLYSIQQYDEKLKCLVPISTANIDSNFSK
>NZ_CP010580.1|WP_044798518.1|46489_48028_+|PcfJ-domain-containing-protein
MKKHFPKKRVLLECIIQDEDLNYEEITKCFCPRCSETLLLAEPCEKRYGYRCPICKVGFKHYMDRGQYRDYIVMFSKIYDEDNKIRWSICLSEWSFLGRDKPIYKKFYYKLVYNKESKQLYIFTKTPKGKKTKVSPISNGAIAKWVNRDHFDTILKDKNYKHYMNRLKKELPNWMQNKEIDFYNFVSLIRYPVLMNLPHLSHFPLGRCTRLISPVVKNKLLKCEESIYSLFQELHGFKPTKSEIKIITENSLNLVMYPILKRIIKDNNHVVNVLKSMSEWKNTDCFSLSQFYFKYFLNPKCRMKECNLLINLQVIRGLYDSETAFVRAMINTIHGVRSYERLEMYILHSVMYLTEHEFEDNHGIFRNARDFQTIHDSLMRMDSYLHLCGKKFHYSEDEILKFEKEMKGFKFILPKSGEDLYKVHCDLRLCVDLYAGYISNGRGYLIFLENVTKNKIEYCLEINNKNQLRQAKAFCNQYPSSNVANIIAEYCKGIRVSIATNDLSSYESLSVS
>NZ_CP010580.1|WP_000064262.1|54165_54570_+|helix-turn-helix-transcriptional-regulator
MSNEQNQISHKKDRKNSTKSIDQRLEKLEMTLKLLDISFDELVGLVTYYRAEKQKSDEPMERSGQLKWNLDKLMLEMNLNIDQVATIVGLHRNQIGKIKNHDFKRTDLKTIERISKGLNVSLDELFRYEKDDSV
>NZ_CP010580.1|WP_000364598.1|55896_56421_-|hypothetical-protein
MDLKTDEFFKEDIINLKDTTHQNNEVVFFCEIGEYRLEVQVIRKDHEDCFLQVYKKNNIEIDVPMWLSPTIINFEVRKQRWKDLISVINRLEDISFEIKETDELSNEFKIVARNQPIIVMKENEYKEYQKIIEELNIRNVKVIEKSVRVIEETSELDNKFKIIEGEQLVKVIKP
>NZ_CP010580.1|WP_044798528.1|56479_57607_-|S-layer-homology-domain-containing-protein
MKHKLLKTTTAFSIMGSMFFGASLSSAETPVFKDVPANHWSTEAINDLGSKQIFLGYGNGIFGFGDNVTRGQVARMLYNFLKPADVDGSFRSSFSDIRGHMFEKEIKALEKAGIMNGYGNGTFGAENILTREQLASVLTKAFKLKPKSMTTFDDVEKNYWATDSISAVQSNGISIGMGNNTFEPKTLVKREQYVQFLYNTMKKQPDHNGNNNENNNGNNNGNNNENNNGNNNGNNNDEVNSPYYVAPPKESSENSALRQKLGNYGSYTGVKKSYFDSLNQDIASGKITEEDAKVKAGTLEPWEDAKIPSFLPKGTKVAVESVNIQKFNTSSNDYKVIDKMIQKDYGGTYFGINVYWNAETKQNTVSVLHVQFIYQ
>NZ_CP010580.1|WP_044798529.1|57633_58599_-|DUF3895-domain-containing-protein
MVAKYLTQTERDILFKELSNVQQEYLTNFLKRGKKTAFASILAQQKGEGSEADYKHISTNWRLVDYIDAGVVTETLKCECGRSLRYQYIVKNLKTNKILKFGKSHFEEHTNIPAEIVKQVIEGMTKIDYELDEILIKLRNNWSLENNEGIQLPLNIEIPRDIKEHLELKLPLLDKQVNKLIGILSEHNKHETSLQSVEFNNTEPNQISLFDEVMTLGIEQGFNTKPFYNKVLHNFLTESEKSFIKSFIQQHEIISTRQLCEFLIEHKGSNTKRYLSGKPLIYPYVANYLENLEYEGLVFFGENIDYRDKTFISICYNIQMV
>NZ_CP010580.1|WP_044798530.1|58629_58872_-|helix-turn-helix-domain-containing-protein
MNWKFSSKEEMENFIKNEVLTTSEVAEILGIGRDRVNRLIREGKLKPLKKVGSVCLFMRSYILEKELEYKKLRLKYRPYD
>NZ_CP010580.1|WP_048558683.1|58855_59053_-|hypothetical-protein
MKNINTLKINKTDSGILLTSILYLATMDLGKVDKFDLVVISMIGLYMVLRTINFFLGRDTDELEI
>NZ_CP010580.1|WP_012552610.1|59128_59302_-|hypothetical-protein
MIEIATKVVVFIASLLGIINVSLDIHTKIKAKAKARKKAKKKTTKQKKCQRKERKHR
>NZ_CP010580.1|WP_012552622.1|59791_60094_-|hypothetical-protein
MIKLKGLNAEEYATIKEMAKKELSFKVNIRQWKRKYAYNAIDIRPTKKDDYKFTKEQLDEVYNFMKRHNLRTMGKNYFETSSNYYIIFNQGVTFVYKVVQ
>NZ_CP010580.1|WP_000453241.1|60669_60918_-|hypothetical-protein
MEVKNKLENIIWHIKTNRVVLGDKRTLNDVLVALENMVEEKVIVAPVDDVILQSHQFTKQLGVVTSVLKEVRKSNIKEIENL
>NZ_CP010580.1|WP_044798531.1|60979_61432_-|hypothetical-protein
MGVTWTYFKQFEIVKHEENDFNEMIRYFDQDELRFTYTTSGTLRAVFANYGIHIPIYSQFEPPNSTKLELVSPEDLVHACEDAIKVLKEGINPELKGFDGEKSLLWELDDLDGRNGGSRTIVELNARIIDELQRIKSISSQGYYIIENEQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53173-53202	0	1.0
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53257-53286	0	1.0
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53257-53286	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	67285-67314	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	81454-81483	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	13550-13579	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP004868	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence	81352-81381	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NC_020239	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence	75926-75955	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	7886-7915	2	0.933
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP007614	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence	12647-12676	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53293-53322	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53113-53142	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53149-53178	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53173-53202	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53209-53238	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	67201-67230	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	67285-67314	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_017202	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT127, complete sequence	126035-126064	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	81370-81399	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	81454-81483	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	13466-13495	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	13550-13579	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004868	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence	81268-81297	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004868	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence	81352-81381	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020393	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence	101228-101257	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP021063	Bacillus thuringiensis strain ATCC 10792 plasmid poh2, complete sequence	65828-65857	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020239	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence	75842-75871	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020239	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence	75926-75955	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_014937	Bacillus thuringiensis CT43 plasmid pBMB0558, complete sequence	83184-83213	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	7886-7915	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	7970-7999	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP007614	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence	12647-12676	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP007614	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence	12731-12760	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	CP020756	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-17, complete sequence	72434-72463	2	0.933
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53233-53262	3	0.9
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53293-53322	4	0.867
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53077-53106	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53077-53106	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53101-53130	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53137-53166	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010580	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence	53197-53226	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	67213-67242	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_017202	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT127, complete sequence	126047-126076	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	81382-81411	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	13478-13507	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004868	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence	81280-81309	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020393	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence	101240-101269	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP021063	Bacillus thuringiensis strain ATCC 10792 plasmid poh2, complete sequence	65840-65869	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020239	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence	75854-75883	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_014937	Bacillus thuringiensis CT43 plasmid pBMB0558, complete sequence	83172-83201	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	7958-7987	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP007614	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence	12719-12748	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	CP020756	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-17, complete sequence	72422-72451	4	0.867
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	67309-67338	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_017202	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT127, complete sequence	126095-126124	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	81478-81507	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	13574-13603	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP004868	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence	81376-81405	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020393	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence	101288-101317	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP021063	Bacillus thuringiensis strain ATCC 10792 plasmid poh2, complete sequence	65888-65917	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_020239	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence	75950-75979	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NC_014937	Bacillus thuringiensis CT43 plasmid pBMB0558, complete sequence	83124-83153	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	7862-7891	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP007614	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence	12623-12652	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	CP020756	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-17, complete sequence	72374-72403	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP026693	Nostoc sp. 'Lobaria pulmonaria (5183) cyanobiont' strain 5183 plasmid pNLP1, complete sequence	48383-48412	6	0.8
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	260114-260143	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010110	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence	45114-45143	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010110	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence	45168-45197	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010110	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence	45330-45359	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010110	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence	45384-45413	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010092	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence	34207-34236	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010092	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence	34234-34263	7	0.767
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010092	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence	34369-34398	7	0.767
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	NC_025829	Shigella phage pSs-1, complete genome	121291-121320	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	MK962750	Shigella phage CM8, complete genome	117657-117686	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	KR269718	Escherichia phage HY03, complete genome	51599-51628	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	MT179807	Escherichia phage vB_EcoM_IME537, complete genome	26890-26919	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	KX452694	UNVERIFIED: Escherichia phage KPN1 genomic sequence	108202-108231	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	KX452698	UNVERIFIED: Shigella phage KPN5 genomic sequence	120526-120555	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	MH992510	Escherichia phage vB_EcoM_DalCa, complete genome	116206-116235	8	0.733
NZ_CP010580_1	1.3\|53173\|30\|NZ_CP010580\|CRT	53173-53202	30	MN994497	Phage NBEco003, complete genome	50240-50269	8	0.733
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010092	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence	34288-34317	8	0.733
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010092	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence	34342-34371	8	0.733
NZ_CP010580_1	1.5\|53257\|30\|NZ_CP010580\|CRT	53257-53286	30	NZ_CP010092	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence	34504-34533	8	0.733

1. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 0, identity: 1.0

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtttcaggcttcgcctcaggtttag	Protospacer
******************************

2. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 0, identity: 1.0

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttagtttcaggcttcgtctcaggtttag	Protospacer
******************************

3. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gcttagtttcaggcttcgtctcaggtttag	Protospacer
*.****************.***********

4. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

5. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

6. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

7. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP004868 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

8. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NC_020239 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

9. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

10. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP007614 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence) position: , mismatch: 2, identity: 0.933

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*******.**********.***********

11. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttagtttcaggcttcgtctcaggtttca	Protospacer
**************************** .

12. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

13. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

14. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtttcaggcttcgcctcaggtttag	Protospacer
*.****************.***********

15. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

16. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

17. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

18. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_017202 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT127, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

19. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

20. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

21. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

22. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

23. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004868 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

24. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004868 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

25. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020393 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

26. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP021063 (Bacillus thuringiensis strain ATCC 10792 plasmid poh2, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

27. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020239 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

28. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020239 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

29. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_014937 (Bacillus thuringiensis CT43 plasmid pBMB0558, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

30. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

31. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

32. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP007614 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggtttag	Protospacer
*.*****.**********************

33. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP007614 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

34. spacer 1.5|53257|30|NZ_CP010580|CRT matches to CP020756 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-17, complete sequence) position: , mismatch: 2, identity: 0.933

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttcgtctcaggcttcgtctcaggtttag	Protospacer
**** **.**********************

35. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 3, identity: 0.9

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttag	Protospacer
*.*****.*****************.****

36. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 4, identity: 0.867

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
gcttagtttcaggcttcgtctcaggtttca	Protospacer
*.****************.********* .

37. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 4, identity: 0.867

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cttgtgtttcaggcttcgtctcaggtttag	Protospacer
 **  *************.***********

38. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
cttgtgtttcaggcttcgtctcaggtttag	Protospacer
 .*  *************************

39. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

40. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

41. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010580 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB76, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

42. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

43. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_017202 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT127, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

44. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

45. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

46. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004868 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

47. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020393 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

48. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP021063 (Bacillus thuringiensis strain ATCC 10792 plasmid poh2, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

49. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020239 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

50. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_014937 (Bacillus thuringiensis CT43 plasmid pBMB0558, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

51. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

52. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP007614 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

53. spacer 1.5|53257|30|NZ_CP010580|CRT matches to CP020756 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-17, complete sequence) position: , mismatch: 4, identity: 0.867

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gtttagtctcaggcttcgtctcaggcttcg	Protospacer
*.*****.*****************.** *

54. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

55. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_017202 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT127, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

56. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

57. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

58. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP004868 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB94, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

59. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020393 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

60. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP021063 (Bacillus thuringiensis strain ATCC 10792 plasmid poh2, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

61. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_020239 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pHT77, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

62. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NC_014937 (Bacillus thuringiensis CT43 plasmid pBMB0558, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

63. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

64. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP007614 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

65. spacer 1.5|53257|30|NZ_CP010580|CRT matches to CP020756 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-17, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggtttagtctcaggtttag	Protospacer
 .*. ********.** *************

66. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP026693 (Nostoc sp. 'Lobaria pulmonaria (5183) cyanobiont' strain 5183 plasmid pNLP1, complete sequence) position: , mismatch: 6, identity: 0.8

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttagtttcaggcttcgtttcataatcaa	Protospacer
*******************.*** . *.*.

67. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
gcttagtttcaggcttagtttcataatcaa	Protospacer
**************** **.*** . *.*.

68. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010110 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggcttct	Protospacer
 **. *********** ********.**

69. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010110 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggcttct	Protospacer
 **. *********** ********.**

70. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010110 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggcttct	Protospacer
 **. *********** ********.**

71. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010110 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-4, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggcttct	Protospacer
 **. *********** ********.**

72. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010092 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggcttct	Protospacer
 **. *********** ********.**

73. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010092 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggcttct	Protospacer
 **. *********** ********.**

74. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010092 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence) position: , mismatch: 7, identity: 0.767

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tctctgtttcaggcttagtctcaggctttt	Protospacer
 **. *********** ********.**

75. spacer 1.3|53173|30|NZ_CP010580|CRT matches to NC_025829 (Shigella phage pSs-1, complete genome) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

76. spacer 1.3|53173|30|NZ_CP010580|CRT matches to MK962750 (Shigella phage CM8, complete genome) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

77. spacer 1.3|53173|30|NZ_CP010580|CRT matches to KR269718 (Escherichia phage HY03, complete genome) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

78. spacer 1.3|53173|30|NZ_CP010580|CRT matches to MT179807 (Escherichia phage vB_EcoM_IME537, complete genome) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

79. spacer 1.3|53173|30|NZ_CP010580|CRT matches to KX452694 (UNVERIFIED: Escherichia phage KPN1 genomic sequence) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

80. spacer 1.3|53173|30|NZ_CP010580|CRT matches to KX452698 (UNVERIFIED: Shigella phage KPN5 genomic sequence) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

81. spacer 1.3|53173|30|NZ_CP010580|CRT matches to MH992510 (Escherichia phage vB_EcoM_DalCa, complete genome) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

82. spacer 1.3|53173|30|NZ_CP010580|CRT matches to MN994497 (Phage NBEco003, complete genome) position: , mismatch: 8, identity: 0.733

gtttagtttcaggcttcgcctcaggtttag	CRISPR spacer
cagaagtttcaggtttggcctcaggttgat	Protospacer
    *********.** ********** *

83. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010092 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence) position: , mismatch: 8, identity: 0.733

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggcttagtctcaggctttt	Protospacer
 .*. *********** ********.**

84. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010092 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence) position: , mismatch: 8, identity: 0.733

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggcttagtctcaggctttt	Protospacer
 .*. *********** ********.**

85. spacer 1.5|53257|30|NZ_CP010580|CRT matches to NZ_CP010092 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB126, complete sequence) position: , mismatch: 8, identity: 0.733

gcttagtttcaggcttcgtctcaggtttag	CRISPR spacer
tttctgtttcaggcttagtctcaggctttt	Protospacer
 .*. *********** ********.**

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP010581

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1971

Lactococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|675_1971_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0

DBSCAN-SWA_2

9170 : 9428

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044798560.1\|9170_9428_+	hypothetical protein	A0A1B1P771	Bacillus_phage	2.1e-21	94.3

DBSCAN-SWA_3

23980 : 25474

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044798574.1\|23980_25474_+	C40 family peptidase	A0A0A8WIF2	Clostridium_phage	1.4e-24	29.6

DBSCAN-SWA_4

47541 : 48468

Brevibacillus_phage(100.0%)

integrase

attL 46655:46669|attR 52530:52544

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
46655:46669	attL	NA	NA	NA	NA
WP_044798598.1\|47541_48468_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.2e-36	34.2
WP_044798598.1\|47541_48468_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.2e-36	34.2
52530:52544	attR	NA	NA	NA	NA

DBSCAN-SWA_5

57097 : 58204

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044798604.1\|57097_58204_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.9e-90	48.3

DBSCAN-SWA_6

63065 : 67720

Bacillus_phage(100.0%)

transposase,integrase

attL 56778:56792|attR 67275:67289

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
56778:56792	attL	NA	NA	NA	NA
WP_024086119.1\|63065_63329_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A125RQ76	Bacillus_phage	3.4e-43	100.0
WP_024086118.1\|63297_63555_-	hypothetical protein	A0A125RQ77	Bacillus_phage	1.4e-41	100.0
WP_024086117.1\|63710_64631_+\|integrase	tyrosine-type recombinase/integrase	A0A0A7AR08	Bacillus_phage	3.6e-172	100.0
WP_044797901.1\|64702_67720_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	0.0e+00	99.9
67275:67289	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP010577

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010577_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010577_1

610049-610124

Orphan

Consensus_repeat	Method
ATCATCATCATGGAGGACACAATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010577_1

>merge|NZ_CP010577|1|610049-610124|CRISPRCasFinder
ATCATCATCATGGAGGACACAATCATGGTGGGCACAATCATAACGGCGGACATCATCACCATGGAGGACACAATCA

>NZ_CP010577|1|1|610049-610124|CRISPRCasFinder
ATCATCATCATGGAGGACACAATCA	TGGTGGGCACAATCATAACGGCGGAC
ATCATCACCATGGAGGACACAATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010577.1\|WP_042597096.1\|619463_620633_-\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP010577.1\|WP_000885973.1\|601695_602427_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP010577.1\|WP_044797800.1\|607247_608141_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP010577.1\|WP_000743028.1\|608268_609798_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|171510
NZ_CP010577.1\|WP_000095903.1\|602640_603831_+\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893
NZ_CP010577.1\|WP_044797799.1\|604900_605323_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NZ_CP010577.1\|WP_001248845.1\|605360_607244_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226921
NZ_CP010577.1\|WP_000723120.1\|603875_604841_+\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|187580
NZ_CP010577.1\|WP_000513938.1\|615285_616713_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP010577.1\|WP_000387172.1\|623435_624896_+\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP010577.1\|WP_016078614.1\|622304_623276_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|225213
NZ_CP010577.1\|WP_042597095.1\|618420_619548_-\|Ger(x)C-family-spore-germination-protein	unknown	unknown	gnl\|CDD\|274338
NZ_CP010577.1\|WP_000760052.1\|599771_600830_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP010577.1\|WP_000193671.1\|620613_622116_-\|spore-germination-protein	unknown	unknown	gnl\|CDD\|377020
NZ_CP010577.1\|WP_042597094.1\|600842_601664_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP010577.1\|WP_000925213.1\|598770_599775_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP010577.1\|WP_000448446.1\|612582_613980_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129983
NZ_CP010577.1\|WP_000893348.1\|610847_612551_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP010577.1\|WP_000656106.1\|616726_618388_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP010577.1\|WP_000987242.1\|614432_615143_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116

Protein	Function_ID	Function_description	E-value
NZ_CP010577.1\|WP_042597096.1\|619463_620633_-\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	1.57737e-39
NZ_CP010577.1\|WP_000885973.1\|601695_602427_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.07831e-20
NZ_CP010577.1\|WP_044797800.1\|607247_608141_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	1.7177e-37
NZ_CP010577.1\|WP_000743028.1\|608268_609798_-\|cardiolipin-synthase	gnl\|CDD\|171510	PRK12452, PRK12452, cardiolipin synthase.	0
NZ_CP010577.1\|WP_000095903.1\|602640_603831_+\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NZ_CP010577.1\|WP_044797799.1\|604900_605323_+\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	1.27929e-24
NZ_CP010577.1\|WP_001248845.1\|605360_607244_-\|VWA-domain-containing-protein	gnl\|CDD\|226921	COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism].	1.51306e-97
NZ_CP010577.1\|WP_000723120.1\|603875_604841_+\|L-threonine-3-dehydrogenase	gnl\|CDD\|187580	cd05272, TDH_SDR_e, L-threonine dehydrogenase, extended (e) SDRs. This subgroup contains members identified as L-threonine dehydrogenase (TDH). TDH catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. This group is distinct from TDHs that are members of the medium chain dehydrogenase/reductase family. This group has the NAD-binding motif and active site tetrad of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP010577.1\|WP_000513938.1\|615285_616713_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP010577.1\|WP_000387172.1\|623435_624896_+\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
NZ_CP010577.1\|WP_016078614.1\|622304_623276_+\|phosphotransferase	gnl\|CDD\|225213	COG2334, COG2334, Putative homoserine kinase type II (protein kinase fold) [General function prediction only].	5.26171e-33
NZ_CP010577.1\|WP_042597095.1\|618420_619548_-\|Ger(x)C-family-spore-germination-protein	gnl\|CDD\|274338	TIGR02887, Spore_germination_protein_B3, germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc. [Transport and binding proteins, Amino acids, peptides and amines, Cellular processes, Sporulation and germination].	1.09702e-88
NZ_CP010577.1\|WP_000760052.1\|599771_600830_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	8.98999e-88
NZ_CP010577.1\|WP_000193671.1\|620613_622116_-\|spore-germination-protein	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
NZ_CP010577.1\|WP_042597094.1\|600842_601664_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	6.0702e-132
NZ_CP010577.1\|WP_000925213.1\|598770_599775_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.49512e-87
NZ_CP010577.1\|WP_000448446.1\|612582_613980_-\|amino-acid-permease	gnl\|CDD\|129983	TIGR00905, Arginine/ornithine_antiporter, transporter, basic amino acid/polyamine antiporter (APA) family. This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines].	1.33606e-97
NZ_CP010577.1\|WP_000893348.1\|610847_612551_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	2.99317e-109
NZ_CP010577.1\|WP_000656106.1\|616726_618388_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP010577.1\|WP_000987242.1\|614432_615143_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.60325e-130

>NZ_CP010577.1|WP_000743028.1|608268_609798_-|cardiolipin-synthase
MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFPGKEISHAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEKDFKHSTEIKWNSFQNRSIKKRILESFMRLISPLL
>NZ_CP010577.1|WP_044797800.1|607247_608141_-|MoxR-family-ATPase
MLEQFHIHSDLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSIIEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTIQTKDGASEVSFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQEVVYGDEEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLNDVATIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDETEQMTVRELAESYFFEG
>NZ_CP010577.1|WP_001248845.1|605360_607244_-|VWA-domain-containing-protein
MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIEKKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQLFVLLEDLRVEEIVKNLRPGTKHIFKRRKEMYRNYFGSQNEINRVRNYHGDRLFCLCYLSLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYVVEKIRYRLEALLESDMLNNYFGHAPLYLSVLADEKNCRVEDLANDDTQLIDDDENKNKMDESFSTWHRENKNNENENFLRFELESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQHDGAYGKYNVGASHTFKEARKANIDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDKYYGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFHEALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVNYKNSTLPNVGPEIMQLREEEDNRDGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIGIFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE
>NZ_CP010577.1|WP_044797799.1|604900_605323_+|NUDIX-hydrolase
MQRVDVVYALIHDEETDKILMVHNAEQNVWSLPGGAVEKGEILEEALIREVKEETGLIATLGGLVAINEKFFEESGNHALFFTFRANVVKGELIAEDEGEISAIEWVDRTIANERFPYCDGGFESLLEVAIPYKFQPETK
>NZ_CP010577.1|WP_000723120.1|603875_604841_+|L-threonine-3-dehydrogenase
MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVKSGPFETLDVTDGQKLHDIAKHNEVDTIIHLAALLSATAEKNPLFAWNLNMGGLVNALEAARELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPTTMYGVNKVAGELLCDYYHQKFGVDTRGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKGAYTSYIAEGTYMDMMYMPDALQAIISLMEADPSKLVHRNAFNITAMSFEPEQIAASIRKHIPTFTMDYAVDSARQTIADSWPNSIDATAAMKEWGFKAEYDLDKMTTDMLAKLKKKLTAELVMN
>NZ_CP010577.1|WP_000095903.1|602640_603831_+|glycine-C-acetyltransferase
MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYINLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQKAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKGAGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTALTPADAAACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEFSKRLNEEGVYAKSIVFPTVAKGKGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII
>NZ_CP010577.1|WP_000885973.1|601695_602427_-|class-I-SAM-dependent-methyltransferase
MAFTESDVYNNTAFFEQYMKRRYRENSPNESIEKPVFFQLIGHVQGKQILDLGCGDAKFGAELLEKGCYSYTGIEGSELMYEKAKNQLENKNGSVHFLNLKDYTYPSSTFDLVTSRLALHYIEHLDTIFQNVFQTLKTNGTFTFSVQHPVITSSFESLQTSGKRTSWLVDDYFKLGKRVEPWIDQEVIKYHRTTEEYFTLLQQAGFTITSLKEATPNPIYFQNEEEYKRRLRIPLFLLFSCTK
>NZ_CP010577.1|WP_042597094.1|600842_601664_+|ABC-transporter-ATP-binding-protein
MQKALETKRLTLSYGETSIIDELNLEIQKGEITIFIGSNGCGKSTLLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRYPYQTWLKQWSEKDEEMVQKALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIILLDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQGKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGRGRRVVKEVAQAIR
>NZ_CP010577.1|WP_000760052.1|599771_600830_+|iron-ABC-transporter-permease
MKKYIPFRIGKGELSFLMYKRACLVLLSLLLVLIGLFFASAGMGDMKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLASPDIIGITGGASVAVVLFLALFSDKNNALTVSIHYMPLAAFAGATIVAVFVYLFAWQNDGLSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWVLILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRVFMLLLSTALIGGAVAFAGGIGFVGLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTIFTPLEIPAGVFTSAIGAPYFIYLLYKSRNS
>NZ_CP010577.1|WP_000925213.1|598770_599775_+|iron-ABC-transporter-permease
MLLKTNRAKGIGLFVGIIAVVICIWGSIIFGYTNTSWKLALDAFFHFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFFIVVAIVIFSVTSLSAFTWIAFLGAAVAAVLVFASSSLGKEGTTPLKLTLAGVAISALFSSLTQGLLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASLIMAGKVNTLMMGEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIITPHFARFLVGVDHRWRVPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK
>NZ_CP010577.1|WP_000893348.1|610847_612551_+|EAL-domain-containing-protein
MLEQRGHALYDSSLRDLKLALDESSIVAITDRKGLITYVNDKFCEISKYKREELIGKDHRILNSGHHPKTFFQNLWKRILNGKVWTGEIRNRAKDGTYYWVKTTIVPFLNEKGEPYQFIAIRNDISSRKEAEHRLRLSESRYRELAYHDALTSLPNRLQLITTVNKLIADKKEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGGDEFVLLTKNHRQDDMSQLATSVLSCFQAPFMLEGHEVYISASLGLCSYPQDGLDVETLLKNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKVEFALQKAIRDEELDVALQPIIDLKTKRYSGIEALVRCMTEDGPIAPSEFIPVAEESGLIIKLGDWVLEKSCRLFKTLPNYQEGLKLSVNLSIQQLMQKRFILSVRSILKRTGFPPNRLILEITESIAVRHFDYIIATLQELRNMGVLIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAHSLNLAVVAEGVETVEQESLLQSMSCDYVQGFYYAKPLSVGELKEKLITDF
>NZ_CP010577.1|WP_000448446.1|612582_613980_-|amino-acid-permease
METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWSITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAATASVIISFAGYLSTFFPVLQSKQILFSINGFSLELGKGLTFLVCSLMLWGIQYILSQNIDRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAIATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALPQDALKESQKPLVDALNLAIGNKGAYIMALLALISLFGSTVGWIVVSSEVPYQAAKNGLFPKFFGKTNKKGSPSKSLLITNVMTQIFLFSTISGTVSEAYSFAIVVATLAYLIPYLVSTLYQFKLVITGETYDIMPGSRIKDGIITTLAFVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLMKDSQKTD
>NZ_CP010577.1|WP_000987242.1|614432_615143_+|trehalose-operon-repressor
MMSKYEQIYTEISKSIDNKQLKEGCKIPSETELMKQYEASRGTVRKAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEMDKEKATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEFIPGLTKEIATASIYKYIEKELGLHISYSQRVIEVQPCTEDDRKYLDLNGTDYVVVVKNFTHLYDGSQFEYTESRHRLDIFHFSDVARRK
>NZ_CP010577.1|WP_000513938.1|615285_616713_+|PTS-system-trehalose-specific-EIIBC-component
MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDNDKLQSVSLVKGAFHNAGIFQVVIGPGDVDRVYAELITLAGMEESTVADVKDSGNQKLNPAQKFVKIFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLGGLWDLINMMANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLEGQKIEYFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGVLALGIIGPVTRHIGDLLTVGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQLIAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGVNLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMIIAVIIPFTLTWLFAKRVKQK
>NZ_CP010577.1|WP_000656106.1|616726_618388_+|alpha,alpha-phosphotrehalase
MKDWHKSVVYQIYPKSFNSYYNKETGDIKGVTEKLDYLKELGVDYIWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLAEAKVRNIEIMLDIVVNHSSTEHKWFKEAKEDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTEQYYLHLFDETQADLNWENEQLREEVYDMMRFWLDKGVTGFRLDVINLISKDQCFLNDEGNTATSDGRKYYTDGPRVHEYLQEMNRKVFAGKDVITVGEMSSTTIDNCIKYSNPERNELSMTFSFHHLKVDYPNGDKWTKAEFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGDDGKYRNESAKMLATAMHMLQGTPYIYQGEEIGMTNPKFESIEQYRDVESLNIYDIKLKEGLSKEEIIGILKQKSRDNSRTPMQWNEEMNSGFTTSTPWISVAENFTEINVEKALEDKESVFYHYKKLIELRKTYDVITEGEYAILDKNDPKIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQLDGMKQEILLSNYKDSSNDITKLNLRPYESIVYRYTK
>NZ_CP010577.1|WP_042597095.1|618420_619548_-|Ger(x)C-family-spore-germination-protein
MCTKKTVKLCSILCASSLLSGCWDQEPLREARLAYSIGFDITEENQLQQTVELVRSSGSQQSSFENEIHSATGRNIRDTSDTLKENVTGNIRYFKYGVQLLGTKIQKKGILPYLDISFRDPTNPTALVKLISVDGETAAILEKKKVGNLLIGDFLKKKIKSLEDMSIFPNETLETAATKMLDPGKDFTLPSIKLKGKEVVTNGIALFNKDKLTGLLPSRQSVLFVLLTDKMGTSARITQKLTNSDSSNTSDYITIDVSNQKLKRNLKITTDKKGDVYAHIKLQLKVIALESPRDNLYKMDERKKLNKELSKQLTKEAKKITKKLQKANCDAFGIGRHLIAYHPNLWKKKNWNKDYAKVKFKPEVEVNILYSGVLK
>NZ_CP010577.1|WP_042597096.1|619463_620633_-|GerAB/ArcD/ProY-family-transporter
MTNTQSKISLVQLTFFVIQCQIGVGILSLPNRLHPIAKGGGWISVLIAGLATQLIILLMWFLLRRFPDANMYEIACMMFGNKFGKLLGFSYVFYFTLIGMTVMLNACTVIKIWILQATPWYAILLLFTIACCYVAYNTFKVIVRFYVMASILILPMALLIGLGLSRADFSYIFPITEAGWWNIIKASKETITAMYGFEIFLIAFPKVNGTAVAKLKAISIANGFVTLFYAFTVWICFIVFSPKQVELIPEPVAYLLRSLHIGIVDRTDLIFIPIWMITVVASIASCYAAASIGIGHIFNLANHKKSVPIVGVISFSIALFIDTPEELKLIANFTDKFTYIFIIVLPFLFLLYSLLRNKKGAPYAQKKQLNYVVSYVLAHFFLVAGIKSL
>NZ_CP010577.1|WP_000193671.1|620613_622116_-|spore-germination-protein
MTQQEEQQKSKNQKHMFPSLPENINYIENKLCHSDDIKKLDIPFQNGKGIILYIESLADPNLIHQLALEPLLTRSDLSLDKAFSTLNMKKETNLNYGVQLLLQGKSLYFHEHVESFCTFETALSLKRAITEPDNEGIVRGPHTGFVEDLATNLASIRKLIKSPNVVVKYFTLGEEMHTKVAITYIQNIANDDLVAEVKRRLEMIKTDALMPPGYIQEFIEDTSFSPFPQQLNTERPDRTAANLMEGRVAILSDGDPTALIVPVTLFAFYQSPDDYNNRWIVGSFVRMIRLVSFLIAFLLPAIYIATVAFHPDVLPLELVYTIKASLEQVPLPPIFEALLMELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAIASFLVPSNDMSSAVRILRFPLMVLAAIFGYVGISFGIIITFVHLCQLHSFHTPYLSPLAPMRIKDMKDSFVRFPIWSFWERPHDSKPKKMQRQHVTREDENGDKHAK
>NZ_CP010577.1|WP_016078614.1|622304_623276_+|phosphotransferase
MEIAVERVFTKEILRRAAKAFHVTVEEKPLGDFENYIFKAKGDNDEDYVLRLTHSSHRSKKEVEAELDFLRYVAEHGAKVAGPLNSTSQNLVEEIGAEDSTFFFASLFTYAKGEQVKGEESPYWGEAYFEAWGKAIGQLHRLTMSYPKTDYRDTWEEDESGIVNELEDDQVKKIAAVLMDEIKALPVERETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYNYFIHDLAMVLYYSILFTPWTAEEKTDFARKQLQVLRKGYEHEHRLADSWYESLPLFLRLRDVGLYGTLQKKFKGKGMPDNFRELSEELYERIIKREAIVNI
>NZ_CP010577.1|WP_000387172.1|623435_624896_+|alanine:cation-symporter-family-protein
MEAFVNWLNNIVWSPALVYLCLGVGLYFSIRTRFLQVRHVGEMVKLTFQGEKSEAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAGSAYIESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGLLLPGVQANSIAVSLETAFGINTTVSGALLVVVLAIIIFGGVKRIVNVAQVVVPFMAVGYILVACVIVAMNIEKLPEAFMLIIRSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGPHAAAAAEVSHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKNFIVNKLNGAQPGPGYTQAAVESVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWLSIVLKFVFLGAVFYGCIKTAATAWALGDIGVGIMAWVNIIAILLLQKPALVALKDYEKQKKEGKDPVFDPQPLGIKNADFWEHEYGKDKKEEVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010577_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010577_2

1195169-1195389

Orphan

Consensus_repeat	Method
GAAACATGGAATTCGATTGTTGA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP010577_2

>merge|NZ_CP010577|2|1195169-1195389|CRISPRCasFinder
GAGGTATGGAATTCAATTACAGAATTTCTAACAGGAATTTGGGAAGGTATATCCCAATGGGCAACAGAAACATGGGAAAGCATTAGTGAATCTACTTCTTCAGCATGGAATGCCATTAAAGAATTTTTAACAGAACTATGGAATGGGATCATGGAGTCTTTATCTGAAACATGGAATTCGATTGTTGAAACTACTACGGAAACATGGAATTCGATTGTTGA

>NZ_CP010577|2|2|1195169-1195389|CRISPRCasFinder
GAGGTATGGAATTCAATTACAGA	ATTTCTAACAGGAATTTGGGAAGGTATATCCCAATGGGCAACA
GAAACATGGGAAAGCATTAGTGA	ATCTACTTCTTCAGCATGGAATGCCATTAAAGAATTTTTAACA
GAACTATGGAATGGGATCATGGA	GTCTTTATCTGAAACATGGAATTCGATTGTTGAAACTACTACG
GAAACATGGAATTCGATTGTTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010577.1\|WP_044797907.1\|1210013_1211117_+\|recombinase-RecA	unknown	unknown	gnl\|CDD\|236476
NZ_CP010577.1\|WP_001016250.1\|1190301_1190559_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_024086118.1\|1200045_1200303_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_044797899.1\|1192992_1194237_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227605
NZ_CP010577.1\|WP_044797901.1\|1195880_1198898_-\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_CP010577.1\|WP_044797898.1\|1191799_1192393_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273713
NZ_CP010577.1\|WP_044797892.1\|1188500_1189085_+\|HK97-family-phage-prohead-protease	unknown	unknown	gnl\|CDD\|309640
NZ_CP010577.1\|WP_044797906.1\|1208523_1209459_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|227919
NZ_CP010577.1\|WP_024086119.1\|1200271_1200535_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
NZ_CP010577.1\|WP_044797905.1\|1208098_1208524_+\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|227161
NZ_CP010577.1\|WP_000415931.1\|1192399_1192762_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_042596912.1\|1190824_1191124_+\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|273692
NZ_CP010577.1\|WP_044797903.1\|1203278_1207667_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273743
NZ_CP010577.1\|WP_044797895.1\|1190555_1190828_+\|DNA-packaging-protein	unknown	unknown	gnl\|CDD\|130623
NZ_CP010577.1\|WP_044797896.1\|1191116_1191473_+\|HK97-gp10-family-phage-protein	unknown	unknown	gnl\|CDD\|377415
NZ_CP010577.1\|WP_044797897.1\|1191469_1191799_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_044797902.1\|1201812_1203282_+\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|188159
NZ_CP010577.1\|WP_044797904.1\|1207683_1208061_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_044797893.1\|1189101_1190286_+\|phage-major-capsid-protein	unknown	unknown	gnl\|CDD\|273690
NZ_CP010577.1\|WP_024086117.1\|1198969_1199890_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|274042

Protein	Function_ID	Function_description	E-value
NZ_CP010577.1\|WP_044797907.1\|1210013_1211117_+\|recombinase-RecA	gnl\|CDD\|236476	PRK09354, recA, recombinase A; Provisional.	0
NZ_CP010577.1\|WP_044797899.1\|1192992_1194237_+\|hypothetical-protein	gnl\|CDD\|227605	COG5280, COG5280, Phage-related minor tail protein [Function unknown].	8.95525e-32
NZ_CP010577.1\|WP_044797901.1\|1195880_1198898_-\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	1.03765e-171
NZ_CP010577.1\|WP_044797898.1\|1191799_1192393_+\|phage-tail-protein	gnl\|CDD\|273713	TIGR01603, Uncharacterized_phage_related_protein, phage major tail protein, phi13 family. This model describes a set of proteins that share low levels of sequence similarity but similar lengths and similar patterns of charged, hydrophobic, and Gly/Pro residues. All members (except one attributed to mouse embryo cDNA) belong to phage of Gram-positive bacteria. Several are identified as phage major tail proteins. Some members of this family have additional C-terminal regions of about 100 residues not included in this model. [Mobile and extrachromosomal element functions, Prophage functions].	1.59234e-34
NZ_CP010577.1\|WP_044797892.1\|1188500_1189085_+\|HK97-family-phage-prohead-protease	gnl\|CDD\|309640	pfam04586, Peptidase_S78, Caudovirus prohead serine protease. Family of Caudovirus prohead serine proteases also found in a number of bacteria possibly as the result of horizontal transfer.	1.20807e-69
NZ_CP010577.1\|WP_024086119.1\|1200271_1200535_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	6.40465e-13
NZ_CP010577.1\|WP_044797905.1\|1208098_1208524_+\|phage-holin-family-protein	gnl\|CDD\|227161	COG4824, COG4824, Phage-related holin (Lysis protein) [General function prediction only].	1.21929e-41
NZ_CP010577.1\|WP_044797903.1\|1203278_1207667_+\|phage-tail-protein	gnl\|CDD\|273743	TIGR01665, structural_protein, phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions].	2.9203e-58
NZ_CP010577.1\|WP_042596912.1\|1190824_1191124_+\|phage-head-closure-protein	gnl\|CDD\|273692	TIGR01563, hypothetical_protein_AGR_C_1752, phage head-tail adaptor, putative, SPP1 family. This family describes a small protein of about 100 amino acids found in bacteriophage and in bacterial prophage regions. Examples include gp9 of phage HK022 and gp16 of phage SPP1. This minor structural protein is suggested to be a head-tail adaptor protein (although the source of this annotation was not traced during construction of this model). [Mobile and extrachromosomal element functions, Prophage functions].	1.08419e-07
NZ_CP010577.1\|WP_044797895.1\|1190555_1190828_+\|DNA-packaging-protein	gnl\|CDD\|130623	TIGR01560, phage-related_hypothetical_protein, uncharacterized phage protein (possible DNA packaging). This model describes a small (~ 100 amino acids) protein found in phage and in putative prophage regions of a number of bacterial genomes. Members have been annotated in some cases as a possible DNA packaging protein, but the source of this annotation was not traced during construction of this model. [Mobile and extrachromosomal element functions, Prophage functions].	1.82586e-12
NZ_CP010577.1\|WP_044797906.1\|1208523_1209459_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|227919	COG5632, COG5632, N-acetylmuramoyl-L-alanine amidase [Cell envelope biogenesis, outer membrane].	5.17626e-49
NZ_CP010577.1\|WP_044797896.1\|1191116_1191473_+\|HK97-gp10-family-phage-protein	gnl\|CDD\|377415	pfam04883, HK97-gp10_like, Bacteriophage HK97-gp10, putative tail-component. This family of proteins is found in the caudovirales. It may be a tail component.	0.000215006
NZ_CP010577.1\|WP_044797902.1\|1201812_1203282_+\|phage-tail-family-protein	gnl\|CDD\|188159	TIGR01633, unnamed_protein_product, putative phage tail component, N-terminal domain. This model represents the best-conserved region of about 125 amino acids, toward the N-terminus, of a family of proteins from temperate phage of a number of Gram-positive bacteria. These phage proteins range in length from 230 to 525 amino acids. [Mobile and extrachromosomal element functions, Prophage functions].	3.75481e-32
NZ_CP010577.1\|WP_044797893.1\|1189101_1190286_+\|phage-major-capsid-protein	gnl\|CDD\|273690	TIGR01554, prophage_Lp3_protein_18, phage major capsid protein, HK97 family. This model family represents the major capsid protein component of the heads (capsids) of bacteriophage HK97, phi-105, P27, and related phage. This model represents one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease. [Mobile and extrachromosomal element functions, Prophage functions].	4.88754e-67
NZ_CP010577.1\|WP_024086117.1\|1198969_1199890_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|274042	TIGR02224, Tyrosine_recombinase_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	4.12723e-38

>NZ_CP010577.1|WP_044797899.1|1192992_1194237_+|hypothetical-protein
MAGRIKGITIEIGGETTGLQNALKDVNKRSNDLTKELKDVERLLKFDPGNVEALAQKQKLLTQQIENTTEKLDKLKAAEQQVQAQFQNGKISEEQYRAFRREIEFTQGSLDGLKNKLGNMKSEQENVASSTRQLETLFSATGKSVDDFAGALGNRLVNAIRNGTATSKQLEQAIGIIGREALGTEADIEKLQRALRSVDAGNSIQQVRNELRDLQQEAERTEKKFEGLQIGLENVIGGLAAGGGIATAVEKAMDMSKLKTKIDVSFEVPESSKKSVEESVRAVTAYGVDIDEALEGNRRQWALNKDASDETNAAIAKGAAGIVAVYSDIDFTELIQEANEIGATLGITNEEALGLVHTLLKTGFPPEQLDIIAEYGDQMMQAGFTAKEVQGIMSAGVDTKSWNIDNLLDKKLSL
>NZ_CP010577.1|WP_000415931.1|1192399_1192762_+|hypothetical-protein
MEKTITIDGKQVRLKSTAATVKRYKAQFRRDLFADMFKLGILSPSNPQEGSLATIDLANADLSKLDFEVVYDLVWLYAKTANPEIDDPITWLDGFDEFPISEIIPEIMDMIQSTMGAKKK
>NZ_CP010577.1|WP_044797898.1|1191799_1192393_+|phage-tail-protein
MNENKVTFGLKNVHYVPLDIKDFLVTFGTPIPLPGGVELTFEPRGDLIEFYADDMLYYAASNNQGYDGTLSIATIPEKFAIDALGEELDETDGVLNELADAKGKPFALLFEFDGDVNATRHVMYNCSASRPTLASKTKTSSAEPNTNELKFVSSPIILAPGGRPMVKTKTTSKTTQAIYNNWYKEVYVKKPAEPKGA
>NZ_CP010577.1|WP_044797897.1|1191469_1191799_+|hypothetical-protein
MTLGELKKILEATGYPVAYSHFTETPGVPVPSPPYVCYFVDGSPNMAADNKAYHKINDVNIELYTTKKDLVAEAKLEQVLDDHEIPYESYGTFIESEKLFQKIYETRLL
>NZ_CP010577.1|WP_044797896.1|1191116_1191473_+|HK97-gp10-family-phage-protein
MANIDDLSNEIARELQRYANVIEEDMEVAKEEVADNLVDELKQKSPKNTGRYSKGWRKKKDGNAIIVHNALKPQLTHLLEKGHAKANGGRVPAKVHIAPVEEHAIHDFVERVERAIGQ
>NZ_CP010577.1|WP_042596912.1|1190824_1191124_+|phage-head-closure-protein
MNDIVFFPVVTTTTDDLGQIEAAEDFTRQVFCEKKSVSQNEFFQAGQNGFKPKCVLIVYTLDYQEEQKVQYHNKKYNIYRTYERDDERIELYCEVKTGG
>NZ_CP010577.1|WP_044797895.1|1190555_1190828_+|DNA-packaging-protein
MILKDIKKALRISHDALDDEINDAIEAARHDLMLSGVSSIKANNDGDPLIKRAIKVYCKAEFVAEVKEAERFQASYNMLKNHLTLAGDYK
>NZ_CP010577.1|WP_001016250.1|1190301_1190559_+|hypothetical-protein
MNHLVLNAFIDKETKVGYSKGDMYESNDSERVAFLIEKGFLKGNKEISTFPKHTGGGWYELSNGEKVQGKEEAMSAEQSLRGNES
>NZ_CP010577.1|WP_044797893.1|1189101_1190286_+|phage-major-capsid-protein
MNKEQLLKRKSEISELLSDETRSIDNLDAIETELRDINNQLAAIEKREQLLNEARSINEGNATGANKIETFNTDSSNEKRELGTNTVEYRNAFMNYVLRGEAIPTELRANAVTKTSDIGSVIPQTVLDKIIEKIEAVGMILPLITRTAIKGGVTVPTSAVKPVATWVAESSGSDKQKKTTGSITFNYHKLRCAVAVSLEVETMSLAVFETTLINNIVEAMTKAIEQAIVSGDGSGKPKGILAETPVDGQALDVAKINYKTLTDAEAALPLEYEASAIWTMTKKTFMEFSAMTDADGQPIARTNYGISGKPERILLGRPVVLCNYVDSFATATEGTTFAFLFNYKDYILNTNYQMGVKKYEDNETDDQVTKAIMIVDGKVVDKNSLVVLKKAPAA
>NZ_CP010577.1|WP_044797892.1|1188500_1189085_+|HK97-family-phage-prohead-protease
MDKTETREIVTQKIEIREDDNGNRTLIGYAVKWEKKSVVMGYYRKFREQFKNGAFTETLQNDDQRFLWSHDMSKVLGRTKNNTLRLSEDAVGLRFELDLPDTTLGNDTYKSIKRGDVDGVSFGFSMISEEIQEPDDDLMLRTVTKAKLLEVSAVAFPAYPDSEVSARGYDPYKHFTEEKERSEKRRRLYLQTLL
>NZ_CP010577.1|WP_044797901.1|1195880_1198898_-|Tn3-family-transposase
MPVDFLTPEQEEKYGCFCDTPTSEQLAKYFWLDDTDKELIWNRRGEHNQLGFAVQLGTVRFLGTFLSDPTNVPQSVITYMANQLHLDAQSFSRYRNKRSQWDQMQEIRSVYGYKNFTDKSTHWRFIRWLYARAWLYNERPSVLFDLATARCIEQKILLPGVSVLTRLVSTVRDRSAENIWKKLSSLPDNVQKKQLENLLQIDQKTKKTYLERLSNPPVPISVTGIKNTLIRLQELRQLNTENWDMSRIPSKRLQQFARHTVAVRSQAIARMPDQRRMAMLVAFAKMYTQSAQDDVIDIFDRYLTDLFAKTYRKEQKERLRTIKDLDKAARQLREACVILLEHTDPSVHPKTAVFEKISEKDLIQAVQIVDSLTYSPNQTLAYSGLLQHYGIIRKFLPLLMEEIELQATPAGLPILQAWNFVKEHGKSNKKRWKNAPLAGLNANWSKVVIDKDSGTVNHRAYTFWMLEQVLEALHRHDLYIVGSEKYGDLRAQLLQDEEWKSIRPSILRSLDWSIDSYESLTPLKEELDKTYHQVIENWENNPAVQIDTFAGKERIVLTPLDKQPEPESLQKLKQQIHTMLPNIDIPQLLLEVNRWTGFMDGFRHISEAKSRINELPISICALLISQACNIGLRPLVQDGVPSLERDRLTWIEQNYFRAETLSESNAKLVDFHSQLQLAKMWGGGEIASADGLRFITPVKSVHTGPNPKYFGSGRGVTYYNYTSDQFTGLHGLVIPGTIRDSLYLLQCVLEQNTNLQPKEIMTDTAGYSDIIFGLFGLLGYQFSPRLADISESRLWRFDANSDYSMLNNLSKSRIREELIHRHWEDMLRVAGSLKLNKINATHLIQALQYNGKPTMLGRAIGELGRLFKTRYLLLYLHDENYRRKILNQLNRGEARHSLARAVFYGKRGELHQSYREGQEEQLGALGLVVNAIIVWNTRYIESALQVLRNRGHTIDNDDISRLSPLGHKHINIVGRYSFVLPEEVKDGQLRTLTYEETNKKEPDSL
>NZ_CP010577.1|WP_024086117.1|1198969_1199890_-|tyrosine-type-recombinase/integrase
MHSTKTISIQATSLISDFISSLSQEGDLHTKTLKEYTSDLKDFVFWFENVWGKHAEDTLFHPIEVTARTIARYRGHMQVTRLLKPSTINRRINSIKRYFDWAKQKGLVQTNYSKSIKFVPTEKTSPKRMSDKEEAALMHAVEKYGTLRDRAMIIFMLHTGLRSMEVCDVQIEDVIMRKRGGYVVVRSGKRNKQREVPLNSTARCALEEHIRLSEISQSYLFPSSKTGKRLQERAIRHILQKYIRLAKLEGFSAHDLRHRFGYVMAERTPLHRLAQIMGHDNLNTTMIYVRATQEDLQGEVEKIAWN
>NZ_CP010577.1|WP_024086118.1|1200045_1200303_+|hypothetical-protein
MAIRKDELYRLIDHLDQQDEKAAFDFLEFLVQRSRRKPKEWEKIDMADPDHEPLSTQELEQLNSEEGYVSGEDAKREFGLQIDLP
>NZ_CP010577.1|WP_024086119.1|1200271_1200535_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MNSDYKLIYHKSAVKFIAKQEKGIQKRIAEGLKGLLKIPPEGDIKSMKGYTELYRLRIGTFRILFEINHDEKVIYIQAIGNRGDIYK
>NZ_CP010577.1|WP_044797902.1|1201812_1203282_+|phage-tail-family-protein
MSSFTFNNIRKDFMQIEKGWKKPAWAPLKRNFLSVPGYPGARLLTTETEMRVLPVPVGIIVPDGSDLETVKEEIAEWLITERPVELVFDVTPDRTYLAVIDEDFDPEDFVTLGKGILNFVCPMPYKLGNEKTVDFENDGQGLIANVQNKGSVHSNPIIEIDIKKPHTFLDVWFEDKYAKEPDYFRIGMPLKMEQLPVERNQRLIWDDMSTTVGWSKVSSMEDGNPVGEMKTDSYQFYCSDYGSGNGWHGAAVKKSIPGGPVQDFIMQAHVTCKSKTINEMGRVEIAILDENSKVLSKIAMNDLYWQAEQNFGTMVIGYDNKPEKTGLIYESGDYPNTWNQYYGRLWIARTGNDWEAYISKFLPGTEKDDAERFARWTDKDNKHMEKAAQIQISIMQWQDVPPVEAMTVSDLKFWKVNLNSQSTPPYIVDVGDKVVIDTESSHVSIEGKNAINIKDIFSNFPVINKDTNKLEIIPSDIGTAKVTYRERFR
>NZ_CP010577.1|WP_044797903.1|1203278_1207667_+|phage-tail-protein
MRTPSGILHVVDSQTDQIIGAIQSKDYWNDNRHWEIKNNVDKLDFTVFDGTKEAAALTQQNLVLKEVRGGRIVPYTITETEKDSNNRSLTTYASGEWILLGKANYIDPQKFEAKTVGEYVDIALKGTKWKKGNISYESFRSMTVDEFIDPLSFLKKIASLFELEIQYRTEVVGNHIERYVDMMKKRGQDTGKTIELEKDLIGIKRIENSQNICTALIGFVKGEGDNIITIEKINNGLPYITNIDAFQRWNEKGKHKFGFYSPETDNENMSPERLKTLMEIEMKKCVNASVSYEVKAASIGRVFGLAHELINEGDTIRIKDTGFTPKLYLEARAIAGDESFTDPTQDKYVFGDYREIVDPNEELRKIYNQILSSLGSKQEMLDQLDKLVKQNEKTIETIRKESQAAKELAEKVQENLKNNTVNIIEAKNAPTDNLIVGKTLWRDISNGKPGILKVWNGKGWELLIPDVESIKKDTLEQVNKDIQLTKEELNKKVEEAQNETAGQFKEVTENLQEVSLTIKNVQNSQGEIDKTVSEMKQTNEGFTKSIDSLTKKNGEITEKLNTVVETSEGTIKKISEVQKTTNDLKKTTTEIEEKAGEISEKLTSVEKKVDNTEIGIRNLLLETATKSHSVKTGENKPHTYFGVAKDAVTLMQGKNIAMSFLFTGKVTAWGTTNKWIGFEVKITFTDNTFAYPSCRVENRLTLGKQYKQERFTASAVVMDKPIKEILVYALGRDFTGDVLIEKPKLEVGTVPTAWIPAPEDQVTNEEFNKKTTEIEKSVDGIKESIKTVEKTQVSFSERVTTVEKTAEGIKENVTSIQEIQTKQGTQLQEAKAGWETTAKALEGKVEIKDVENYVGGLGTVNELRDADFKLGQKYWFWNSGNGATGSVDTNLKYKGMNTFAITVTGQTQDRWWGLTSQFIECQVNEDFVASGYFNTDGKTPIDGGGAFIEIEWWTADKKTRIKTARTNIKVVNHTWIRAVCTDKAPANAAFVRWRYYVTRNGRLWCAAPMLQRGIIATEFWLHPKDQTDADKMIEDIANRVATKDYDKKVTELERSISATEEGVEITSKKQEKFINETYAAYVKEMGSKLKVLDEGILAEVKKGNIIAAINFSSEKLEIDVSKVAINADTMVKWLTAKGIDTNLIRIDGDKVTIDKDGVTVKMLDFLFQDEWGTKTTAVSRRNLIADPDFSSVTKKNIGHNDYYGFEGGYGLTWKSWGNVVIEKNTHIFDYEQMVNAARVDMYNYPETVVNNGIHPGNEYTVSAHFRTAMINGVRKTGKPRLQVCCVKFRDNVSYDIWNEQKMDFPEPSTYYGEIRRYSFTFKVPTNYIPQQHALIIKVCSGNADMRQGTAICVSGVTLYSGKYASMYNWDRAAAERADGIQPFNALAVGGVNNNISPAPDGQTFDISTEKEVKIFRNIRAMQGINLGGGGFQQWGHIRFTDGNAGAGFYASTPSGWKFNALG
>NZ_CP010577.1|WP_044797904.1|1207683_1208061_+|hypothetical-protein
MDINYMMPFQEGEMLPYMGRIVDVKRTETGVFIQVPADMLDNAGVSNDTSKVEVWRDMSDGTIGFRVLTKCELCGCGAKLYELNLGVAKRNICANDYFKLTGNYPSQEPPTPTNENNTQTEQEQQ
>NZ_CP010577.1|WP_044797905.1|1208098_1208524_+|phage-holin-family-protein
MDRIDVLLKTFIATFGGFCGYFLGGWDTTLKILVTMAVIDYLTGMIAAGYNGELKSKVGFKGIAKKVVLFLLVGAAAQLDLALGSNSAIREATIFFFIGNELLSLLENAGRMGIPLPSALTNAVEILGGKQKQEEKKGDVQ
>NZ_CP010577.1|WP_044797906.1|1208523_1209459_+|N-acetylmuramoyl-L-alanine-amidase
MEIRKKLVDPSKYGTKCPYTMNPKFITVHNTYNDATAENEVSYMIRNDNQVSFHVAVDDKEAVQGLPLERNAWACGDGNGSGNRDSISVEICYSLSGGERYYKAEDNATIVVAQLMKQYNIPIHKVRTHQSWSGKYCPHRMLAEGRWDGFLERVQCAYNGGSSLINLTPTPSFSGETGIVNIEGNDVNLRKGPGTGYGIIRQLGKGESYQVWGESNDWLNLGGDQWIYNDPSYIRYTGENVSAPSKTLNDGIGVVTITADVLRVRKGPGIIYGIVKNVYQGEQYQSWGYRDGWYNVGGDQWVSGEYVKFEK
>NZ_CP010577.1|WP_044797907.1|1210013_1211117_+|recombinase-RecA
MFWKGAIHVAIIENTTQGKEKALEEALKKIVKEFGTGAIMKLGERPEQKISVISSGSVGLDNALGVGGYPKGRITEIFGPESSGKTTIALHAIAETQKEGGTAAFIDAEHALDPIYAQKLGVNIDELLMSQPDTGEQALEIAEALVRSGAVDIVVIDSVAALVPKAEIEGDMGASHVGMQARLMGQAMRKISGAISKNGVVAIFLNQIREKVGVSFGSPETTPGGRALKFYSTIRLDVRRGEQLKGKESDILGNKTKVKVVKNKVAPPFKNIDFDILYGEGISLEGELIDIGVELDIVQKSGAWYSYQEERLGQGRDNAKQFLKENENIRNSVRNKIYEYYSPKEDSVVVKAELIKENEPITLKESE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010577_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010577_3

5100859-5100975

Orphan

Consensus_repeat	Method
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010577_3

>merge|NZ_CP010577|3|5100859-5100975|CRISPRCasFinder
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTTCGTTAACCTTTGAACTACATGAGTTTCTTTCTACCGAACATACAGCTTAAACAAACGTTTGATTAATTCTCCATTTTTCTT

>NZ_CP010577|3|3|5100859-5100975|CRISPRCasFinder
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTT	CGTTAACCTTTGAACTACATGAGTTTCTTTCTACCGAACATACAG
CTTAAACAAACGTTTGATTAATTCTCCATTTTTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010577.1\|WP_000359401.1\|5095891_5096557_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP010577.1\|WP_003280640.1\|5098485_5098794_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP010577.1\|WP_001002987.1\|5104691_5104940_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP010577.1\|WP_000929162.1\|5093153_5093939_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP010577.1\|WP_001206339.1\|5108258_5109431_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|181072
NZ_CP010577.1\|WP_016078142.1\|5109452_5111834_-\|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|224170
NZ_CP010577.1\|WP_001242143.1\|5097988_5098333_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_016078138.1\|5094177_5094984_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP010577.1\|WP_001180555.1\|5104953_5105139_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_000218968.1\|5100297_5100663_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP010577.1\|WP_000416287.1\|5106087_5107872_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173850
NZ_CP010577.1\|WP_016078139.1\|5096549_5097575_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP010577.1\|WP_000640870.1\|5098797_5099142_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224572
NZ_CP010577.1\|WP_000026896.1\|5099872_5100256_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP010577.1\|WP_016078140.1\|5101074_5101602_-\|lipoprotein	unknown	unknown	unknown
NZ_CP010577.1\|WP_106081637.1\|5103495_5104665_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427
NZ_CP010577.1\|WP_000864826.1\|5105252_5105972_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293807
NZ_CP010577.1\|WP_000666168.1\|5102459_5103473_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP010577.1\|WP_016078141.1\|5101746_5102394_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP010577.1\|WP_000735090.1\|5095055_5095868_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381

Protein	Function_ID	Function_description	E-value
NZ_CP010577.1\|WP_000359401.1\|5095891_5096557_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	8.57648e-99
NZ_CP010577.1\|WP_003280640.1\|5098485_5098794_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	4.18685e-18
NZ_CP010577.1\|WP_000929162.1\|5093153_5093939_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	5.15323e-150
NZ_CP010577.1\|WP_001206339.1\|5108258_5109431_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|181072	PRK07661, PRK07661, acetyl-CoA C-acetyltransferase.	0
NZ_CP010577.1\|WP_016078142.1\|5109452_5111834_-\|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|224170	COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism].	5.11591e-83
NZ_CP010577.1\|WP_001002987.1\|5104691_5104940_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	9.62029e-15
NZ_CP010577.1\|WP_016078138.1\|5094177_5094984_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	5.95239e-112
NZ_CP010577.1\|WP_000218968.1\|5100297_5100663_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.13259e-61
NZ_CP010577.1\|WP_000416287.1\|5106087_5107872_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	0
NZ_CP010577.1\|WP_016078139.1\|5096549_5097575_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	2.17767e-176
NZ_CP010577.1\|WP_000640870.1\|5098797_5099142_-\|hypothetical-protein	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21
NZ_CP010577.1\|WP_000026896.1\|5099872_5100256_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	6.96592e-70
NZ_CP010577.1\|WP_106081637.1\|5103495_5104665_-\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP010577.1\|WP_000864826.1\|5105252_5105972_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293807	cd07721, yflN-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis yflN; MBL-fold metallo hydrolase domain. This subgroup includes the uncharacterized Bacillus subtilis yflN protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	4.53913e-64
NZ_CP010577.1\|WP_000666168.1\|5102459_5103473_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.39354e-86
NZ_CP010577.1\|WP_016078141.1\|5101746_5102394_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	1.3152e-15
NZ_CP010577.1\|WP_000735090.1\|5095055_5095868_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	6.69253e-111

>NZ_CP010577.1|WP_000218968.1|5100297_5100663_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ
>NZ_CP010577.1|WP_000026896.1|5099872_5100256_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQGELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP010577.1|WP_000640870.1|5098797_5099142_-|hypothetical-protein
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSTHLANVLWGADIDVYTEYLR
>NZ_CP010577.1|WP_003280640.1|5098485_5098794_-|thioredoxin-family-protein
MIEVIDWTGAEATSLIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEELKIGMLDLNYAPHLAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYTELK
>NZ_CP010577.1|WP_001242143.1|5097988_5098333_-|hypothetical-protein
MRLYSLLQSFVNYANGQYHLEPLLRREEKTVNFRLGDESCSLQISRDYIELVHEERGTEQIICLDEKDIEQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>NZ_CP010577.1|WP_016078139.1|5096549_5097575_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIEKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISTITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKAKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMERGKIVETGPVLDVFRNPKQDITKRFVQQLTDSEDTNETIESLIEKYPDGKVIRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP010577.1|WP_000359401.1|5095891_5096557_-|ABC-transporter-permease
MDKLLANVDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKSINTVIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFLIQWIGDSLTTRIDKR
>NZ_CP010577.1|WP_000735090.1|5095055_5095868_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEVAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVADHGRGLAILQKEGILKVKDGVDPVKATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGNDSPYANIVAVRKGDKDKKEIKALVEVLHSKEIEDFINKEYKGAVVPVKE
>NZ_CP010577.1|WP_016078138.1|5094177_5094984_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MRKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKELPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEILHSKEIQDFINKEYKGAVLPISE
>NZ_CP010577.1|WP_000929162.1|5093153_5093939_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINQMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETAEQEA
>NZ_CP010577.1|WP_016078140.1|5101074_5101602_-|lipoprotein
MKRLSYFLVFILLCLVGAGCAKNNEGEKLEYNGRALVIGVVGEKPKDTFRNVKFEEMKLEALEKKSKEVDGFLIMKDHFQEASTEQYKNVFSSLKKPVFFIGLQDKLYSIFITKGIEYNSARKDVNAMYTQGFANIGSGEGQQWAIGLSNGGNTEESIHNMYIVVFQTIADYLNR
>NZ_CP010577.1|WP_016078141.1|5101746_5102394_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSTVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSVIFGKLACFSIYYFWQTTVPRPTVVGTDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHAFEYYILTFFGTLIILSTLFTKQHAFLDAVSGMTLASILYFGVQLLLAKESIRVPVKQNHRM
>NZ_CP010577.1|WP_000666168.1|5102459_5103473_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNAVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVLPAMVITYIVIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NZ_CP010577.1|WP_106081637.1|5103495_5104665_-|L-lactate-dehydrogenase
MRSFYFLYVNKYIINIFPVVTNMTKMEYNNSQKGQKLCSIFHKVSMVSIVGTSIIKNVKNKRNRLYDQLGEIAMKRHTRKIAIIGTGLVGSSCAYSIVNQGICEELLLIDINHERAVGEAMDLSHCINFTNTRTKVYAGSYEDCKDMDIVIITAGPAPKPGQSRLDTLGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYEVWKLSGLPRNRVIGTGTSLDSSRLRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKERFGEIDLDEIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYGEYDICTGVPAIITRDGIREVVELNLTEDEESRFAKSNDILRDYMKTIGY
>NZ_CP010577.1|WP_001002987.1|5104691_5104940_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE
>NZ_CP010577.1|WP_001180555.1|5104953_5105139_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLEQYAQTCTDPQLKQMLQKDAQDARNTKQQLMTFLG
>NZ_CP010577.1|WP_000864826.1|5105252_5105972_-|MBL-fold-metallo-hydrolase
MKVISVGTVHQIAFLPRLFPINCYFVEEETGLTLIDAALPFCAKKILQSARKIGKPITNIVITHAHDDHVGALDVIKQVLPDVPVYISKRDACLLEGDKVLQEGERNTSIKVGVSKQINTIPDILLQEGDKVGSLVAIGAPGHTPGSMAFLDTRNDALIVGDAFQTRGGLAVAGQLKWLFPFPMFGTWDAEVSLASAQKLLEYKPSLLATGHGKMIENPLIQMQRAIEEAERNLSRKSL
>NZ_CP010577.1|WP_000416287.1|5106087_5107872_-|acyl-CoA-dehydrogenase-family-protein
MEKTVGNAVKGGSFLVDEITIDQVFTPEDFSSEHKMIAKTTEDFIVNEVLPELEYLEQHEFDRSVRLLKEAGELGLLGADVPEEYGGIGLDKVSSALIAEKFSRAGGFAITHGAHVGIGSLPIVLFGNEEQKKKYLPLLATGEKLAAYALTEPGSGSDALGAKTTARLNAEGTHYVLNGEKQWITNSAFADVFIVYAKIDGEHFSAFIVEKEYAGVSTSPEEKKMGIKCSSTRTLILEDALVPKENLLGEIGKGHIIAFNILNIGRYKLGVGTVGSAKRAVEISAQYANQRQQFKQPIARFPLIQEKLANMAAKTYAAESSVYRTVGLFESRMSTLSEEEVKDGKAVAASIAEYAIECSLNKVFGSEVLDYTVDEGVQIHGGYGFMAEYEIERMYRDSRINRIFEGTNEINRLIVPGTFLRKAMKGELPLLQKAQKLQEELMMMMPEEVGDEPLALQKYLVTNAKKIGLMVAGLAAQKYGKALDKEQEILVNIADIVSNLYAMESAVLRTEKAIKTTGLEKNKQKVLYTEVFCQEAFNEIEADAKETLIAVENGDMLRMMLSSLRKLTRHTPLNVIPKKREIAAKILEDERYTV
>NZ_CP010577.1|WP_001206339.1|5108258_5109431_-|acetyl-CoA-C-acetyltransferase
MREAVIVAGARTPIGKAKRGSLKTVRPDDLGALVVKETLKRANYEGPIDDLIFGCAMPEAEQGLNMARNIGGLAGLSYDVPAITINRYCSSGLQSIAYGAERIMLGHSEAVLSGGAESMSLVPMMGHVVRPNSRLVEAAPEYYMGMGHTAEQVAVKYGISREEQDAFAVRSHQRAAKALAAGNFADETVSVDVTLRTVGSNNKLQEETIIFAQDEGVRAETSLDILGKLRPAFNVRGSVTAGNSSQMSDGAASVLLMDREKAVSDGMKPLAKFRSFAVAGVPPEVMGIGPIAAIPKALKLAGLELSDIGLFELNEAFASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLIHEMKRRNEQFGIVTMCIGGGMGAAGVFELL
>NZ_CP010577.1|WP_016078142.1|5109452_5111834_-|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein
MFQIKKAAVLGSGVMGSGIAAHLANIGIPTLLLDIVPPALTKEEEAKGLTLEHKSVRNRFSNTAVQKLLKQKPAPLTVKGNLALIEAGNLEDDLERLADVDWIIEVVVENLDIKKKLFEKVDAVRKPGSIVSSNTSGISVEKMAEGRSDDFQKHFLGTHFFNPPRYLKLLEVIPTKETDPQVLSFMKLFGEDVLGKGVVIAKDTPNFIGNRIGTYGLLVTLQEMIKRGYSIGEVDSVTGPLIGRPKSATFRTLDVVGLDTFVHVANNVYENVQEEERDVFKVPAFMHDMLEKKWLGSKTGQGFFLKQGKEILELNPETMEYEARKKLKAASVELSKQEKGLANKLKALVYAKDRAGELLWNIITPTLLYSAKLHKEIADDIVAIDQAMKWGFGWEQGPFEVWDAIGVEKSVQKMEENGVVVPTWVKEMLEKGFTTFHKHDNGDSYYYDNGEYKRIERNKKAISLKQLKAKNGVLKKNSGASLIDLGDGILCLEFHSKSNAIGMDITQMINYAVDEVEKNYKGLVIGNQSKNFCVGANLAMILMEAQDDNYFEIELVVKNFQDAMTKIKYSSKPVVAAPYGMTLGGGTEVCLPAASIQASSETYMGLVEVGVGLIPGGGGNKELYIKHLNKMPNGVEFDLQKVANKVFESVAMAKVSTSAQEAVSNNFLGDKDGISVNGDHLLYDAKQKALALYEAGYKAPIRKKIPVVGETGYATLVLGAEAMHLSGYISEHDLHIAKKLAYVIAGGKVPYGTEVDEQYLLDVEREAFISLVSEMKSQARMQHMLVKGKPLRN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010577_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010577_4

5420442-5420575

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP010577_4

>merge|NZ_CP010577|4|5420442-5420575|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTAGGTTCTTCTTTTTTGTCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NZ_CP010577|4|4|5420442-5420575|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTAGG	TTCTTCTTTTTTGTCACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010577.1\|WP_000008903.1\|5420119_5420254_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010577.1\|WP_001053969.1\|5411493_5412930_+\|IS4-like-element-IS231C-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP010577.1\|WP_000467944.1\|5416494_5417172_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP010577.1\|WP_000411275.1\|5425526_5426831_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP010577.1\|WP_016079662.1\|5424299_5425319_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP010577.1\|WP_000057889.1\|5427626_5427863_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP010577.1\|WP_042596763.1\|5422170_5423013_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP010577.1\|WP_000457978.1\|5418376_5419378_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP010577.1\|WP_016079673.1\|5410454_5411105_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|274398
NZ_CP010577.1\|WP_042596754.1\|5414797_5415499_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP010577.1\|WP_000931959.1\|5417513_5417948_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP010577.1\|WP_042596761.1\|5421463_5422171_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP010577.1\|WP_016078205.1\|5431086_5432949_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP010577.1\|WP_042596756.1\|5415488_5416232_-\|capsular-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP010577.1\|WP_003272396.1\|5426870_5427581_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP010577.1\|WP_017763801.1\|5429587_5431090_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP010577.1\|WP_042596752.1\|5413919_5414687_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NZ_CP010577.1\|WP_000544012.1\|5419538_5419811_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP010577.1\|WP_017763800.1\|5428065_5429586_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP010577.1\|WP_042596765.1\|5423194_5424202_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054

Protein	Function_ID	Function_description	E-value
NZ_CP010577.1\|WP_001053969.1\|5411493_5412930_+\|IS4-like-element-IS231C-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	5.01379e-28
NZ_CP010577.1\|WP_000467944.1\|5416494_5417172_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.84961e-82
NZ_CP010577.1\|WP_000411275.1\|5425526_5426831_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP010577.1\|WP_016079662.1\|5424299_5425319_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	4.03637e-135
NZ_CP010577.1\|WP_000057889.1\|5427626_5427863_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NZ_CP010577.1\|WP_042596763.1\|5422170_5423013_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.28753e-91
NZ_CP010577.1\|WP_000457978.1\|5418376_5419378_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP010577.1\|WP_016079673.1\|5410454_5411105_-\|sugar-transferase	gnl\|CDD\|274398	TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.	6.75263e-106
NZ_CP010577.1\|WP_042596754.1\|5414797_5415499_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	2.40781e-83
NZ_CP010577.1\|WP_000931959.1\|5417513_5417948_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP010577.1\|WP_042596761.1\|5421463_5422171_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	5.86419e-09
NZ_CP010577.1\|WP_016078205.1\|5431086_5432949_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP010577.1\|WP_042596756.1\|5415488_5416232_-\|capsular-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	2.46399e-85
NZ_CP010577.1\|WP_003272396.1\|5426870_5427581_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	1.11897e-33
NZ_CP010577.1\|WP_017763801.1\|5429587_5431090_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	9.36796e-176
NZ_CP010577.1\|WP_042596752.1\|5413919_5414687_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	8.31028e-105
NZ_CP010577.1\|WP_000544012.1\|5419538_5419811_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP010577.1\|WP_017763800.1\|5428065_5429586_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	3.55146e-150
NZ_CP010577.1\|WP_042596765.1\|5423194_5424202_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.31231e-29

>NZ_CP010577.1|WP_000008903.1|5420119_5420254_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEELEREE
>NZ_CP010577.1|WP_000544012.1|5419538_5419811_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP010577.1|WP_000457978.1|5418376_5419378_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NZ_CP010577.1|WP_000931959.1|5417513_5417948_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP010577.1|WP_000467944.1|5416494_5417172_-|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLMQCIQKTDIENVYLMAAGPIPPNPAELLGSRAMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKILGVVLNDKREEKEQYGYY
>NZ_CP010577.1|WP_042596756.1|5415488_5416232_-|capsular-biosynthesis-protein
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNIQLTNTYKVIIKSPVILDQVKEKLGLNITVQELNNKIEVANEKDSQVVAVTAQDKDPKLARDIANTTAEVFKGEVAKIMSVDNVTVLSKAEVAENLSPIKPRPMLNVAIAFVIGLMVSIGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKVRGQTIGS
>NZ_CP010577.1|WP_042596754.1|5414797_5415499_-|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>NZ_CP010577.1|WP_042596752.1|5413919_5414687_-|tyrosine-protein-phosphatase
MIDLHCHILHGIDDGAQTVTDSLAMAQQAVAEGIHTIVATPHHQNGKYVNERTSIIHHVKQLNDELQQYNIPLTILPGQEVRLYGDLLEDYEAGKIVTLNETNKYIFIEFPSNHVPRYAEQLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMVASDAHNTTSRGFHLAESYELIEKEFGMNVMSDLKENPYLLISGKAIYKEDPEQIRRKRLFGIF
>NZ_CP010577.1|WP_001053969.1|5411493_5412930_+|IS4-like-element-IS231C-family-transposase
MNLSIQDELQLFSEELYRHLTPSLLEELAKELGFVKRKRKFSGNELATICIWVSQRTASDSLVRLCSQLHAATGTLMSPEGLNKRFDKKAVEFLKYIFSALWKSKLCKTSAISSAALTYFQRIRILDATIFQVPKHLAHVYPGSGGCAQTAGIKIQLEYDLHSGQFLNFQVGPGKNNDKTFGTDCLDTLRPGDLCIRDLGYFSLEDLDQMDQRGVCYISRLKLNHTVYTKNPFPEYFRNGTIKKQSQYIQVDLENIMHTLKPGQTYEIKESYIGKNQRLFTRVIIYRLTEEQILERRKKQSYTESKKGITFSEKSKRLTGINIYVTNTPWEVVPMEQIHDFYSLRWQIEIIFKTWKSLFQIHHWQTIKQERLECHVYGKLIAIFICSSTMFKMRQLLLQKHKRELSEYKAIGMIQDHLSLLYQAIQRNTRIITKVLIRLFTLLKKNGRKSHRYEKKTIFDIMGVVYEYNGLRKQKKAA
>NZ_CP010577.1|WP_016079673.1|5410454_5411105_-|sugar-transferase
MAMREMKKYPLDETIETNINLPNHYIYFTLKNTADFLMALLGLVILSPILLLFVLAIKLESNGPAFFLQERVGLNGRVFNIIKLRSMYIDAEKNGAQWAKKNDARVTKIGAFIRRTRIDEIPQLINMLKGDMSLVGPRPERPIFTEQFNKEIPGFKNRIVVKPGITGWAQVNGGYDISPKEKLEFDIYYIKNLSLFMDVKIIFKTIKVIFTGEGAR
>NZ_CP010577.1|WP_042596761.1|5421463_5422171_-|ABC-transporter-permease
MTFSMKRFSAIVRKEINDAGKNSQVILMALLPILLAVFYSNMDSIKEFFAGFVIVMTITMVGSYVQAIIIAEEKEKHTLRVLMLSPASPIEVILGKSVLTVFFVLASSFISLVILDTFKGNIGMLVIIILIGTLLCVVLGTIVGLLSQNIAQTSILGLPIFIIFIMGPMLQEMVKNEFIIKVVNLLPTNHVMEALQKVIKGEGFIAIQEHILNNTIWTICLIILYIIVYKKKQLD
>NZ_CP010577.1|WP_042596763.1|5422170_5423013_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFGGKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSINYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNEEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIEVVLKDKQKEVVQKDELGAKRISEWMKKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP010577.1|WP_042596765.1|5423194_5424202_-|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MVLLELKQLGKTNQLPVIDLKVAKGQCVVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGGAIGKKNYPRIGFCFLKDEAYDRLKVKEYFKFLIGLYESKISIEEVVQSVGLLDKLNVKIEKLLFSEKRRLHIGRVMIHNPDLVVLEEPEQNVDIESTIIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKIEIEQEEVEEVGEEKVIQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELEMRLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP010577.1|WP_016079662.1|5424299_5425319_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVESLPMEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKEELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIITTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP010577.1|WP_000411275.1|5425526_5426831_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP010577.1|WP_003272396.1|5426870_5427581_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKDKANIQKWEVEQSPDGYKATSYKKFASHEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQKVNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP010577.1|WP_000057889.1|5427626_5427863_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP010577.1|WP_017763800.1|5428065_5429586_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASSLILCIAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKNRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGATTPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTLDSMWFYMLAYMLMNIGAFAIIHGLILQNDKENITIFTGLYKKSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP010577.1|WP_017763801.1|5429587_5431090_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKSLSLFDEKVKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMVLTALLAMLAAIAAFSIKSNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVSAGGELVIPSSLQLGVFIAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDIMVLGGLAKSVPILSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEYVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP010577.1|WP_016078205.1|5431086_5432949_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASAVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYFLFVLAVIAAFLTAFYMFRLYFLVFTGEAKTKEDVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYGKKSISREWAGGTGTSLYNLLKEKYYVDELYNMTVIPITKGIARVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010577_1	1.1\|610074\|26\|NZ_CP010577\|CRISPRCasFinder	610074-610099	26	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	103187-103212	5	0.808
NZ_CP010577_4	4.1\|5420465\|31\|NZ_CP010577\|CRISPRCasFinder	5420465-5420495	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	100650-100683	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	8	0.765
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
NZ_CP010577_4	4.2\|5420519\|34\|NZ_CP010577\|CRISPRCasFinder	5420519-5420552	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 1.1|610074|26|NZ_CP010577|CRISPRCasFinder matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

tggtgggcacaatcataacggcggac	CRISPR spacer
atctgggcacaatcatagcggcggaa	Protospacer
   **************.*******

2. spacer 4.1|5420465|31|NZ_CP010577|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

3. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tttatcttcttttttattttctggtttattttcc	Protospacer
.**.****** ****************  * ..*

4. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

5. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

6. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

7. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

8. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

9. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

10. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

11. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

12. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

13. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

14. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

15. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

16. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

17. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

18. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

19. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

20. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

21. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

22. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

23. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

24. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

25. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

26. spacer 4.2|5420519|34|NZ_CP010577|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

239451 : 247550

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917311.1\|239451_239736_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_001029992.1\|239774_241409_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.3e-156	57.8
WP_164852166.1\|241812_243354_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.8e-22	31.7
WP_000833094.1\|243740_245066_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.1e-44	29.5
WP_000929886.1\|245359_246061_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-39	36.4
WP_000719237.1\|246044_247550_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.3e-30	29.5

DBSCAN-SWA_2

287523 : 295899

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|287523_288831_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170545.1\|288919_289639_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000278823.1\|289631_289886_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666782.1\|289882_290566_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055594.1\|290549_292769_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	3.3e-163	41.2
WP_000879026.1\|292753_294169_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_001262424.1\|294274_295315_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.5e-68	46.3
WP_016078569.1\|295311_295899_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.7e-27	36.9

DBSCAN-SWA_3

645258 : 688813

Bacillus_phage(92.73%)

tail,head,terminase,portal,integrase,capsid,plate,bacteriocin,protease

attL 646615:646629|attR 679756:679770

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001132863.1\|645258_646155_+	ribokinase	A0A0K0KW05	Prochlorococcus_phage	2.0e-05	30.2
WP_000716153.1\|646151_646547_+	D-ribose pyranase	NA	NA	NA	NA
646615:646629	attL	NA	NA	NA	NA
WP_044797803.1\|646951_648112_-\|integrase	site-specific integrase	A0A1C8E994	Bacillus_phage	2.2e-219	100.0
WP_044797805.1\|648181_648607_-	ImmA/IrrE family metallo-endopeptidase	A0A1C8E988	Bacillus_phage	2.6e-77	100.0
WP_044797807.1\|648622_649045_-	helix-turn-helix transcriptional regulator	A0A1C8E9A4	Bacillus_phage	2.8e-71	100.0
WP_044797808.1\|649317_649503_+	helix-turn-helix transcriptional regulator	A0A1C8E998	Bacillus_phage	9.2e-27	100.0
WP_044797810.1\|649502_649775_+	DUF771 domain-containing protein	A0A1C8E9B3	Bacillus_phage	5.3e-47	100.0
WP_172452020.1\|649788_649944_+	hypothetical protein	A0A1C8E9A0	Bacillus_phage	6.7e-23	100.0
WP_044797811.1\|649960_650791_+	ORF6C domain-containing protein	A0A1C8E9A5	Bacillus_phage	4.0e-154	100.0
WP_044797813.1\|650802_650991_+	hypothetical protein	A0A1C8E9A1	Bacillus_phage	2.7e-26	100.0
WP_033669561.1\|651017_651452_+	hypothetical protein	A0A1C8E9A2	Bacillus_phage	2.1e-74	100.0
WP_016099145.1\|651470_652184_+	hypothetical protein	A0A1C8EA84	Bacillus_phage	3.2e-128	100.0
WP_080893217.1\|652183_652399_+	hypothetical protein	A0A1C8E9A6	Bacillus_phage	5.0e-32	100.0
WP_080893219.1\|652328_652670_+	hypothetical protein	A0A0S2MVH7	Bacillus_phage	9.9e-51	97.3
WP_044797814.1\|652763_653678_+	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	1.8e-139	99.0
WP_044797815.1\|653689_654169_+	hypothetical protein	A0A1C8E9A8	Bacillus_phage	8.4e-80	94.3
WP_000139235.1\|654161_654392_+	hypothetical protein	A0A1C8E9C2	Bacillus_phage	2.5e-34	100.0
WP_044797816.1\|654415_655009_+	hypothetical protein	A0A1C8E9A7	Bacillus_phage	1.1e-84	97.5
WP_044797817.1\|655041_655590_+	hypothetical protein	A0A2H4J8I5	uncultured_Caudovirales_phage	4.4e-48	53.8
WP_001053195.1\|655628_656063_+	hypothetical protein	A0A2H4JBD8	uncultured_Caudovirales_phage	3.3e-75	93.8
WP_001093039.1\|656231_657023_+	prohibitin family protein	A0A1C8E9A9	Bacillus_phage	6.8e-143	100.0
WP_044797818.1\|657106_657634_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	2.9e-97	100.0
WP_044797819.1\|657630_657957_+	hypothetical protein	A0A1C8E9C1	Bacillus_phage	3.3e-59	100.0
WP_003308641.1\|657994_658396_+	hypothetical protein	A0A1C8E9D1	Bacillus_phage	1.1e-67	99.2
WP_044797820.1\|658798_659383_-	hypothetical protein	A0A1C8E9C5	Bacillus_phage	1.2e-107	100.0
WP_044797821.1\|659508_659706_+	hypothetical protein	A0A1C8E9B9	Bacillus_phage	2.3e-28	100.0
WP_044797822.1\|659751_660093_+	hypothetical protein	A0A1C8E9B7	Bacillus_phage	1.2e-61	100.0
WP_044797823.1\|660089_660377_+	phage protein	A0A1C8EAA0	Bacillus_phage	9.5e-47	100.0
WP_044797824.1\|660373_660766_+	HNH endonuclease	A0A1C8E9C7	Bacillus_phage	3.9e-75	100.0
WP_044797825.1\|660849_661275_+\|terminase	P27 family phage terminase small subunit	A0A1C8E969	Bacillus_phage	4.7e-74	100.0
WP_044797826.1\|661271_662996_+\|terminase	terminase large subunit	A0A1C8E985	Bacillus_phage	0.0e+00	100.0
WP_044797827.1\|663010_663223_+	hypothetical protein	A0A1C8E971	Bacillus_phage	7.3e-36	100.0
WP_044797828.1\|663222_663438_+	hypothetical protein	A0A1C8E977	Bacillus_phage	1.4e-31	100.0
WP_044797829.1\|663476_664649_+\|portal	phage portal protein	A0A1C8E972	Bacillus_phage	7.5e-223	100.0
WP_044797830.1\|664817_665075_-	hypothetical protein	A0A1C8E966	Bacillus_phage	2.4e-41	100.0
WP_044797831.1\|665147_665729_+\|head,protease	HK97 family phage prohead protease	A0A1C8EA63	Bacillus_phage	3.0e-100	100.0
WP_044797832.1\|665730_667053_+\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	1.8e-217	100.0
WP_044797833.1\|667056_667317_+\|head,tail	phage head-tail connector protein	A0A1C8E967	Bacillus_phage	3.8e-42	100.0
WP_044797834.1\|667291_667627_+	phage protein	A0A1C8E986	Bacillus_phage	2.9e-55	100.0
WP_001167236.1\|667616_667946_+	hypothetical protein	A0A1C8E981	Bacillus_phage	6.2e-58	100.0
WP_044797835.1\|667945_668323_+	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	1.7e-64	100.0
WP_044797836.1\|668334_668970_+\|tail	phi13 family phage major tail protein	A0A1C8E980	Bacillus_phage	5.7e-116	100.0
WP_000113342.1\|668981_669368_+	hypothetical protein	A0A1C8E984	Bacillus_phage	7.3e-66	100.0
WP_000383689.1\|669406_669595_+	hypothetical protein	A0A1C8E979	Bacillus_phage	1.6e-31	100.0
WP_044797837.1\|669611_673133_+\|tail	phage tail tape measure protein	A0A1C8E982	Bacillus_phage	1.2e-295	100.0
WP_044797838.1\|673134_673818_+\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	4.3e-130	100.0
WP_044797839.1\|673814_676157_+\|tail	phage tail protein	A0A1C8E983	Bacillus_phage	0.0e+00	100.0
WP_044797840.1\|676171_677446_+\|plate	BppU family phage baseplate upper protein	A0A1C8E978	Bacillus_phage	7.1e-243	100.0
WP_000392439.1\|677541_677772_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	5.7e-34	100.0
WP_044797842.1\|677768_678821_+	N-acetylmuramoyl-L-alanine amidase	A0A1C8E990	Bacillus_phage	3.5e-203	100.0
WP_000119474.1\|679341_679671_-	hypothetical protein	A0A1C8E989	Bacillus_phage	2.8e-50	100.0
WP_044797843.1\|679735_680407_-	hypothetical protein	A0A1C8E993	Bacillus_phage	1.0e-115	100.0
679756:679770	attR	NA	NA	NA	NA
WP_044797844.1\|680557_680776_+	hypothetical protein	A0A1C8E991	Bacillus_phage	7.0e-34	100.0
WP_044797845.1\|680799_681093_+	YolD-like family protein	A0A1C8E992	Bacillus_phage	2.6e-47	100.0
WP_044797846.1\|681109_681937_-	helix-turn-helix domain-containing protein	A0A1C8EA76	Bacillus_phage	5.1e-149	100.0
WP_016078612.1\|683472_684408_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_000758976.1\|684422_685349_+	ribose ABC transporter substrate-binding protein RbsB	NA	NA	NA	NA
WP_000667666.1\|685383_686031_+	fructose-6-phosphate aldolase	G8EY84	Synechococcus_phage	5.1e-48	48.8
WP_001252976.1\|686413_688813_+\|protease	M6 family metalloprotease immune inhibitor InhA	NA	NA	NA	NA

DBSCAN-SWA_4

1167348 : 1254354

Bacillus_phage(42.86%)

tail,head,terminase,portal,tRNA,integrase,capsid,transposase,holin,protease

attL 1182850:1182867|attR 1214029:1214046

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044797875.1\|1167348_1169127_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	2.7e-22	27.1
WP_044797876.1\|1169157_1170561_-	recombinase family protein	A0A2I7SDG6	Paenibacillus_phage	3.1e-114	44.8
WP_000289676.1\|1170673_1170892_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044797877.1\|1170907_1171591_-	LexA family transcriptional regulator	A0A2I6PF08	Staphylococcus_phage	4.5e-18	31.9
WP_000385075.1\|1171741_1172014_+	helix-turn-helix transcriptional regulator	A0A141E0W0	Streptococcus_phage	2.3e-10	50.0
WP_000014073.1\|1172079_1172244_+	hypothetical protein	NA	NA	NA	NA
WP_175566458.1\|1172312_1172480_+	hypothetical protein	A0A1B2APZ0	Phage_Wrath	2.8e-14	76.4
WP_175566457.1\|1172480_1172636_+	hypothetical protein	A0A1C8E9A0	Bacillus_phage	7.7e-19	88.0
WP_044797878.1\|1172648_1173410_+	ORF6C domain-containing protein	A0A2H4JBC7	uncultured_Caudovirales_phage	4.5e-128	93.3
WP_001187283.1\|1173421_1173610_+	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	2.6e-13	62.9
WP_044797879.1\|1173636_1174065_+	hypothetical protein	A0A0S2MVA8	Bacillus_phage	6.4e-71	97.2
WP_044797880.1\|1174082_1174796_+	hypothetical protein	A0A2H4JC60	uncultured_Caudovirales_phage	1.2e-125	97.5
WP_014894867.1\|1174795_1175011_+	hypothetical protein	A0A2H4J3B2	uncultured_Caudovirales_phage	2.0e-28	90.1
WP_042597302.1\|1174943_1175282_+	hypothetical protein	A0A2H4J6H7	uncultured_Caudovirales_phage	6.2e-53	99.1
WP_044797881.1\|1175367_1176285_+	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	9.6e-125	91.5
WP_044797815.1\|1176296_1176776_+	hypothetical protein	A0A1C8E9A8	Bacillus_phage	8.4e-80	94.3
WP_000139235.1\|1176768_1176999_+	hypothetical protein	A0A1C8E9C2	Bacillus_phage	2.5e-34	100.0
WP_044797816.1\|1177022_1177616_+	hypothetical protein	A0A1C8E9A7	Bacillus_phage	1.1e-84	97.5
WP_044797817.1\|1177648_1178197_+	hypothetical protein	A0A2H4J8I5	uncultured_Caudovirales_phage	4.4e-48	53.8
WP_044797882.1\|1178235_1178670_+	hypothetical protein	A0A2H4JBD8	uncultured_Caudovirales_phage	3.9e-76	94.4
WP_001093039.1\|1178838_1179630_+	prohibitin family protein	A0A1C8E9A9	Bacillus_phage	6.8e-143	100.0
WP_175566456.1\|1179711_1179876_+	hypothetical protein	A0A068EMC2	Bacillus_phage	7.4e-20	79.2
WP_000331717.1\|1179911_1180439_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.9e-88	91.4
WP_042596893.1\|1180435_1180759_+	hypothetical protein	A0A2H4JAV2	uncultured_Caudovirales_phage	4.7e-42	74.8
WP_044797884.1\|1180959_1181346_+	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	9.8e-47	74.4
WP_044798211.1\|1181628_1181964_+	hypothetical protein	A0A1C8E9B9	Bacillus_phage	6.0e-16	70.5
WP_044797885.1\|1181969_1182404_+	hypothetical protein	Q2I8B8	Bacillus_phage	2.2e-18	58.5
WP_044797886.1\|1182463_1182772_+	HNH endonuclease	A0A1B0YEC6	Lactobacillus_phage	1.2e-18	48.5
1182850:1182867	attL	NA	NA	NA	NA
WP_044798212.1\|1182963_1183422_+	hypothetical protein	NA	NA	NA	NA
WP_044797888.1\|1183514_1183877_+	hypothetical protein	A0A290GJQ7	Caldibacillus_phage	1.7e-16	41.0
WP_044797889.1\|1183873_1185574_+\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.6e-245	71.6
WP_044797890.1\|1185587_1186766_+\|portal	phage portal protein	A0A0A8WJ25	Clostridium_phage	5.5e-141	61.6
WP_001236353.1\|1186900_1188130_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.7e-84	48.5
WP_044797892.1\|1188500_1189085_+\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.0e-31	44.1
WP_044797893.1\|1189101_1190286_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	5.6e-08	23.1
WP_001016250.1\|1190301_1190559_+	hypothetical protein	A6XMJ7	Bacillus_virus	1.1e-06	43.2
WP_044797895.1\|1190555_1190828_+	DNA-packaging protein	R9TMB7	Paenibacillus_phage	3.6e-19	55.1
WP_042596912.1\|1190824_1191124_+\|head	phage head closure protein	NA	NA	NA	NA
WP_044797896.1\|1191116_1191473_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	3.6e-35	61.5
WP_044797897.1\|1191469_1191799_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	4.4e-48	84.4
WP_044797898.1\|1191799_1192393_+\|tail	phage tail protein	D2XR23	Bacillus_phage	6.1e-104	93.8
WP_000415931.1\|1192399_1192762_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	1.4e-42	71.7
WP_044797899.1\|1192992_1194237_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	8.6e-177	81.6
WP_044797901.1\|1195880_1198898_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	0.0e+00	99.9
WP_024086117.1\|1198969_1199890_-\|integrase	tyrosine-type recombinase/integrase	A0A0A7AR08	Bacillus_phage	3.6e-172	100.0
WP_024086118.1\|1200045_1200303_+	hypothetical protein	A0A125RQ77	Bacillus_phage	1.4e-41	100.0
WP_024086119.1\|1200271_1200535_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A125RQ76	Bacillus_phage	3.4e-43	100.0
WP_044797902.1\|1201812_1203282_+\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	1.3e-232	78.9
WP_044797903.1\|1203278_1207667_+\|tail	phage tail protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	58.1
WP_044797904.1\|1207683_1208061_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	6.5e-43	66.4
WP_044797905.1\|1208098_1208524_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.3e-71	99.3
WP_044797906.1\|1208523_1209459_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	2.7e-154	82.3
WP_044797907.1\|1210013_1211117_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	6.9e-186	92.5
WP_044797908.1\|1211259_1211700_-	DnaD domain protein	NA	NA	NA	NA
WP_044797909.1\|1211757_1212726_-	helix-turn-helix domain-containing protein	A0A0S2MVF4	Bacillus_phage	1.4e-137	78.8
WP_000159539.1\|1213203_1214163_+	ferrochelatase	NA	NA	NA	NA
1214029:1214046	attR	NA	NA	NA	NA
WP_001069166.1\|1214222_1215689_+	catalase	A0A2K9L572	Tupanvirus	1.7e-123	47.8
WP_044797910.1\|1215933_1217166_-	ammonium transporter	NA	NA	NA	NA
WP_033668897.1\|1217324_1218680_+	alpha-amylase	NA	NA	NA	NA
WP_000397873.1\|1218977_1219874_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001040146.1\|1220725_1221217_-	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_000281261.1\|1221447_1222302_+	hypothetical protein	NA	NA	NA	NA
WP_001214205.1\|1222356_1223214_-	peptidylprolyl isomerase PrsA	NA	NA	NA	NA
WP_001120851.1\|1223343_1223475_-	DUF3941 domain-containing protein	NA	NA	NA	NA
WP_000364431.1\|1223575_1224433_+	YitT family protein	NA	NA	NA	NA
WP_000527408.1\|1224458_1224656_-	DUF3813 domain-containing protein	NA	NA	NA	NA
WP_000516816.1\|1224656_1224797_-	hypothetical protein	NA	NA	NA	NA
WP_001041241.1\|1224902_1225712_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_000531422.1\|1226202_1226382_+	YjzC family protein	NA	NA	NA	NA
WP_000365378.1\|1226593_1229194_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	6.3e-121	37.4
WP_001211116.1\|1229232_1229415_-	YjzD family protein	NA	NA	NA	NA
WP_000028706.1\|1229571_1230306_+	hypothetical protein	NA	NA	NA	NA
WP_000486171.1\|1230335_1231208_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_001003335.1\|1231262_1231439_+	ComZ family protein	NA	NA	NA	NA
WP_001100533.1\|1231670_1232603_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_000412645.1\|1232634_1233873_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_000538198.1\|1233980_1234769_+	hypothetical protein	NA	NA	NA	NA
WP_000966119.1\|1234912_1235659_+	YjbA family protein	A0A0A0RP53	Bacillus_phage	3.6e-45	41.6
WP_000110979.1\|1235936_1236926_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_001045002.1\|1237323_1237704_-	DUF3899 domain-containing protein	NA	NA	NA	NA
WP_000727209.1\|1238023_1239679_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000534168.1\|1239807_1240737_+	ABC transporter permease	NA	NA	NA	NA
WP_000974107.1\|1240733_1241750_+	ABC transporter permease	NA	NA	NA	NA
WP_000854341.1\|1241770_1242814_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.1e-19	29.6
WP_000166354.1\|1242806_1243742_+	ATP-binding cassette domain-containing protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	4.9e-07	25.1
WP_002083070.1\|1243799_1245242_-	MATE family efflux transporter	NA	NA	NA	NA
WP_000727253.1\|1245593_1247240_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000559983.1\|1247267_1247471_-	hypothetical protein	NA	NA	NA	NA
WP_000258267.1\|1248062_1248458_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_000362600.1\|1248507_1249182_-	TerC family protein	W8EBD0	Pseudomonas_phage	3.4e-26	43.1
WP_000350716.1\|1249527_1250211_+	adaptor protein MecA	NA	NA	NA	NA
WP_000799189.1\|1250283_1251828_+	cardiolipin synthase	NA	NA	NA	NA
WP_001053969.1\|1252917_1254354_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1917164 : 1962951

Bacillus_phage(84.75%)

capsid,terminase,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755512.1\|1917164_1918457_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.2e-10	37.5
WP_001194308.1\|1918556_1919321_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_044797938.1\|1919557_1921132_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.9e-285	100.0
WP_000649486.1\|1921109_1922492_-	recombinase family protein	B8R885	Bacillus_phage	3.8e-266	100.0
WP_001137803.1\|1922491_1923124_-	helix-turn-helix domain-containing protein	W8CZ28	Bacillus_phage	2.1e-110	100.0
WP_016064699.1\|1923374_1923623_+	helix-turn-helix transcriptional regulator	W8CYU5	Bacillus_phage	8.3e-39	100.0
WP_016064700.1\|1923738_1923975_+	hypothetical protein	W8CYL8	Bacillus_phage	6.4e-33	100.0
WP_016064701.1\|1923967_1924237_+	hypothetical protein	W8CYE5	Bacillus_phage	4.0e-47	100.0
WP_016064702.1\|1924236_1924410_+	hypothetical protein	W8CZ30	Bacillus_phage	1.2e-23	100.0
WP_016064703.1\|1924422_1924908_+	siphovirus Gp157 family protein	W8CYU7	Bacillus_phage	3.5e-81	100.0
WP_016064704.1\|1924918_1925122_+	hypothetical protein	K4LP06	Bacillus_virus	1.4e-28	100.0
WP_016064705.1\|1925108_1925765_+	ERF family protein	W8CYS2	Bacillus_phage	1.5e-100	100.0
WP_016064706.1\|1925764_1926079_+	hypothetical protein	W8CYL9	Bacillus_phage	1.5e-53	100.0
WP_016064707.1\|1926107_1926641_+	hypothetical protein	W8CYE6	Bacillus_phage	1.3e-81	100.0
WP_016064708.1\|1926643_1927231_+	hypothetical protein	W8CZ31	Bacillus_phage	3.4e-107	100.0
WP_052574927.1\|1927230_1928064_+	hypothetical protein	W8CYV0	Bacillus_phage	9.0e-162	100.0
WP_016064710.1\|1928126_1928822_+	Rha family transcriptional regulator	W8CYS3	Bacillus_phage	7.8e-127	100.0
WP_044798217.1\|1928988_1929444_+	hypothetical protein	W8CYM0	Bacillus_phage	9.7e-86	100.0
WP_016064712.1\|1929436_1929643_+	hypothetical protein	W8CYE7	Bacillus_phage	2.5e-33	100.0
WP_016064713.1\|1929644_1929782_+	hypothetical protein	W8CZ32	Bacillus_phage	7.8e-23	100.0
WP_044797940.1\|1930061_1930565_+	hypothetical protein	W8CYS4	Bacillus_phage	1.4e-69	100.0
WP_000730536.1\|1930695_1930896_+	NINE protein	W8CYM1	Bacillus_phage	2.1e-32	100.0
WP_016064715.1\|1930933_1932268_+	helicase DnaB	W8CYE8	Bacillus_phage	2.6e-256	100.0
WP_016064717.1\|1932461_1932677_+	hypothetical protein	K4LP17	Bacillus_virus	1.4e-34	100.0
WP_103599638.1\|1932616_1932904_+	hypothetical protein	W8CYS5	Bacillus_phage	4.3e-47	100.0
WP_016064719.1\|1932900_1933047_+	hypothetical protein	W8CYM2	Bacillus_phage	6.8e-17	100.0
WP_016064720.1\|1933018_1933618_+	DUF1064 domain-containing protein	W8CYE9	Bacillus_phage	1.4e-111	100.0
WP_153598355.1\|1933614_1933770_+	hypothetical protein	A0A1B1P7H5	Bacillus_phage	2.9e-18	94.1
WP_016064721.1\|1933769_1933922_+	hypothetical protein	W8CZ34	Bacillus_phage	2.8e-21	100.0
WP_016064723.1\|1934274_1934439_+	hypothetical protein	W8CYS6	Bacillus_phage	8.4e-24	100.0
WP_016064724.1\|1934556_1934835_+	hypothetical protein	K4LPB5	Bacillus_virus	4.0e-50	100.0
WP_016064725.1\|1935136_1935379_+	hypothetical protein	W8CYF0	Bacillus_phage	2.3e-38	100.0
WP_015994878.1\|1936845_1937130_+	hypothetical protein	W8CYW3	Bacillus_phage	7.7e-49	100.0
WP_016064726.1\|1937101_1937365_+	hypothetical protein	W8CYS7	Bacillus_phage	2.2e-45	100.0
WP_000432374.1\|1937364_1937634_+	hypothetical protein	W8CYM4	Bacillus_phage	4.6e-43	100.0
WP_016064727.1\|1937728_1938208_+\|terminase	terminase small subunit	W8CYF1	Bacillus_phage	3.2e-87	100.0
WP_016064728.1\|1938382_1939702_+\|terminase	PBSX family phage terminase large subunit	W8CZ36	Bacillus_phage	2.7e-261	100.0
WP_016064729.1\|1939716_1941189_+\|portal	phage portal protein	W8CYW5	Bacillus_phage	4.4e-281	100.0
WP_016064730.1\|1941192_1942218_+\|capsid	minor capsid protein	K4LP29	Bacillus_virus	2.3e-191	100.0
WP_016064731.1\|1942226_1942427_+	hypothetical protein	W8CYM5	Bacillus_phage	4.5e-27	100.0
WP_016064732.1\|1942527_1943151_+	DUF4355 domain-containing protein	W8CZ37	Bacillus_phage	1.4e-90	100.0
WP_016064733.1\|1943227_1944064_+	hypothetical protein	W8CYW9	Bacillus_phage	5.3e-154	100.0
WP_000782183.1\|1944100_1944466_+	hypothetical protein	W8CYS9	Bacillus_phage	7.1e-63	100.0
WP_001216890.1\|1944469_1944802_+	hypothetical protein	W8CYM6	Bacillus_phage	3.1e-57	100.0
WP_000503577.1\|1944801_1945218_+	hypothetical protein	W8CYF3	Bacillus_phage	8.9e-70	100.0
WP_016064734.1\|1945214_1945616_+	hypothetical protein	W8CZ38	Bacillus_phage	1.6e-71	100.0
WP_016064735.1\|1945634_1946300_+	hypothetical protein	W8CYX2	Bacillus_phage	5.7e-127	100.0
WP_000446742.1\|1946365_1946785_+	hypothetical protein	W8CYT0	Bacillus_phage	3.3e-72	100.0
WP_015994840.1\|1946805_1947078_+	hypothetical protein	W8CYM7	Bacillus_phage	1.0e-45	100.0
WP_016064737.1\|1947080_1949924_+\|tail	phage tail tape measure protein	K4LRV6	Bacillus_virus	0.0e+00	100.0
WP_044797944.1\|1949935_1951450_+\|tail	phage tail family protein	W8CYX4	Bacillus_phage	3.0e-301	100.0
WP_044797945.1\|1951453_1956814_+	phage minor structural protein	K4LNZ9	Bacillus_virus	0.0e+00	99.9
WP_000427019.1\|1956823_1957111_+	hypothetical protein	W8CZ40	Bacillus_phage	6.2e-46	100.0
WP_016064697.1\|1957169_1957961_+	N-acetylmuramoyl-L-alanine amidase	K4LP86	Bacillus_virus	3.5e-155	100.0
WP_044797946.1\|1957992_1958250_+	multidrug transporter	W8CYT2	Bacillus_phage	4.4e-27	100.0
WP_000612415.1\|1958290_1958968_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.0e-123	99.6
WP_016077844.1\|1958964_1960038_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	2.2e-192	100.0
WP_000818985.1\|1960265_1960985_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_002083265.1\|1961697_1961952_+	hypothetical protein	W8CYN0	Bacillus_phage	4.5e-40	100.0
WP_001258547.1\|1962081_1962951_+	aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	1.6e-65	44.2

DBSCAN-SWA_6

2140712 : 2147626

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000427801.1\|2140712_2140988_+	stage V sporulation protein S	J9PTX7	Bacillus_phage	2.9e-08	41.2
WP_003277991.1\|2141186_2141450_+	hypothetical protein	A0A218KBU4	Bacillus_phage	4.4e-06	38.9
WP_000456183.1\|2142096_2142444_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	6.6e-10	27.5
WP_000109855.1\|2142634_2143708_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.9e-74	42.3
WP_000709202.1\|2143704_2143830_+	hypothetical protein	NA	NA	NA	NA
WP_000499713.1\|2144149_2144977_-	hypothetical protein	NA	NA	NA	NA
WP_000165966.1\|2145086_2145734_+	HD domain-containing protein	S4W232	Pandoravirus	2.5e-10	28.3
WP_000783164.1\|2145730_2147626_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	4.9e-46	25.3

DBSCAN-SWA_7

2595518 : 2687729

Bacillus_phage(61.22%)

tail,head,portal,terminase,tRNA,integrase,capsid,transposase,bacteriocin,protease

attL 2632595:2632611|attR 2675414:2675430

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000558613.1\|2595518_2597072_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_016077648.1\|2597131_2597560_-	cell wall hydrolase	NA	NA	NA	NA
WP_000285653.1\|2597710_2598625_+	acetamidase/formamidase family protein	NA	NA	NA	NA
WP_000238992.1\|2598752_2599460_+	response regulator transcription factor	NA	NA	NA	NA
WP_002082724.1\|2599456_2600440_+	sensor histidine kinase	NA	NA	NA	NA
WP_000354655.1\|2600641_2601538_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.0e-05	33.7
WP_000395988.1\|2601596_2602586_-	aldo/keto reductase family protein	NA	NA	NA	NA
WP_002082721.1\|2603104_2604733_+	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	1.2e-53	34.3
WP_000503550.1\|2604753_2605347_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016077647.1\|2606077_2606848_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	38.5
WP_016077646.1\|2606822_2608754_+	ABC transporter permease	NA	NA	NA	NA
WP_000975387.1\|2608804_2609491_+	hypothetical protein	NA	NA	NA	NA
WP_001165517.1\|2609568_2609910_-	DUF3914 domain-containing protein	NA	NA	NA	NA
WP_044797970.1\|2610186_2611428_+	lipase	NA	NA	NA	NA
WP_000701766.1\|2611515_2612541_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_000471637.1\|2612630_2614079_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_016077645.1\|2614083_2614998_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_016077644.1\|2615304_2615994_+	thiaminase II	NA	NA	NA	NA
WP_002082716.1\|2616391_2616655_+	DUF3937 domain-containing protein	NA	NA	NA	NA
WP_001071349.1\|2617108_2617438_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_042598145.1\|2617931_2618417_+	hypothetical protein	NA	NA	NA	NA
WP_000736198.1\|2618723_2619425_+	DUF3962 domain-containing protein	NA	NA	NA	NA
WP_000675852.1\|2619463_2620573_-\|integrase	tyrosine-type recombinase/integrase	A0A0U3U8Y8	Bacillus_phage	5.7e-148	79.7
WP_080893239.1\|2621675_2622869_+	helix-turn-helix transcriptional regulator	A0A0S2MVK2	Bacillus_phage	1.7e-126	59.2
WP_164852155.1\|2622910_2623063_+	hypothetical protein	NA	NA	NA	NA
WP_164852160.1\|2623222_2623360_+	hypothetical protein	NA	NA	NA	NA
WP_000427704.1\|2623389_2623749_-	helix-turn-helix transcriptional regulator	A0A0A7AR52	Bacillus_phage	7.8e-22	43.9
WP_044797971.1\|2623919_2624123_+	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	4.4e-14	59.7
WP_044797972.1\|2624328_2624595_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	2.7e-35	89.4
WP_044797973.1\|2624594_2624759_+	hypothetical protein	A0A0U3B230	Bacillus_phage	5.1e-21	90.7
WP_044797974.1\|2624788_2624965_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	1.5e-23	89.7
WP_044797975.1\|2624969_2625716_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	2.0e-104	93.5
WP_044797976.1\|2625684_2626488_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	7.3e-145	98.5
WP_044797977.1\|2626503_2626698_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	2.2e-26	85.9
WP_000805174.1\|2626723_2626897_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_044797978.1\|2626911_2627166_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.4e-36	88.1
WP_044797979.1\|2627177_2627603_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	2.1e-13	41.9
WP_044797980.1\|2627618_2628074_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	9.3e-20	46.8
WP_044797981.1\|2628112_2628502_+	hypothetical protein	NA	NA	NA	NA
WP_044797982.1\|2628956_2629823_-	hypothetical protein	NA	NA	NA	NA
WP_044797983.1\|2630118_2630766_-	exosporium leader peptide-containing protein	NA	NA	NA	NA
WP_044797984.1\|2631282_2632581_-	collagen-like protein	A0A285PWR0	Cedratvirus	4.4e-38	62.6
2632595:2632611	attL	NA	NA	NA	NA
WP_044797986.1\|2634332_2634989_+	hypothetical protein	NA	NA	NA	NA
WP_044797988.1\|2635147_2635318_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	2.1e-09	64.3
WP_044797991.1\|2635345_2635828_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	2.5e-71	83.1
WP_044797992.1\|2635827_2636370_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.5e-85	88.3
WP_044797993.1\|2636644_2637103_+	hypothetical protein	NA	NA	NA	NA
WP_044797994.1\|2638295_2638517_+	hypothetical protein	B5LPQ8	Bacillus_virus	1.1e-26	88.4
WP_044797995.1\|2638530_2638794_+	hypothetical protein	A0A1B1P745	Bacillus_phage	1.3e-05	42.5
WP_044797997.1\|2638759_2639095_+	HNH endonuclease	D2XR61	Bacillus_phage	3.6e-53	91.9
WP_000763337.1\|2639247_2639604_+	hypothetical protein	A0A2H4JBV9	uncultured_Caudovirales_phage	1.4e-58	99.2
WP_000635289.1\|2639600_2641256_+\|terminase	terminase large subunit	A0A2H4JI41	uncultured_Caudovirales_phage	0.0e+00	95.8
WP_044797998.1\|2641261_2642425_+\|portal	phage portal protein	D2XR16	Bacillus_phage	9.8e-183	88.4
WP_000216410.1\|2642408_2643191_+\|protease	Clp protease ClpP	R9TLM7	Paenibacillus_phage	1.9e-57	52.8
WP_044797999.1\|2643194_2644349_+\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	2.0e-199	90.4
WP_044798000.1\|2644354_2644648_+	hypothetical protein	D2XR19	Bacillus_phage	5.3e-45	93.8
WP_044798001.1\|2644649_2645003_+\|head	phage head closure protein	A0A2H4JGG7	uncultured_Caudovirales_phage	6.6e-58	95.7
WP_044798002.1\|2645004_2645346_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	9.9e-51	92.0
WP_044798003.1\|2645345_2645675_+	hypothetical protein	D2XR22	Bacillus_phage	1.5e-48	88.1
WP_001004914.1\|2645675_2646263_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	3.3e-86	81.0
WP_000415921.1\|2646267_2646630_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.8e-57	90.0
WP_044798004.1\|2646683_2646845_+	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	4.3e-20	86.8
WP_044798005.1\|2646860_2648324_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	4.9e-187	85.4
WP_044798007.1\|2648546_2650712_+\|tail	phage tail tape measure protein, TP901 family, core region	A0A2H4JC82	uncultured_Caudovirales_phage	7.6e-96	82.6
WP_044798008.1\|2650753_2652229_+\|tail	phage tail family protein	D2XR27	Bacillus_phage	6.4e-163	58.4
WP_044798009.1\|2652225_2656959_+\|tail	phage tail protein	D2XR28	Bacillus_phage	0.0e+00	57.9
WP_000398730.1\|2656997_2657234_+	hemolysin XhlA family protein	A0A0A7AQY5	Bacillus_phage	2.5e-08	97.4
WP_000461723.1\|2657233_2657473_+	hypothetical protein	A0A0A7AR38	Bacillus_phage	1.2e-34	98.7
WP_044798010.1\|2657469_2658534_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	8.7e-202	96.6
WP_044798011.1\|2658967_2660158_+	AAA family ATPase	C7BGE8	Burkholderia_phage	7.8e-34	28.4
WP_044798012.1\|2660154_2660928_+	HNH endonuclease	NA	NA	NA	NA
WP_000626096.1\|2661616_2663299_+	DUF3893 domain-containing protein	NA	NA	NA	NA
WP_033668957.1\|2663506_2664274_+	DUF3959 family protein	NA	NA	NA	NA
WP_016077599.1\|2664418_2664835_+	DUF3995 domain-containing protein	NA	NA	NA	NA
WP_000878369.1\|2664957_2665161_+	hypothetical protein	NA	NA	NA	NA
WP_000416836.1\|2665489_2665702_-	hypothetical protein	NA	NA	NA	NA
WP_000565700.1\|2665911_2666916_+	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_000282691.1\|2667062_2667467_+	hypothetical protein	NA	NA	NA	NA
WP_000062093.1\|2667627_2668863_+	cytochrome P450	NA	NA	NA	NA
WP_000106404.1\|2669129_2670413_+	MFS transporter	NA	NA	NA	NA
WP_001069207.1\|2670402_2671035_+	Vat family streptogramin A O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.6e-25	43.1
WP_000046095.1\|2671105_2671261_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_000289121.1\|2671363_2671861_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000168021.1\|2672001_2673216_+	cytochrome P450	NA	NA	NA	NA
WP_000954440.1\|2673324_2673903_+	cysteine dioxygenase family protein	NA	NA	NA	NA
WP_000766389.1\|2674077_2674929_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_001088545.1\|2675351_2677139_+	PAS domain-containing protein	NA	NA	NA	NA
2675414:2675430	attR	NA	NA	NA	NA
WP_000743784.1\|2677373_2679500_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_002162782.1\|2679576_2680107_+	signal peptidase I	NA	NA	NA	NA
WP_000932152.1\|2680366_2681554_+	UDP-glucosyltransferase	A0A2H4ZK81	Cryptophlebia_leucotreta_granulosis_virus	4.0e-06	24.3
WP_000864388.1\|2681645_2682326_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_001038209.1\|2682735_2683284_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_016077598.1\|2683294_2684995_+	energy-coupling factor ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	2.1e-16	30.1
WP_016077597.1\|2684987_2685788_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_000120182.1\|2685924_2686032_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000348332.1\|2686132_2687392_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-24	29.1
WP_001074707.1\|2687516_2687729_-\|transposase	transposase	A0A0U3U8Y8	Bacillus_phage	1.8e-18	75.0

DBSCAN-SWA_8

3877162 : 3982631

108

Bacillus_phage(50.98%)

tail,head,portal,terminase,tRNA,integrase,capsid,coat,bacteriocin,protease

attL 3860385:3860402|attR 3973312:3973329

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3860385:3860402	attL	NA	NA	NA	NA
WP_001288799.1\|3877162_3877705_-\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_000870460.1\|3877831_3878263_-	RicAFT regulatory complex protein RicA family protein	NA	NA	NA	NA
WP_001005392.1\|3878266_3879796_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_000190155.1\|3880224_3881091_-	2-oxoacid:ferredoxin oxidoreductase subunit beta	NA	NA	NA	NA
WP_000625429.1\|3881077_3882835_-	2-oxoacid:acceptor oxidoreductase subunit alpha	NA	NA	NA	NA
WP_003279695.1\|3883060_3884020_-	dipeptidase	NA	NA	NA	NA
WP_000404341.1\|3884042_3884303_-	stage V sporulation protein SpoVS	J9PTX7	Bacillus_phage	8.4e-10	43.8
WP_001221092.1\|3884452_3885247_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_000099770.1\|3885405_3886971_-	ribonuclease Y	NA	NA	NA	NA
WP_001283853.1\|3887454_3888486_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	3.2e-137	71.5
WP_000990684.1\|3888629_3889868_-	competence/damage-inducible protein A	NA	NA	NA	NA
WP_001052967.1\|3889888_3890467_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_000137466.1\|3890532_3891447_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000574107.1\|3891468_3892254_-	DUF3388 domain-containing protein	NA	NA	NA	NA
WP_000114444.1\|3892392_3892641_-	DUF3243 domain-containing protein	NA	NA	NA	NA
WP_000759625.1\|3892716_3893430_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_000411972.1\|3893530_3894817_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	3.8e-10	28.4
WP_044798052.1\|3894817_3896092_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	9.2e-57	30.5
WP_000008857.1\|3896301_3897261_-	ABC transporter permease	NA	NA	NA	NA
WP_044798053.1\|3897261_3898320_-	ABC transporter permease	NA	NA	NA	NA
WP_000456930.1\|3898312_3899845_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-11	25.9
WP_000725767.1\|3899962_3901039_-	BMP family protein	A0A0A7DN02	Lactobacillus_phage	5.6e-47	33.6
WP_000114182.1\|3901131_3901857_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_016077342.1\|3902395_3904777_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.0e-89	51.4
WP_016077341.1\|3904989_3905193_-	YlzJ-like family protein	NA	NA	NA	NA
WP_000139825.1\|3905189_3905939_-	translocation-enhancing protein TepA	NA	NA	NA	NA
WP_000823089.1\|3906043_3907714_-	ribonuclease J	NA	NA	NA	NA
WP_000564762.1\|3908624_3909503_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_000692458.1\|3909514_3910747_-	aspartate kinase	NA	NA	NA	NA
WP_044798054.1\|3910770_3911817_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_001238645.1\|3911967_3912144_-	dipicolinate synthase	NA	NA	NA	NA
WP_044798055.1\|3912291_3912528_-	DUF3850 domain-containing protein	A0A059T699	Listeria_phage	4.6e-15	57.1
WP_044798056.1\|3912558_3913080_-	AAA family ATPase	NA	NA	NA	NA
WP_044798057.1\|3913079_3913466_-	ASCH domain-containing protein	Q6SE87	Lactobacillus_prophage	1.4e-32	53.2
WP_044798058.1\|3913443_3914490_-	hypothetical protein	Q6SE88	Lactobacillus_prophage	7.5e-81	45.6
WP_044798059.1\|3914963_3915464_+	hypothetical protein	NA	NA	NA	NA
WP_044798060.1\|3915852_3916662_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.0e-133	83.3
WP_001261076.1\|3916661_3916898_-\|bacteriocin	bacteriocin biosynthesis protein	A0A2H4JGN9	uncultured_Caudovirales_phage	1.7e-25	100.0
WP_044798061.1\|3916927_3917311_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.4e-45	70.6
WP_044798063.1\|3917332_3921652_-\|tail	phage tail protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	62.9
WP_044798064.1\|3921648_3923118_-\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	3.2e-231	78.7
WP_044798065.1\|3923159_3926786_-	membrane protein	A0A2H4JAI2	uncultured_Caudovirales_phage	8.4e-180	84.8
WP_000477703.1\|3926803_3926965_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	2.1e-19	81.1
WP_044798066.1\|3927018_3927381_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	6.2e-43	71.7
WP_001004907.1\|3927385_3927973_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.1e-87	82.1
WP_000176452.1\|3927973_3928309_-	hypothetical protein	D2XR22	Bacillus_phage	7.5e-51	89.9
WP_000064422.1\|3928305_3928650_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	2.4e-44	79.5
WP_001247293.1\|3928651_3929005_-\|head	phage head closure protein	A0A2H4JGG7	uncultured_Caudovirales_phage	4.3e-57	93.1
WP_000450783.1\|3929006_3929300_-	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	3.8e-43	87.6
WP_044798067.1\|3929305_3930457_-\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	6.7e-208	95.8
WP_044798228.1\|3930460_3931204_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.1e-107	82.6
WP_044798068.1\|3931203_3932349_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	1.8e-181	81.9
WP_044798069.1\|3932357_3934025_-\|terminase	terminase large subunit	D2XR15	Bacillus_phage	4.2e-304	90.3
WP_000301142.1\|3934021_3934333_-\|terminase	P27 family phage terminase small subunit	D2XR14	Bacillus_phage	7.9e-47	98.1
WP_044798070.1\|3934457_3934793_-	HNH endonuclease	D2XR61	Bacillus_phage	2.1e-53	92.8
WP_044798071.1\|3934789_3935218_-	hypothetical protein	Q2I8B8	Bacillus_phage	9.2e-54	78.5
WP_044798073.1\|3935210_3935465_-	hypothetical protein	NA	NA	NA	NA
WP_044798074.1\|3935478_3935658_-	hypothetical protein	NA	NA	NA	NA
WP_044798075.1\|3935701_3936454_-	hypothetical protein	NA	NA	NA	NA
WP_044798076.1\|3936990_3938019_-	hypothetical protein	NA	NA	NA	NA
WP_000434816.1\|3938625_3938826_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	74.2
WP_016108998.1\|3939344_3939887_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	5.0e-89	91.7
WP_044798077.1\|3939886_3940369_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.0e-72	82.5
WP_016077323.1\|3940396_3940567_-	hypothetical protein	A0A1B0T6D0	Bacillus_phage	1.1e-10	80.4
WP_044798080.1\|3942478_3942904_-	hypothetical protein	NA	NA	NA	NA
WP_044798229.1\|3942917_3943277_-	hypothetical protein	A0A0A7AR03	Bacillus_phage	2.0e-57	91.6
WP_175581932.1\|3943518_3943680_-	hypothetical protein	NA	NA	NA	NA
WP_016077319.1\|3943716_3943908_-	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	1.1e-14	63.5
WP_044798081.1\|3943980_3944343_-	hypothetical protein	D2XR47	Bacillus_phage	6.6e-53	85.8
WP_044798082.1\|3944317_3944506_-	hypothetical protein	D2XR45	Bacillus_phage	4.8e-15	83.6
WP_044798083.1\|3944508_3945831_-	replicative DNA helicase	D2XR44	Bacillus_phage	6.0e-237	95.2
WP_044798084.1\|3945827_3946778_-	DnaD domain protein	D2XR43	Bacillus_phage	5.2e-73	59.9
WP_044798085.1\|3947057_3947342_-	hypothetical protein	D2XR42	Bacillus_phage	4.3e-23	54.3
WP_000215316.1\|3947522_3947744_-	hypothetical protein	NA	NA	NA	NA
WP_000537277.1\|3947757_3948345_-	hypothetical protein	D2XR41	Bacillus_phage	2.2e-74	69.7
WP_001141264.1\|3948435_3948684_-	hypothetical protein	NA	NA	NA	NA
WP_044798086.1\|3948716_3948908_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016077312.1\|3949080_3949518_+	helix-turn-helix transcriptional regulator	D2XR39	Bacillus_phage	7.0e-33	59.9
WP_044798087.1\|3949530_3949962_+	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	1.2e-61	79.0
WP_044798088.1\|3949999_3950767_+	hypothetical protein	NA	NA	NA	NA
WP_044798089.1\|3950863_3952411_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	5.9e-143	53.4
WP_000954737.1\|3952865_3953768_-	dipicolinic acid synthetase subunit A	NA	NA	NA	NA
WP_016077306.1\|3953938_3954190_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000592996.1\|3954325_3955567_-	insulinase family protein	G3MBJ8	Bacillus_virus	5.8e-56	34.5
WP_000868231.1\|3955654_3956554_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000076742.1\|3956706_3958845_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_001229392.1\|3959005_3959275_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_000766703.1\|3959375_3960347_-	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	2.1e-05	31.8
WP_000399365.1\|3960390_3961314_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_000776437.1\|3961400_3961757_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_000634349.1\|3961772_3962054_-	DUF503 family protein	NA	NA	NA	NA
WP_000036346.1\|3962050_3964117_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.9e-19	25.9
WP_001286522.1\|3964121_3964433_-	YlxQ family RNA-binding protein	NA	NA	NA	NA
WP_000071123.1\|3964433_3964706_-	YlxR family protein	NA	NA	NA	NA
WP_000102599.1\|3964717_3965824_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_000359095.1\|3965841_3966312_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_000059996.1\|3966645_3970947_-	PolC-type DNA polymerase III	A0A0A8WJ41	Clostridium_phage	4.1e-24	39.6
WP_000814295.1\|3971071_3972772_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_001090241.1\|3972881_3974138_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
3973312:3973329	attR	NA	NA	NA	NA
WP_000790358.1\|3974155_3975298_-	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_000813589.1\|3975321_3976113_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_000971296.1\|3976130_3976907_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	9.0e-23	42.5
WP_000531505.1\|3976992_3977550_-	ribosome recycling factor	NA	NA	NA	NA
WP_000042669.1\|3977552_3978275_-	UMP kinase	NA	NA	NA	NA
WP_001018576.1\|3978341_3979229_-	elongation factor Ts	NA	NA	NA	NA
WP_000111485.1\|3979332_3980034_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_000421290.1\|3980382_3981162_-	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_000550084.1\|3981239_3982631_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.1e-47	29.9

DBSCAN-SWA_9

4552766 : 4637676

102

Bacillus_phage(88.52%)

tail,head,portal,terminase,tRNA,capsid,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002082112.1\|4552766_4553111_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|4553122_4553431_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_000855476.1\|4553600_4554989_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_000599047.1\|4555056_4555917_-	M50 family metallopeptidase	NA	NA	NA	NA
WP_000797477.1\|4555909_4556656_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000503309.1\|4556789_4557587_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_000391514.1\|4557589_4558276_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_000975762.1\|4558311_4558857_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_001135484.1\|4558871_4559723_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000466736.1\|4559764_4560784_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_001013396.1\|4560941_4561619_-	DNA repair protein RadC	NA	NA	NA	NA
WP_000720491.1\|4561665_4562241_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_042595877.1\|4562473_4563424_-	hypothetical protein	NA	NA	NA	NA
WP_000582079.1\|4563588_4564890_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_016077237.1\|4564983_4567629_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	5.5e-165	43.0
WP_000350652.1\|4568112_4569138_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_062804407.1\|4569204_4570206_-	stage VI sporulation protein D	NA	NA	NA	NA
WP_000712938.1\|4570286_4571573_-	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.7e-05	34.1
WP_001087080.1\|4571572_4572562_-	porphobilinogen synthase	NA	NA	NA	NA
WP_000992324.1\|4572582_4573335_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_001226403.1\|4573337_4574267_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_000009002.1\|4574282_4575116_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_000547868.1\|4575133_4576468_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_000133913.1\|4576884_4577337_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000359773.1\|4577339_4577756_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_000869118.1\|4577790_4578387_-	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
WP_000097281.1\|4578383_4580714_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.3e-177	43.7
WP_000119171.1\|4580896_4582567_-\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	8.7e-15	33.5
WP_000472289.1\|4582673_4583933_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-148	66.3
WP_000105215.1\|4584197_4585475_-	trigger factor	NA	NA	NA	NA
WP_000358275.1\|4585784_4586783_-	hypothetical protein	NA	NA	NA	NA
WP_044798102.1\|4586980_4587229_-	hypothetical protein	NA	NA	NA	NA
WP_000475202.1\|4587748_4588363_+	PH domain-containing protein	NA	NA	NA	NA
WP_000124591.1\|4588452_4588653_-	hypothetical protein	NA	NA	NA	NA
WP_000645510.1\|4589456_4589960_-	metallophosphoesterase	NA	NA	NA	NA
WP_000815946.1\|4589973_4590582_-	XTP/dITP diphosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	2.0e-14	34.4
WP_001261763.1\|4590593_4591331_-	ribonuclease PH	NA	NA	NA	NA
WP_001126747.1\|4591462_4592512_-	spore germination protein GerM	NA	NA	NA	NA
WP_000774005.1\|4592746_4593556_-	glutamate racemase	NA	NA	NA	NA
WP_000513862.1\|4593769_4595095_-	MFS transporter	NA	NA	NA	NA
WP_000728521.1\|4595608_4596292_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_001233010.1\|4596341_4596980_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002082076.1\|4597137_4597800_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_042631274.1\|4597907_4597982_-	hypothetical protein	NA	NA	NA	NA
WP_044798103.1\|4598016_4599471_-	recombinase family protein	A0A288WG52	Bacillus_phage	2.6e-233	96.5
WP_044798105.1\|4599568_4600432_-	helix-turn-helix domain-containing protein	A0A288WFZ2	Bacillus_phage	1.0e-147	95.1
WP_127057650.1\|4600446_4600566_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	2.0e-06	66.7
WP_153599615.1\|4600700_4600919_+	helix-turn-helix domain-containing protein	A0A288WG81	Bacillus_phage	1.2e-30	97.2
WP_044798107.1\|4600962_4601580_-	replication-relaxation family protein	Q2LIA9	Bacillus_phage	4.7e-107	93.7
WP_044798108.1\|4601521_4602703_-	cell division protein FtsK	Q3HKZ7	Bacillus_phage	6.2e-217	95.2
WP_044798109.1\|4602820_4603003_-	hypothetical protein	Q2I8E2	Bacillus_phage	9.4e-24	96.7
WP_044798110.1\|4603005_4603308_-	hypothetical protein	A0A288WG38	Bacillus_phage	2.4e-48	92.9
WP_044798111.1\|4603467_4603665_+	helix-turn-helix domain-containing protein	A0A288WG74	Bacillus_phage	8.3e-26	96.9
WP_044798112.1\|4603670_4604255_+	type IV secretory system conjugative DNA transfer family protein	A0A288WFT6	Bacillus_phage	3.5e-104	95.4
WP_044798113.1\|4604322_4604652_+	hypothetical protein	A0A288WGQ4	Bacillus_phage	6.6e-52	95.4
WP_044798114.1\|4604690_4605746_-	N-acetylmuramoyl-L-alanine amidase	D3WK93	Bacillus_phage	1.9e-193	95.2
WP_044798115.1\|4605742_4605982_-	hypothetical protein	A0A288WFV1	Bacillus_phage	1.2e-31	94.9
WP_044798117.1\|4605981_4606218_-	hemolysin XhlA family protein	A0A288WG97	Bacillus_phage	1.4e-16	97.8
WP_044798118.1\|4606256_4610321_-\|tail	tail fiber domain-containing protein	W8CYT7	Bacillus_phage	0.0e+00	90.4
WP_080893257.1\|4610317_4611799_-\|tail	phage tail family protein	H0USX4	Bacillus_phage	2.6e-281	93.3
WP_044798119.1\|4611813_4615665_-\|tail	phage tail tape measure protein	A0A288WG88	Bacillus_phage	0.0e+00	96.5
WP_175581933.1\|4615681_4615858_-	hypothetical protein	A0A288WGC4	Bacillus_phage	1.3e-25	96.6
WP_044798120.1\|4615887_4616205_-	hypothetical protein	A0A288WGA9	Bacillus_phage	4.9e-52	97.1
WP_044798121.1\|4616252_4616861_-\|tail	tail protein	A0A288WG55	Bacillus_phage	8.1e-104	98.5
WP_044798123.1\|4616861_4617221_-	DUF3168 domain-containing protein	Q2I8F3	Bacillus_phage	3.2e-60	95.8
WP_044798124.1\|4617217_4617658_-	HK97 gp10 family phage protein	A0A288WGB7	Bacillus_phage	4.2e-78	100.0
WP_044798125.1\|4617650_4617974_-\|head	phage head closure protein	Q2I8F5	Bacillus_phage	2.2e-55	97.2
WP_044798126.1\|4617970_4618261_-\|head,tail	phage gp6-like head-tail connector protein	A0A288WGQ6	Bacillus_phage	1.1e-45	96.9
WP_044798128.1\|4618278_4619448_-\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	1.6e-196	92.6
WP_044798129.1\|4619486_4620107_-\|head,protease	HK97 family phage prohead protease	Q2I8F8	Bacillus_phage	1.2e-110	98.1
WP_079245635.1\|4620069_4621368_-\|portal	phage portal protein	Q2LIC9	Bacillus_phage	3.2e-243	98.4
WP_044798130.1\|4621383_4623081_-\|terminase	terminase large subunit	A0A288WFW5	Bacillus_phage	0.0e+00	98.8
WP_044798131.1\|4623077_4623563_-\|terminase	phage terminase small subunit P27 family	Q2I8G1	Bacillus_phage	6.5e-80	96.9
WP_044798132.1\|4623663_4624047_-	HNH endonuclease	Q2I8B2	Bacillus_phage	2.6e-68	97.6
WP_044798237.1\|4624106_4624382_-	hypothetical protein	NA	NA	NA	NA
WP_044798133.1\|4624591_4624801_-	hypothetical protein	A0A1C8E9B9	Bacillus_phage	1.3e-16	67.2
WP_153599616.1\|4624813_4624954_-	hypothetical protein	A0A288WG60	Bacillus_phage	4.5e-18	78.3
WP_044798134.1\|4624968_4625223_-	hypothetical protein	A0A288WG25	Bacillus_phage	1.0e-39	92.9
WP_080893259.1\|4625227_4625449_-	hypothetical protein	Q2LI85	Bacillus_phage	5.6e-31	93.2
WP_044798239.1\|4625455_4625680_-	hypothetical protein	Q3HKX2	Bacillus_phage	1.7e-27	86.5
WP_044798135.1\|4625799_4626195_-	sigma-70 family RNA polymerase sigma factor	A0A288WFT8	Bacillus_phage	1.8e-64	96.2
WP_127057652.1\|4626369_4626492_-	DUF3983 domain-containing protein	A0A288WG42	Bacillus_phage	7.2e-12	87.5
WP_044798136.1\|4626645_4626834_-	hypothetical protein	Q3HKX5	Bacillus_phage	1.5e-21	87.1
WP_000539655.1\|4626982_4627150_-	hypothetical protein	A0A0M4RER6	Bacillus_phage	2.0e-20	87.3
WP_153599617.1\|4627211_4627370_-	hypothetical protein	NA	NA	NA	NA
WP_044798137.1\|4627409_4627709_-	hypothetical protein	A0A0M4REQ3	Bacillus_phage	2.0e-39	80.8
WP_044798138.1\|4627871_4628384_-	hypothetical protein	NA	NA	NA	NA
WP_044798140.1\|4628692_4629235_-	dUTP diphosphatase	A0A288WGA4	Bacillus_phage	1.9e-96	95.0
WP_044798142.1\|4629291_4629768_-	hypothetical protein	A0A288WFT9	Bacillus_phage	2.1e-91	95.6
WP_044798143.1\|4629764_4630511_-	sigma-70 family RNA polymerase sigma factor	Q2I8C6	Bacillus_phage	1.5e-128	95.2
WP_044798144.1\|4630503_4630737_-	hypothetical protein	A0A288WG45	Bacillus_phage	1.7e-30	87.0
WP_044798145.1\|4630755_4631667_-	ATP-binding protein	Q2I8C8	Bacillus_phage	5.9e-167	96.7
WP_044798146.1\|4631682_4632600_-	phage protein	Q2I8C9	Bacillus_phage	2.9e-145	96.7
WP_044798147.1\|4632727_4633378_-	hypothetical protein	A0A288WGQ2	Bacillus_phage	1.3e-115	93.5
WP_044798148.1\|4633384_4633762_-	hypothetical protein	A0A288WG31	Bacillus_phage	4.8e-62	96.8
WP_175581935.1\|4633789_4634497_-	ORF6C domain-containing protein	A0A288WG93	Bacillus_phage	3.4e-130	98.3
WP_175581934.1\|4634553_4634709_-	hypothetical protein	Q2I8D2	Bacillus_phage	3.3e-22	98.0
WP_175581929.1\|4634782_4634938_-	hypothetical protein	A0A288WFR7	Bacillus_phage	1.3e-18	92.2
WP_044798152.1\|4635034_4635262_-	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	2.7e-36	100.0
WP_103572836.1\|4635423_4635783_+	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	6.8e-58	99.2
WP_080893263.1\|4636115_4637402_-	hypothetical protein	A0A288WGM1	Bacillus_phage	1.4e-241	98.1
WP_044798153.1\|4637508_4637676_-	helix-turn-helix transcriptional regulator	A0A290GJH9	Caldibacillus_phage	1.2e-14	84.6

DBSCAN-SWA_10

4670355 : 4678043

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221121.1\|4670355_4671279_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-45	43.5
WP_000247674.1\|4671404_4672340_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-24	26.6
WP_000018046.1\|4672341_4673034_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	6.8e-06	26.9
WP_001293576.1\|4673204_4673378_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|4673378_4673573_+	YwbE family protein	NA	NA	NA	NA
WP_001255945.1\|4673612_4674812_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.0
WP_000587818.1\|4675106_4675430_+	heme oxygenase	NA	NA	NA	NA
WP_002162479.1\|4675502_4676267_-	class B sortase	NA	NA	NA	NA
WP_000403765.1\|4676299_4677070_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-13	28.6
WP_042595928.1\|4677059_4678043_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.4e-17	27.4

DBSCAN-SWA_11

5175493 : 5269748

102

Bacillus_phage(83.61%)

tail,head,portal,terminase,tRNA,integrase,capsid,holin,protease

attL 5261319:5261369|attR 5269977:5270027

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001021089.1\|5175493_5176756_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.5e-88	42.4
WP_042596460.1\|5177125_5178043_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_000573651.1\|5178426_5178822_-	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_000455073.1\|5179018_5180521_-	DUF4077 domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-07	27.8
WP_000714043.1\|5180553_5181612_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_000639338.1\|5181957_5182362_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000568577.1\|5182358_5182715_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000980956.1\|5182744_5182984_-	DUF3947 family protein	NA	NA	NA	NA
WP_000086300.1\|5183063_5183297_-	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_001293768.1\|5183456_5184650_-	MFS transporter	A0A2K5B2B5	Erysipelothrix_phage	3.2e-43	32.6
WP_042596467.1\|5184655_5186203_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	4.0e-46	27.3
WP_001071085.1\|5186639_5187155_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_001222628.1\|5187440_5187917_+	DUF4362 domain-containing protein	NA	NA	NA	NA
WP_000834707.1\|5187965_5188370_-	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_042596469.1\|5189854_5190412_+	cysteine hydrolase	A0A1V0SL12	Klosneuvirus	1.2e-05	27.5
WP_002083675.1\|5190448_5190883_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_042596471.1\|5191239_5192205_+	DUF4822 domain-containing protein	NA	NA	NA	NA
WP_002008929.1\|5192468_5192900_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_000926482.1\|5193067_5193649_+	carbonic anhydrase	NA	NA	NA	NA
WP_042598534.1\|5193704_5194154_+	cyanase	NA	NA	NA	NA
WP_042596474.1\|5194281_5195562_+	purine/pyrimidine permease	NA	NA	NA	NA
WP_000576735.1\|5195596_5197135_-	anthrolysin O/cereolysin O family cholesterol-dependent cytolysin	NA	NA	NA	NA
WP_000590056.1\|5197569_5198322_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_000631243.1\|5198318_5199383_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_000041823.1\|5199379_5200396_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.0e-58	36.8
WP_016078161.1\|5200415_5201435_-	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042596480.1\|5201820_5202498_-	response regulator transcription factor	NA	NA	NA	NA
WP_001123920.1\|5203379_5203847_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	5.4e-47	63.2
WP_044798170.1\|5204218_5206657_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.7e-91	40.6
WP_042596484.1\|5207149_5208226_+	hypothetical protein	A0A0S2MVF4	Bacillus_phage	7.6e-12	38.8
WP_042596487.1\|5208242_5208851_-	replication-relaxation family protein	W8CZ47	Bacillus_phage	3.3e-113	100.0
WP_042596489.1\|5208840_5210007_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	8.0e-225	100.0
WP_042596490.1\|5210017_5210338_-	hypothetical protein	W8CYN5	Bacillus_phage	7.1e-51	100.0
WP_127057661.1\|5210357_5210489_-	hypothetical protein	W8CYT8	Bacillus_phage	6.9e-21	100.0
WP_000264500.1\|5210812_5211037_+	hypothetical protein	A0A1B1P883	Bacillus_phage	1.3e-27	74.3
WP_042596492.1\|5211984_5212686_-	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	1.6e-124	92.8
WP_042596494.1\|5212685_5213111_-\|holin	phage holin family protein	H0USX7	Bacillus_phage	1.4e-70	97.9
WP_042596496.1\|5213185_5213410_-	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	1.4e-29	94.6
WP_042596497.1\|5213533_5217595_-\|tail	tail fiber domain-containing protein	W8CYT7	Bacillus_phage	0.0e+00	100.0
WP_044798171.1\|5217591_5219076_-\|tail	phage tail family protein	W8CYY9	Bacillus_phage	4.9e-296	100.0
WP_042596501.1\|5219087_5223011_-\|tail	phage tail tape measure protein	W8CZ45	Bacillus_phage	0.0e+00	100.0
WP_000344049.1\|5223025_5223202_-	hypothetical protein	W8CYG0	Bacillus_phage	6.7e-27	100.0
WP_042596503.1\|5223231_5223549_-	hypothetical protein	W8CYN3	Bacillus_phage	1.2e-53	100.0
WP_000896770.1\|5223595_5224204_-\|tail	tail protein	W8CYT6	Bacillus_phage	5.8e-102	100.0
WP_030022312.1\|5224204_5224564_-	DUF3168 domain-containing protein	W8CYY6	Bacillus_phage	5.9e-62	100.0
WP_044798172.1\|5224560_5224995_-	HK97 gp10 family phage protein	W8CZ44	Bacillus_phage	1.0e-76	100.0
WP_044798173.1\|5224987_5225311_-\|head	phage head closure protein	W8CYF9	Bacillus_phage	3.3e-56	99.1
WP_044798174.1\|5225297_5225585_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	8.9e-45	97.9
WP_044798175.1\|5225605_5226772_-\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	5.6e-210	100.0
WP_086405676.1\|5226809_5227520_-\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	1.5e-128	99.6
WP_042596516.1\|5227506_5228760_-\|portal	phage portal protein	H0USW4	Bacillus_phage	3.8e-241	99.3
WP_042596518.1\|5228948_5230643_-\|terminase	terminase large subunit	W8CZ43	Bacillus_phage	0.0e+00	100.0
WP_000233388.1\|5230644_5231148_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	8.0e-89	100.0
WP_044798176.1\|5231256_5231655_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	2.3e-67	96.8
WP_042597896.1\|5231644_5231899_-	hypothetical protein	W8CYT4	Bacillus_phage	1.5e-43	100.0
WP_000773601.1\|5232033_5232246_-	hypothetical protein	H0USV9	Bacillus_phage	1.0e-29	97.1
WP_044798177.1\|5232262_5232502_-	hypothetical protein	W8CZ42	Bacillus_phage	8.3e-20	100.0
WP_044798178.1\|5232518_5232716_-	hypothetical protein	W8CYF7	Bacillus_phage	9.8e-27	100.0
WP_044798179.1\|5232761_5232989_-	hypothetical protein	NA	NA	NA	NA
WP_000017440.1\|5233025_5233313_-	hypothetical protein	H0USV6	Bacillus_phage	1.7e-43	91.6
WP_002179614.1\|5233715_5233961_-	hypothetical protein	W8CYG8	Bacillus_phage	6.9e-38	100.0
WP_042596530.1\|5234167_5234710_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	8.6e-97	100.0
WP_042596531.1\|5234706_5235192_-	ArpU family transcriptional regulator	W8CYU4	Bacillus_phage	1.0e-85	100.0
WP_000866514.1\|5235219_5235384_-	hypothetical protein	W8CYZ7	Bacillus_phage	5.0e-16	100.0
WP_000965619.1\|5235549_5235831_-	hypothetical protein	A0A0S2GLD3	Bacillus_phage	8.7e-45	100.0
WP_000404183.1\|5237248_5237647_-	hypothetical protein	W8CYU3	Bacillus_phage	1.7e-70	100.0
WP_042596535.1\|5238000_5238300_-	hypothetical protein	W8CZ51	Bacillus_phage	7.9e-52	100.0
WP_000705116.1\|5238450_5238750_+	hypothetical protein	W8CYG6	Bacillus_phage	1.1e-50	100.0
WP_042596537.1\|5238746_5238962_-	aspartate ammonia-lyase	W8CYN9	Bacillus_phage	1.1e-36	100.0
WP_000817807.1\|5238979_5239144_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-24	100.0
WP_000436950.1\|5239215_5239482_-	hypothetical protein	W8CYZ5	Bacillus_phage	2.7e-43	100.0
WP_000705175.1\|5239523_5240336_-	ATP-binding protein	W8CZ50	Bacillus_phage	1.6e-155	100.0
WP_042596539.1\|5240298_5241315_-	hypothetical protein	W8CYG5	Bacillus_phage	3.8e-191	100.0
WP_042596541.1\|5241560_5242208_-	sigma-70 family RNA polymerase sigma factor	W8CYN8	Bacillus_phage	2.3e-117	100.0
WP_042596543.1\|5242482_5242797_-	hypothetical protein	W8CYU1	Bacillus_phage	9.8e-53	100.0
WP_042596545.1\|5242960_5243785_-	ORF6C domain-containing protein	A0A0S2MV65	Bacillus_phage	1.9e-116	77.0
WP_042596547.1\|5244002_5244191_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	2.5e-27	100.0
WP_000813894.1\|5244223_5244460_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	4.3e-37	100.0
WP_000511081.1\|5244608_5244953_+	helix-turn-helix transcriptional regulator	W8CZ48	Bacillus_phage	1.9e-57	100.0
WP_042596549.1\|5245353_5246592_-	hypothetical protein	W8CYT9	Bacillus_phage	3.1e-235	100.0
WP_042596551.1\|5247575_5248637_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	5.9e-158	75.9
WP_000761986.1\|5248698_5249439_-	carboxylesterase	NA	NA	NA	NA
WP_042596553.1\|5249600_5249834_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000078304.1\|5249928_5250621_-	LrgB family protein	NA	NA	NA	NA
WP_000673222.1\|5250617_5250986_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_001125040.1\|5251338_5252289_+	nucleoside hydrolase	NA	NA	NA	NA
WP_000103951.1\|5252339_5253635_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.1e-182	75.4
WP_001231141.1\|5253665_5255195_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_001231042.1\|5255191_5255947_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_001036332.1\|5255979_5257164_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_000161234.1\|5257301_5258306_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_001258185.1\|5258332_5259361_-	gapA transcriptional regulator CggR	NA	NA	NA	NA
WP_000869737.1\|5259497_5259743_-	glutaredoxin family protein	NA	NA	NA	NA
WP_000647951.1\|5259752_5261060_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
5261319:5261369	attL	NA	NA	NA	NA
WP_044798180.1\|5261709_5262192_-	hypothetical protein	NA	NA	NA	NA
WP_044798181.1\|5263618_5263978_-	hypothetical protein	NA	NA	NA	NA
WP_044798182.1\|5263996_5264602_-	hypothetical protein	NA	NA	NA	NA
WP_044798184.1\|5264623_5265019_-	hypothetical protein	NA	NA	NA	NA
WP_044798185.1\|5265018_5265285_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044798186.1\|5267397_5267601_-	hypothetical protein	NA	NA	NA	NA
WP_044798188.1\|5267712_5267985_-	hypothetical protein	NA	NA	NA	NA
WP_044798191.1\|5268767_5269748_-\|integrase	tyrosine-type recombinase/integrase	A7XX23	Thermus_virus	1.9e-09	25.9
5269977:5270027	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP010578

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010578_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010578_1

122545-122676

TypeV

Consensus_repeat	Method
CTGGTGTTCCTGGTGTTCCTGGTATTCCTG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP010578_1

>merge|NZ_CP010578|1|122545-122676|CRISPRCasFinder
CTAGTGTTCCCGGTGTTTTTGGCATACATGATTTTTCCATTCCTAGCGTTCCTGTTCCTGACGTTCCTGACGTTTCTGGTGTTCCTGGTGTTCCTGGTATTCCTGGTGTTCCTGGTGTTCCTGGTGTTCCTG

>NZ_CP010578|1|1|122545-122676|CRISPRCasFinder
CTAGTGTTCCCGGTGTTTTTGGCATACATG	ATTTTTCCATTCCTAGCG
TTCCTGTTCCTGACGTTCCTGACGTTTCTG	GTGTTCCTGGTGTTCCTGGTATTC
CTGGTGTTCCTGGTGTTCCTGGTGTTCCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010578.1\|WP_044798392.1\|123508_123934_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374754
NZ_CP010578.1\|WP_044798390.1\|117757_118741_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223613
NZ_CP010578.1\|WP_044798471.1\|125929_126325_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010578.1\|WP_127057688.1\|131750_131945_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010578.1\|WP_044798389.1\|108866_109253_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010578.1\|WP_044797953.1\|111373_113191_+\|maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|238828
NZ_CP010578.1\|WP_003319588.1\|105160_105475_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP010578.1\|WP_000272218.1\|124316_124580_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010578.1\|WP_127057687.1\|113294_115319_+\|TraM-recognition-domain-containing-protein	unknown	unknown	gnl\|CDD\|197911
NZ_CP010578.1\|WP_001020603.1\|115640_116201_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP010578.1\|WP_000633818.1\|125406_125691_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010578.1\|WP_044798388.1\|107389_108676_+\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NZ_CP010578.1\|WP_080893306.1\|109270_110782_+\|conjugal-transfer-protein-TraG	unknown	unknown	unknown
NZ_CP010578.1\|WP_044798398.1\|132851_134765_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|284995
NZ_CP010578.1\|WP_044798391.1\|118750_119677_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010578.1\|WP_044798387.1\|105495_106950_+\|cell-division-protein-FtsZ	unknown	unknown	gnl\|CDD\|276962
NZ_CP010578.1\|WP_044798394.1\|126918_127332_+\|HEPN-domain-containing-protein	unknown	unknown	gnl\|CDD\|368314
NZ_CP010578.1\|WP_044798395.1\|127816_128638_+\|DUF1837-domain-containing-protein	unknown	unknown	gnl\|CDD\|378078
NZ_CP010578.1\|WP_044798396.1\|128627_131780_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|224125
NZ_CP010578.1\|WP_044798393.1\|126545_126932_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393

Protein	Function_ID	Function_description	E-value
NZ_CP010578.1\|WP_044798392.1\|123508_123934_-\|hypothetical-protein	gnl\|CDD\|374754	pfam16723, DUF5065, Domain of unknown function (DUF5065). This family is found in found in Bacillus species. The function is not known.	0.000661086
NZ_CP010578.1\|WP_044798390.1\|117757_118741_+\|hypothetical-protein	gnl\|CDD\|223613	COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis].	2.56024e-06
NZ_CP010578.1\|WP_044798393.1\|126545_126932_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	6.47772e-12
NZ_CP010578.1\|WP_044797953.1\|111373_113191_+\|maturase	gnl\|CDD\|238828	cd01651, RT_G2_intron, RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin. RT transcribes DNA using RNA as template. Proteins in this subfamily are found in bacterial and mitochondrial group II introns. Their most probable ancestor was a retrotransposable element with both gag-like and pol-like genes. This subfamily of proteins appears to have captured the RT sequences from transposable elements, which lack long terminal repeats (LTRs).	3.17235e-88
NZ_CP010578.1\|WP_003319588.1\|105160_105475_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	0.000249044
NZ_CP010578.1\|WP_127057687.1\|113294_115319_+\|TraM-recognition-domain-containing-protein	gnl\|CDD\|197911	smart00843, Ftsk_gamma, This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding.	6.56125e-22
NZ_CP010578.1\|WP_001020603.1\|115640_116201_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	6.55944e-15
NZ_CP010578.1\|WP_044798394.1\|126918_127332_+\|HEPN-domain-containing-protein	gnl\|CDD\|368314	pfam05168, HEPN, HEPN domain.	4.29196e-25
NZ_CP010578.1\|WP_044798398.1\|132851_134765_+\|hypothetical-protein	gnl\|CDD\|284995	pfam07693, KAP_NTPase, KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.	0.00104646
NZ_CP010578.1\|WP_044798387.1\|105495_106950_+\|cell-division-protein-FtsZ	gnl\|CDD\|276962	cd02202, CetZ_tubulin-like, Cell-structure-related euryarchaeota tubulin/FtsZ homologs. CetZ proteins comprise a distinct tubulin/FtsZ family. The crystal structures of CetZ contain the FtsZ/tubulin superfamily fold and its family members have mosaic of tubulin-like and FtsZ-like amino acid residues. However, a recent study found that CetZ proteins (formerly annotated FtsZ type 2) are not required for cell division, whereas FtsZ proteins play an important role. Instead, CetZ proteins are shown to be involved in controlling archaeal cell shape dynamics. The results from inactivation studies of CetZ proteins in Haloferax volcanii suggest that CetZ1 is essential for normal swimming motility and rod-cell development.	1.1088e-15
NZ_CP010578.1\|WP_044798388.1\|107389_108676_+\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	4.68388e-21
NZ_CP010578.1\|WP_044798396.1\|128627_131780_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|224125	COG1204, COG1204, Superfamily II helicase [General function prediction only].	6.91608e-34
NZ_CP010578.1\|WP_044798395.1\|127816_128638_+\|DUF1837-domain-containing-protein	gnl\|CDD\|378078	pfam08878, DUF1837, Domain of unknown function (DUF1837). This family of proteins are functionally uncharacterized.	0.000232381

>NZ_CP010578.1|WP_044798391.1|118750_119677_+|hypothetical-protein
MRTIEEQLSTYIPSIPHLSNEDVQGLQIYRIHKLDKTYVFHSYDELVKFKQRLTEEQYALLTFIGVHMSVRFNHLLYLFKSKYSRKKINDALQGLLYYRLIEKWQVEIFDMKVFEETYTLSDNGYKLLKYWQGNMFFFAPERIDNHGKYIHLRYWHDIDLLCHLRYAPSFIGHIMHPSISKGIFTPPLSFAVQGGVDQVCNFVVYSTLLTDNKGRLKLIIASWKDFVESGKDVVIKDLGNNPTILVIYVSTKKQAKQINNELLLDLIPGKVLLCIGETLHIQGLQHAFYQPLAEGEIKQLNTKLFTAN
>NZ_CP010578.1|WP_044798390.1|117757_118741_+|hypothetical-protein
MAEEKTNTQTVEELGMAFESENPQADTLLETNFNQFERVREHELEELARMKRERTVGKGLVTVVSEKLFPTKNGTSERIQVLTMQIGTHTTAYCPITEAGINVPKNPQWLVGRTKPVIIEHFQKTEEGNFAVVSITAGEIALQKRLYEEVETQEGNKVYTGTVSGHIPSAQTVLVEVHGVTVGVRYSQWSHSFVRSEDIVIGDIVELVIDKVVEKNGRYEFRGNKKILETDPMEKLLELNKRRDRFIGKIVGVDAIAGIFVEVAPGIQFKGLKSRNLANPTPEDAINQTIVTCELLNIDAKNRRGTVRILNYPQGQSKKSNSSIYQF
>NZ_CP010578.1|WP_001020603.1|115640_116201_+|helix-turn-helix-transcriptional-regulator
MNIGKQIQYFRKRDNMSQEKLAEKIHVSRQSISNWENERNYPDIHNLLMMSILFNVSLDDLVKGDVKIMKEELQKSTFFKWSYIMLALMIILPISIAPVFYFFGYYGLIIPVVLTVLLMFSLQQVENIKKEHNLKTYRQIVDFIEGKPVSEVRPNIKDKLLKIGFMLASALISYSLIYLGLSVFGR
>NZ_CP010578.1|WP_127057687.1|113294_115319_+|TraM-recognition-domain-containing-protein
MEQGGILLVNTAKGELAELSNVLGKFVLLSMQNAVFRRKPNVSPYHHIIVDEFPDFVVRPFKEFPAQSRKYKVILTIASQTLSQLALDFTEQYMFTLLGSFRNKMIFGDVTPYDAKIFSDMFGEKEEFKEAESEQGISPMQDNPVSRLGSTYQKAKEVVMSPGDIMAQGAFICAARIVQDNHVQPVQQITSNFVPKEEFAQAIIQVDIETGQYWENERLRLINESIAKANPMKHVDAENMKKIQPLPPILEDEMKQNSSVETTEEQQHIVSLEDYKEHKSHNETLSNESAAMNQQGDVDKEAENKLYEEIKEFIIESQQVSPSHLQRKFKIGYMKAMQYIEKLEQNIVVSSYTGDGPRKVLISNNSSIPEEQSVNITHLSDNTISQEVAIPSENKGTIQEETSFFKDILYDDALSFVKESGSASIPVLQDTFKISYTHASRLIEALQRNGELPVIAEETQIESISTAITKPVVKEDIEKSIDIELPHMEECDEINMEVAELNIELSIPMLEQDWNMDSIIHSRIPDEIEPLLEEFPSDGLPVPIIETAETNIESASIPVIKTESDETYVEINTMPSAETLNHTEENKLDEDVAKVYESISITVHENLEKNREDHSRKDEKQPEYKRMSYKERQEHLKSQQKNKNNTTQSLLNKIEKPKQKTSNVMSKELNNLFD
>NZ_CP010578.1|WP_044797953.1|111373_113191_+|maturase
MRNPNEVLNSLRTMASNTDYKFKRLYRNLYNPEFYYMAYSKIYAKEGNMTKGTDGKNIDGMSIERINTLIDKIKHETYKPYPARRIYRKKANGGKRPLGIPSMDDKIIQEIIRSILESIYESTFSDDSHGFRPKKSCHTALIQIQKTYRGVRWFVEGDIKGFFDNINHHSLINILKRRIDDEKFIRLIWKFLRAGYLEEWTYNNTFSGTPQGGIISPILSNIYLNELDKFMKVYKQQFDKGTRRKTNRDYAYLSDKKYRLRKKHEEQWGQMSEDEKREVKLQWNKLHKEQLSIHSKEPMDENYKRIVYTRYADDFLIGIIGSKEDAIQVKENLTIFLKKTLELELSQEKTLITHSEKLVQFLGYDITISREEAIAKTTHRRTKRVFSFTPKLYVPKNKWIKNLFQKDALAIDKNTGTWKPKHRTYLKDNDDLEILSIYNAEIRGLYEYYKLANNVSVINKYKYIMEYSMYKTFASKYKKSVKQILNKYRINGKFGIRYKTKNGEKIRYLYDQGFRRQISIDTKTECDILPNTLKMSGRTSLIERLLAEECEVCGKKNQAIEIHHIRKLKDLKGKKMWEKMMIARKRKTMALCHQCHIDLHSGKLD
>NZ_CP010578.1|WP_080893306.1|109270_110782_+|conjugal-transfer-protein-TraG
METFKQRLPLFTTIGLISGFILSFGFGLVNYIKLLYYAFEPPSYPIEITYVPLILMFFSLLLGEFSFRFYSRIPALHVKNGKLIILITSHIAVDIQFLWFATAPIHAKVIPYLTDKSKHVNFGEYEAIGHVLTGNFHTLTMIFVFLPTVFMILFTLWYSGHIVRYREEILKWVQKYEYKNHKLQKWFNSQEEQIYPDVEIGPHIEHKEMVRIKGKDRTLNGIIIGPIGSGKTSSLIIPMINQDLHWMVRFINKFETAYKKKDYDTEEVKGTFLNGVTVIEPSNDLCQKVFKLVQAHKIPASSVYYIDPTNPDTKNINILRGPVDKVAEVFAMVIQGLSESNNAFFEQAQRNHLKQHIYLLKLHNPQKDVTFDDLISMYDDVERVHRMHKLLKIQVEKLYDFVQSGAASRDQKNEYQIIKGIDEWFNNTICEKTDFQGEPAVYKSGKYRGQLMHYDREEEYVKGLRNILKDLASNVLIRRVLFGKSDFDFDIHVRPYGHLEIQF
>NZ_CP010578.1|WP_044798389.1|108866_109253_+|hypothetical-protein
MDLQYATTITGGVLSAREAFKNPELVLKHMTEEGATFNVSLQDIQIPGKPNYYWYDVIIETATNKKIEVNIAVLSQEEYDQLCERSSIDLYLKQTEDAAKFFLKKSKEQFKPELHNRFTLHHKAQLYL
>NZ_CP010578.1|WP_044798388.1|107389_108676_+|replication-relaxation-family-protein
MKSKTYKYTSKGTQKSFRLKEADIFVFTFLYYKRHLTTRQITQLYSAFEGRDFSEDSVFTKLNRFSKYGAILSKKIDKRDDSITRRAIFSLKDKMVDYLQEIGKIPAGSSKRRYSSSISLHTLCSREILVRTLLELSKKTNTNKVLCELDIRSYHQKQKKTEIKDAGLLLIPDEHISYQDKNIYIEMDMCKETNATLVEKVGKYIEYAQKNNENITVIFVMYDKSMFLAEDAEPPYVRMKNLLFSMREYHELLMNLPNLNMHICSLKEAGDVISDIILGIDDNQNFEQDILLPLSQRTVGDADWRYAFVEKVQTFKETIDGGLRRTYRRDKDAMQDFFFIFGNENDYRMIARLDDVVFSRREGDEGVPLVVIYPKRKKARDILLMDTYDNVLLLSLQNESVTIDADEQIMARTANNIHPKRRKLVELY
>NZ_CP010578.1|WP_044798387.1|105495_106950_+|cell-division-protein-FtsZ
MLLNSNELEHIHSTNHSVNDISIRWGVIGAGQKGNKEADLFAGYKFSNGTTCYPTLAVNFAESDMMHLQNIIKEDRIHFDGLKGAARTPSVVTDLFDPETNPNANGYLDKLAQELGRKFTNEEGEVIVDQFLICLGAGGGVGTGWGSLVLQLIREQFFPCPVSMLISLPSGDPDEINNALVLLSEIDEFMREQDRLFGNSDIKPLANVIVNDNTQMQRIIESQKGTKDLKNRYVNWKEVANDNVVSTLHEINIIPENYGSDNVTYDPSDLIKLLSIPGRFLTIGKARIAKFDLHSLENSIKRSLDEGFFSAEHQFETATMYGGFVLRPSNADFFKDVNTENRIRNTLGDYKRLDEIAGKFGDPIWDNEYAVCYTIFAGMTMPKRYISLAREGKELAEKQEQLRAEAQRKQDEEKVDISFATNRVQKNTFNPYNKNQGFGGASRFSGGKNSAFKRQTSEATTTQNQQEEENIISTLKTSNPFKKR
>NZ_CP010578.1|WP_003319588.1|105160_105475_+|winged-helix-turn-helix-transcriptional-regulator
MNKDHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMRNL
>NZ_CP010578.1|WP_044798392.1|123508_123934_-|hypothetical-protein
MLKFQKVLLAGALAFTGIVGTSIIDTPKVEAASASVKAQQTTSHLVDGVSRPSSKINGAGQYGRITLQCGTIYPGWQKLVLKKVKEGWFDEEIATLELSGADHADDLHRVSNNVWLEKGSLYYIEVIGEYNATGSLSNYNY
>NZ_CP010578.1|WP_000272218.1|124316_124580_+|hypothetical-protein
MYDPDDNEVIVNEIFYNAASEQKLGSKMGVFAADKLPTSIFEKVQENESMSYMESMEVEEQTIPEILCYLDQNQKPEKLYFEMQYMD
>NZ_CP010578.1|WP_000633818.1|125406_125691_+|hypothetical-protein
MITVNRGYMYDPDDNEVLITEIYYEAATETKLGSKMDSLSYSVLPNNIKEKIEAVTSLSYMESIEMSQQLAAVYQNEINKYGEPEKLYFEYTNM
>NZ_CP010578.1|WP_044798471.1|125929_126325_+|hypothetical-protein
MRTFKTIQFAMFTNIKHYMFLLTKIEPILEEPHHDYKLFQFICELEINQIYEALEGQRNDTYIDSNAHPVYIHTLIKQANLLQYVISIVQEEGVIHAASVLLMHSFDLYTVHRITNLSISYLRNLGNTLSK
>NZ_CP010578.1|WP_044798393.1|126545_126932_+|nucleotidyltransferase-domain-containing-protein
MYNILKRQFNYIIRGVIRINEEVQRELDLLVQKIRETVSSVQKIILFGSHAYGTPNEYSDFDLCIVVEGVGERKREVINRINWGIYDVMETPVDILVYGPEEFQERASRTVTMEHKIALEGTVLYEKY
>NZ_CP010578.1|WP_044798394.1|126918_127332_+|HEPN-domain-containing-protein
MRNIEDLKEWVFIAKSDLDSAIYLSDMKPFPTAIICYHSQQCVEKLLKGFLALNGRPVPKTHNLLMLHKFCCRLDEEFSLILEQCVQLNGYATDIRYPYFEALTVQDGLIAIQHAQKVMSFYMEKLNKLNIHEITVD
>NZ_CP010578.1|WP_044798395.1|127816_128638_+|DUF1837-domain-containing-protein
MILTTQSHIRWFENTGQTIQTSEGENIEVLEFKHEHDEEILSSWAKHFREHYCLDSEIDFFKEGYNYTRAEFLNIIKFPDISRTPGPSIRAGDFGEILVADYLEFILNYWVPRTRYGTKVIGNESSKGCDTLAFKIISDGEYTPEDTLAIFETKTQFSGTRAKPRLQNAVDDSKKDVARKGESLNAIKQQLYLKNELEESKRINRFQNPTDHPYKEISGAVAMFSSSLMDFSTITNTSINEHPNKDNLTLLVIHGENMMTLVHELYRRAADEA
>NZ_CP010578.1|WP_044798396.1|128627_131780_+|DEAD/DEAH-box-helicase
MKPERQSKKLLSATRSKAKMNEYNVEEVDHIKLTKDPATLFTLAIGLLGDLSAYINSENPDEHYLKELRDNLKFSAHFFDAYLHTNLMADLDEYVLLLGSASYYLCDLPGSSLVLVKRIEMNKLNLECSDLDTLLARLLIGNFTPCYVEESGTYAMNIIDISINLSIFYETGGNEQHIYKLISDLRGEAYKFGSPRELLFADVIGAVIRKRIENSSRKCLPKYSGISVGNWESILQNKNFIQEFWPAQHLLGETGVFKGESAVIQLPTSAGKTKATEVIIRSAFLSNRTSLAVIVAPFRALCHEISMSLSKSFQSDSINIDEVSDVLQMDFELKSILRDDFILVVTPEKLIYMLRQCPELATEIGLLIYDEGHQFDSNTRGINYELLLTALKGMVPEGGQKVLISAVINNAEVVGSWLNGPENKVVSGVNLSPTYRTVALTSWMDRLGKLQFLNEENPDELDFYVPRIIEQQKLQLKGRETTERFFPIKNDSSTVSLFLGLKLTSNGSVAIFCGKKDNVSSLCDKVVEAYERGLTLITPFELSEKNELRKLYSLYCLHLGSQASVTKGAELGILTHHGNIPSGIRHAVEHSIKEGLAKFVICTSTLAQGVNLPIRYLIVTSIYQGSEKIKVRDFQNLIGRVGRSGMHTEGSVIFADPNIYDKRNSYNNKWRWRQVKDLLDPNNSEPVESSLLKIFDPLCSDDKKNTHNINYIKLFEIYFEDSDKAYVGLEKIAKAFANEGFSIDGLNQQVESKINVLSSIESYLMANWEYATNEAGENWVSSLAKETLAYSLADDHIKEQIVILFQMLANNISNNIPEDSKKKSYGKLLYGVETAIKIEEWTKMHLDELVKCESYEELLNVLWPLLASNIKNKTFNKCEEPEILREVAIAWIHGRAYFILLDILKDKDIRMKTKKQRREYKIDHIVEICDNALSYEGMLLIGAVAELVESLITDQNIYLVENLKKLQKRMKYGVPNSLNILFYELGFADRIISRDLSGVLRDQSPPTNKRKLKSLIQSYEKDFRKQLIKYPSYYTSVLENILLSSDNRIV
>NZ_CP010578.1|WP_127057688.1|131750_131945_-|hypothetical-protein
MYLFFKSFFYKNYCEAKLIGLELEHDIDAIVHPKFKRLYFDNNEITVSVYIKSNLLDDSIVATQ
>NZ_CP010578.1|WP_044798398.1|132851_134765_+|hypothetical-protein
MNRHCNKTKEFLKKAFVILLVFILLFNITIIKNLIKEMLIFVQGFDLIDFDLIQIKHLYFFLRKYALFGLVLCILSFLGINLYLHIRNYFKNPQRYELNNFEDSLYKYIDDKPNGKGYLVTGEWGSGKTHIVTDFFDKYYKFSNKPIYRISCFGLDSRKLILDEIKNQIEINDTSLFNWIQHVPVIGKPLFSMLKGSYSLNSIPKGSIFIFDDFERITSLGIDPTGSMQESYQKNSFMLQSSNKIRDFKEINDEFRKIEKAFKKYDENNNVISITDNLQKYNVATGLINELIENYKIKVIIICNVDILGYSFVDKVFRGKLDCITFNQTITRNSINSIFNSEFDNQIFSNSDDKELISHVISDLVLDFEKVWASNNNSNLREVKSVIQAFLDTTNIISSKVNLNKDYLFSLFYNIYIVKILRDKKELTNLDNFLIGGNLAFFLKLYGKQSLYDSLELSEHFHNLKWTGISIAGFWILNMEKPNDLNSSERFYMDYEYNDLEKALLQPDLYFDNGNWIEGKVLLEHLIYSIKSESKSYPEEPTNNMDKLNTYIKENIKFIINYNQASEQSIEKKVYNFLVRMHSYMGYSYTPPVLEKWWAVIYEYSKVEFIPEEKDLYLIESYNQFVKNNKPREAELL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578.1	122659-122682	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578.1	122668-122691	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578.1	122677-122700	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578.1	122686-122709	1	0.958

1. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to position: 122659-122682, mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

2. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to position: 122668-122691, mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

3. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to position: 122677-122700, mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

4. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to position: 122686-122709, mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122623-122646	0	1.0
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122650-122673	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122659-122682	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122668-122691	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122677-122700	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122686-122709	1	0.958
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122632-122655	2	0.917
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	122641-122664	2	0.917
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	NZ_CP028885	Borrelia turcica IST7 plasmid lp129, complete sequence	71669-71692	2	0.917
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	MF141540	Mycobacterium phage Avocado, complete genome	37213-37236	3	0.875
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	KR080198	Mycobacterium phage Cambiare, complete genome	37308-37331	3	0.875
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	KR080197	Mycobacterium phage FlagStaff, complete genome	36097-36120	3	0.875
NZ_CP010578_1	1.2\|122623\|24\|NZ_CP010578\|CRISPRCasFinder	122623-122646	24	MN692958	Marine virus AFVG_117M8, complete genome	23622-23645	3	0.875

1. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 0, identity: 1.0

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtattc	Protospacer
************************

2. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

3. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

4. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

5. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

6. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 1, identity: 0.958

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgttcctggtgttc	Protospacer
********************.***

7. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 2, identity: 0.917

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtattcctggtgttc	Protospacer
***********.********.***

8. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 2, identity: 0.917

gtgttcctggtgttcctggtattc	CRISPR spacer
gtattcctggtgttcctggtgttc	Protospacer
**.*****************.***

9. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to NZ_CP028885 (Borrelia turcica IST7 plasmid lp129, complete sequence) position: , mismatch: 2, identity: 0.917

gtgttcctggtgttcctggtattc	CRISPR spacer
gtgttcctggtgctcctggtgttc	Protospacer
************.*******.***

10. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to MF141540 (Mycobacterium phage Avocado, complete genome) position: , mismatch: 3, identity: 0.875

gtgttcctggtgttcctggtattc	CRISPR spacer
ctgttcctggtgttcctggtgctc	Protospacer
 *******************..**

11. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to KR080198 (Mycobacterium phage Cambiare, complete genome) position: , mismatch: 3, identity: 0.875

gtgttcctggtgttcctggtattc	CRISPR spacer
ctgttcctggtgttcctggtgctc	Protospacer
 *******************..**

12. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to KR080197 (Mycobacterium phage FlagStaff, complete genome) position: , mismatch: 3, identity: 0.875

gtgttcctggtgttcctggtattc	CRISPR spacer
ctgttcctggtgttcctggtgctc	Protospacer
 *******************..**

13. spacer 1.2|122623|24|NZ_CP010578|CRISPRCasFinder matches to MN692958 (Marine virus AFVG_117M8, complete genome) position: , mismatch: 3, identity: 0.875

gtgttcctggtgttcctggtattc	CRISPR spacer
atgttccaggtgttcctggtagtc	Protospacer
.****** ************* **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

168487 : 230111

Bacillus_phage(30.0%)

transposase,integrase

attL 203972:203987|attR 215768:215783

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044798413.1\|168487_169201_+\|transposase	transposase	NA	NA	NA	NA
WP_000817909.1\|170067_170703_+	hypothetical protein	NA	NA	NA	NA
WP_175581942.1\|170753_171332_-	hypothetical protein	NA	NA	NA	NA
WP_044798415.1\|171351_171936_-	hypothetical protein	NA	NA	NA	NA
WP_044798416.1\|172061_172445_+	hypothetical protein	NA	NA	NA	NA
WP_016078686.1\|172461_173100_+	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	4.8e-22	35.1
WP_044798417.1\|173685_174405_-	NADH dehydrogenase	NA	NA	NA	NA
WP_044798418.1\|174859_177523_+	type IA DNA topoisomerase	A0A1V0SIB2	Klosneuvirus	1.4e-11	20.1
WP_044798419.1\|177682_178213_+	hypothetical protein	NA	NA	NA	NA
WP_044798420.1\|178235_178883_+	thermonuclease family protein	NA	NA	NA	NA
WP_001014125.1\|178915_179116_+	hypothetical protein	NA	NA	NA	NA
WP_016078682.1\|179191_179479_+	hypothetical protein	NA	NA	NA	NA
WP_044798421.1\|179502_180258_+	hypothetical protein	NA	NA	NA	NA
WP_044798422.1\|180291_180726_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_044798423.1\|180811_181105_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044798424.1\|181627_182041_+	hypothetical protein	NA	NA	NA	NA
WP_044798425.1\|182650_182836_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_175581941.1\|182977_183118_-	hypothetical protein	NA	NA	NA	NA
WP_044798426.1\|183114_184209_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.6e-95	48.8
WP_044798427.1\|184445_184895_+	hypothetical protein	NA	NA	NA	NA
WP_044798428.1\|184925_185246_+	hypothetical protein	NA	NA	NA	NA
WP_044798429.1\|185963_186983_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_044798430.1\|187722_188169_-	hypothetical protein	NA	NA	NA	NA
WP_044798431.1\|189246_189594_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	2.0e-27	56.9
WP_044798432.1\|189669_190512_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_044798434.1\|193245_194070_+	ADP-ribosyltransferase	A0A1V0E017	Clostridioides_phage	1.7e-16	29.4
WP_086405554.1\|194420_196142_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-11	32.1
WP_044798436.1\|197069_198416_+	hypothetical protein	NA	NA	NA	NA
WP_044798437.1\|199382_200198_+	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_127057735.1\|200262_200454_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_127057734.1\|200512_200599_-	hypothetical protein	NA	NA	NA	NA
WP_052574936.1\|200974_201256_-	hypothetical protein	NA	NA	NA	NA
WP_080893310.1\|202012_205012_+	hypothetical protein	A0A1V0E026	Clostridioides_phage	8.1e-88	31.4
203972:203987	attL	NA	NA	NA	NA
WP_175581936.1\|206303_206441_-	hypothetical protein	NA	NA	NA	NA
WP_052574937.1\|206572_208069_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000275580.1\|208722_210018_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|210007_210760_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_044798439.1\|211533_212046_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_044798440.1\|212067_212418_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_044798442.1\|212649_213693_+\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	5.3e-10	23.4
WP_044798443.1\|213905_214232_+	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	7.1e-22	50.0
WP_000734602.1\|214563_214719_-	hypothetical protein	NA	NA	NA	NA
WP_044798444.1\|214715_215939_-	hypothetical protein	A0A1B1P895	Bacillus_phage	2.8e-143	62.4
215768:215783	attR	NA	NA	NA	NA
WP_044798445.1\|216146_217790_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016078649.1\|218179_219271_-	DUF4065 domain-containing protein	A0A0N9SGM1	Paenibacillus_phage	1.8e-21	38.6
WP_044798446.1\|219267_219678_-	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_044798448.1\|220431_221643_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	6.4e-68	35.9
WP_044798449.1\|221781_223161_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_044798450.1\|223309_223720_-	DUF1878 family protein	NA	NA	NA	NA
WP_044798451.1\|224263_224542_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	3.0e-13	59.0
WP_002083794.1\|224879_225074_+	hypothetical protein	NA	NA	NA	NA
WP_001043956.1\|225292_225565_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	7.5e-25	68.9
WP_044798452.1\|226034_227300_+	Y-family DNA polymerase	O64031	Bacillus_phage	3.8e-103	46.6
WP_016078646.1\|227296_227638_+	YolD-like family protein	A0A1Q1PW34	Staphylococcus_phage	6.1e-08	37.5
WP_044798453.1\|227686_228061_+	hypothetical protein	D2XQ01	Bacillus_virus	1.1e-29	52.5
WP_000417392.1\|228281_228533_-	hypothetical protein	NA	NA	NA	NA
WP_044798454.1\|228585_228825_-	hypothetical protein	NA	NA	NA	NA
WP_016078644.1\|229037_230111_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.0e-77	44.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage