CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LM997412	Peptoniphilus sp. ING2-D1G genome assembly, chromosome: I	2 crisprs	csa3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LM997412_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LM997412_1

278641-278735

Orphan

Consensus_repeat	Method
GTAGGGGCGGTCGCCCACGCCCGCCCGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LM997412_1

>merge|NZ_LM997412|1|278641-278735|CRISPRCasFinder
GTAGGGGCGGTCGCCCACGCCCGCCCGATGTAATTTGTAATTTGTTGGGTGGGTTGATATTTTTCGTAGGGGCGGTCGCCCACGTCCGCCCGATG

>NZ_LM997412|1|1|278641-278735|CRISPRCasFinder
GTAGGGGCGGTCGCCCACGCCCGCCCGATG	TAATTTGTAATTTGTTGGGTGGGTTGATATTTTTC
GTAGGGGCGGTCGCCCACGTCCGCCCGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LM997412.1\|WP_045077311.1\|278981_279251_+\|ACT-domain-containing-protein	unknown	unknown	gnl\|CDD\|178923
NZ_LM997412.1\|WP_052658358.1\|282311_284921_+\|S-layer-homology-domain-containing-protein	unknown	unknown	gnl\|CDD\|236545
NZ_LM997412.1\|WP_071387806.1\|287851_287998_+\|YvrJ-family-protein	unknown	unknown	gnl\|CDD\|378969
NZ_LM997412.1\|WP_045077318.1\|286285_286837_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_LM997412.1\|WP_045077306.1\|275243_275900_+\|(d)CMP-kinase	unknown	unknown	gnl\|CDD\|234579
NZ_LM997412.1\|WP_045077301.1\|272631_273339_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
NZ_LM997412.1\|WP_045077295.1\|270760_271387_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100079
NZ_LM997412.1\|WP_045077293.1\|269451_270777_+\|thymidine-phosphorylase	unknown	unknown	gnl\|CDD\|274244
NZ_LM997412.1\|WP_045077299.1\|272086_272635_+\|SMC-Scp-complex-subunit-ScpB	unknown	unknown	gnl\|CDD\|377219
NZ_LM997412.1\|WP_082047573.1\|280999_281518_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376616
NZ_LM997412.1\|WP_045077304.1\|273898_275098_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|272992
NZ_LM997412.1\|WP_045077303.1\|273335_273902_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377744
NZ_LM997412.1\|WP_045077321.1\|286826_287297_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|227919
NZ_LM997412.1\|WP_045077308.1\|275889_276480_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_LM997412.1\|WP_082047572.1\|276454_278527_+\|bifunctional-4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase/30S-ribosomal-protein-S1	unknown	unknown	gnl\|CDD\|234623
NZ_LM997412.1\|WP_045077323.1\|287358_287583_+\|DUF1659-domain-containing-protein	unknown	unknown	gnl\|CDD\|377933
NZ_LM997412.1\|WP_045077297.1\|271371_272097_+\|segregation/condensation-protein-A	unknown	unknown	gnl\|CDD\|234635
NZ_LM997412.1\|WP_045077313.1\|279259_280615_+\|PFL-family-protein	unknown	unknown	gnl\|CDD\|180009
NZ_LM997412.1\|WP_045077328.1\|288149_288455_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370572
NZ_LM997412.1\|WP_045077325.1\|287611_287830_+\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571

Protein	Function_ID	Function_description	E-value
NZ_LM997412.1\|WP_045077311.1\|278981_279251_+\|ACT-domain-containing-protein	gnl\|CDD\|178923	PRK00194, PRK00194, ACT domain-containing protein.	5.24736e-37
NZ_LM997412.1\|WP_052658358.1\|282311_284921_+\|S-layer-homology-domain-containing-protein	gnl\|CDD\|236545	PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional.	0.000516495
NZ_LM997412.1\|WP_071387806.1\|287851_287998_+\|YvrJ-family-protein	gnl\|CDD\|378969	pfam12841, YvrJ, YvrJ protein family. This family of short proteins are related to B. subtilis YvrJ protein. None of the members of this family have been functionally characterized.	6.37465e-12
NZ_LM997412.1\|WP_045077318.1\|286285_286837_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	6.37955e-19
NZ_LM997412.1\|WP_045077306.1\|275243_275900_+\|(d)CMP-kinase	gnl\|CDD\|234579	PRK00023, cmk, (d)CMP kinase.	5.11151e-98
NZ_LM997412.1\|WP_045077301.1\|272631_273339_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	4.6118e-90
NZ_LM997412.1\|WP_045077295.1\|270760_271387_+\|site-2-protease-family-protein	gnl\|CDD\|100079	cd06158, S2P-M50_like_1, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.	1.04073e-60
NZ_LM997412.1\|WP_045077293.1\|269451_270777_+\|thymidine-phosphorylase	gnl\|CDD\|274244	TIGR02644, Thymidine_phosphorylase, pyrimidine-nucleoside phosphorylase. In general, members of this protein family are designated pyrimidine-nucleoside phosphorylase, enzyme family EC 2.4.2.2, as in Bacillus subtilis, and more narrowly as the enzyme family EC 2.4.2.4, thymidine phosphorylase (alternate name: pyrimidine phosphorylase), as in Escherichia coli. The set of proteins encompassed by this model is designated subfamily rather than equivalog for this reason; the protein name from this model should be used when TIGR02643 does not score above trusted cutoff. [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NZ_LM997412.1\|WP_045077299.1\|272086_272635_+\|SMC-Scp-complex-subunit-ScpB	gnl\|CDD\|377219	pfam04079, SMC_ScpB, Segregation and condensation complex subunit ScpB. This is a family of prokaryotic proteins that form one of the subunits, ScpB, of the segregation and condensation complex, condensin, that plays a key role in the maintenance of the chromosome. In prokaryotes the complex consists of three proteins, SMC, ScpA (kleisin) and ScpB. ScpB dimerizes and binds to ScpA. As originally predicted, ScpB is structurally a winged-helix at both its N- and C-terminal halves. IN Bacillus subtilis,one Smc dimer is bridged by a single ScpAB to generate asymmetric tripartite rings analogous to eukaryotic SMC complex ring-shaped assemblies.	1.82743e-61
NZ_LM997412.1\|WP_082047573.1\|280999_281518_+\|hypothetical-protein	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	4.5822e-09
NZ_LM997412.1\|WP_045077304.1\|273898_275098_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|272992	TIGR00275, TIGR00275, flavoprotein, HI0933 family. The model when searched with a partial length search brings in proteins with a dinucleotide-binding motif (Rossman fold) over the initial 40 residues of the model, including oxidoreductases and dehydrogenases. Partially characterized members include an FAD-binding protein from Bacillus cereus and flavoprotein HI0933 from Haemophilus influenzae. [Unknown function, Enzymes of unknown specificity].	1.06366e-163
NZ_LM997412.1\|WP_045077303.1\|273335_273902_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	9.32594e-55
NZ_LM997412.1\|WP_045077321.1\|286826_287297_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|227919	COG5632, COG5632, N-acetylmuramoyl-L-alanine amidase [Cell envelope biogenesis, outer membrane].	3.30625e-30
NZ_LM997412.1\|WP_045077308.1\|275889_276480_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	2.18177e-41
NZ_LM997412.1\|WP_082047572.1\|276454_278527_+\|bifunctional-4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase/30S-ribosomal-protein-S1	gnl\|CDD\|234623	PRK00087, PRK00087, bifunctional 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/30S ribosomal protein S1.	0
NZ_LM997412.1\|WP_045077323.1\|287358_287583_+\|DUF1659-domain-containing-protein	gnl\|CDD\|377933	pfam07872, DUF1659, Protein of unknown function (DUF1659). This family consists of hypothetical bacterial proteins of unknown function.	2.21451e-05
NZ_LM997412.1\|WP_045077297.1\|271371_272097_+\|segregation/condensation-protein-A	gnl\|CDD\|234635	PRK00104, scpA, segregation and condensation protein A; Reviewed.	1.50761e-63
NZ_LM997412.1\|WP_045077313.1\|279259_280615_+\|PFL-family-protein	gnl\|CDD\|180009	PRK05313, PRK05313, hypothetical protein; Provisional.	0
NZ_LM997412.1\|WP_045077328.1\|288149_288455_+\|hypothetical-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	0.00293128
NZ_LM997412.1\|WP_045077325.1\|287611_287830_+\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	4.82315e-06

>NZ_LM997412.1|WP_082047572.1|276454_278527_+|bifunctional-4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase/30S-ribosomal-protein-S1
MKIKIILADHMGFCGGVKRAVELAKKNAGEGVYSLGDIVHNQRVVQDLKDLGVTALQDYRDIENSKIIIRSHGVHKSIIEELKQRGNEIIDCVCPKVKNIYDIVAKARNEGYNVIIFGDPHHPEVIGINSHAEDEAVIISSEEEVNNIKKGKSIIVSQTTNDENKYKKIVKLIKDISKDEILVYNTICSATRLRQDSVRELSAKVEAVMVLGGKNSSNTKKLAEVAKENCKNVYLIESINDLGYNKLKKFNKIGITAGASTPDTVIKEAVCSMENFDNTEMMEAIESSFKRIRRGEVVEGEVLFVNENEVMVNIGYRSDGIISREEISKDPEVKPQDVFKPGDKIQVYVMKIDDGDGNVVLSAKRVESMKVWDDVEELFKNKEKVEVEVKSVVKGGLIADLEDLKAFIPASHVSVRFQKDLSKYVSKKLVCEIIDFDKANRKIVLSRKNVEAEELEAKRSSVYETLKVGDIIEGTVQRLTNFGAFVDVGGVDGLIHISELSWNRVKHPSDVVSPGQKVEVKVLNVDEEKNRIALGLKQTTKKPWDVFVDSVAVGDVVEGKVVNLLEFGAFVRLESGVDGLLHVSQIAKEHVEKPSDKLEIGQEVTAKVTDINEEEKKISLSIKALLEPKVEPKEEVVEEIPAEEVQEEEVVEEKPKAQEKHAETTSEQDNSSNKNLNTDLGDLLGKLKFD
>NZ_LM997412.1|WP_045077308.1|275889_276480_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MLYKILRILVLIIFKIIFRCEIIGAEKIPANTPVIISPNHKSNFDPFLVSALVKPQIHWIAKKELFEFKPLGALIYAVGGFPIDREKSNIKAIKTAMNILKNNKILGLFPEGTRVKKPDFENPKSGVALIAHRTKSTVVPMYIDGNYTPFKKMKLIVRDPMDLSKLPKAEQKDYDSISLDILKSIYGVDENKNYIS
>NZ_LM997412.1|WP_045077306.1|275243_275900_+|(d)CMP-kinase
MYSIAIDGPAGSGKSTIAKLIADKLNISYIDTGSMYRALALKTLKLNIRLEDEKALGDMLDNTDIDYEEGKIYIDGEDVSDKIRGDEVSALASDISKNFAVREYLVHIQREISKRRSVVMEGRDIGTVVLPHADYKFYLTADLNIRAKRRYEQLLAKGEKTTLEEVQESIKQRDTQDMNRKNSPLKQAQDALLVDNSHMDLNQTLEYILNTIRGKNAL
>NZ_LM997412.1|WP_045077304.1|273898_275098_+|NAD(P)/FAD-dependent-oxidoreductase
MKKVAVIGGGPSGMIAAYFAAKKNNVELFEQNEKLGKKLYITGKGRCNITNDKDISEFFDEISRNEKFLYSAFYSFTNRDLISLLKENGLDTIVERGGRVFPKSQKSSDVIKTYEKMLKKNAVKVHLNHKITNIAKKDDIFTLNDTMEFDSVIIATGGYSYRSTGSTGDGYKFAKHFGIKVEELRPALVPVELEDDFLDRLSGLTLKNIELIAKSGKKEIHREFGELLFAHFGISGPVALRMSNIINRKENINLFIDLKPALDQKTLDDRILRDFHEFTNKNIDNGLTKLLPKNLIPVVLELSDIDPQKTINEITKEERLSLVKTIKNMPLKYKSLMDINASIVTSGGISTEEINPSTMQSLKIPNLYFCGEVIDVEGFTGGFNLQIANSTGYLAGISV
>NZ_LM997412.1|WP_045077303.1|273335_273902_+|methyltransferase-domain-containing-protein
MKVVKFNYREIVDEIIENMDLKDSCCLDCTCGNGKDSLNILSHMDGSGFLYCCDLQKQAVENTERLLKSKEFENFKMMHKSHDEIFDEIPCKLKLIIYNLGYLPGSDKSIATKASTTIKSIDRAILKLREDGVIIVVSYLGHQGSHEERKAVDEYLKNLDQQKYKVEKREFYNQKNNPPIVYLIGGRT
>NZ_LM997412.1|WP_045077301.1|272631_273339_+|rRNA-pseudouridine-synthase
MRLQKYMAHSGAASRRKSEEYILEGRVKVNGEVITELGYKVDPMKDKVYLDGKRLKIIREHTYIALNKPIGVFSTASDEKGRKTVTDLIDLDTRLYPVGRLDADTTGLIILTDDGEVTNKITHPKYAIEKTYIATVEGRPDKNELDILRKGVKIGQEKFNGAKLRILKSFENDTIIETVISEGKNHQVKIMYEKIGHPVKKLKRISVGEIQLGDLEIGNYRFLSEDEIRYLKGLK
>NZ_LM997412.1|WP_045077299.1|272086_272635_+|SMC-Scp-complex-subunit-ScpB
MQNEDNLISIIEGILFAWSEPVSIVDLTKVLDISANEVEDILKLMTRKYEQPSSGLRLIRLDDSYQLNTKPENYTYISKFVSDKNKRNLSNAALETLAIIAYKQPVTKLEIENIRGVKCDSTIKGLLDVGLIKIDGQLNKIGRPNIYKTTEDFLRKFGISSIEDLPEIEEDEQIKMQFMEEE
>NZ_LM997412.1|WP_045077297.1|271371_272097_+|segregation/condensation-protein-A
MEYNISLKVYEGPMDLLIDLIKKNNIDIFDIPIHLITNQFIEYIENSKKLNMELTSDFILMASTLLEIKSRMLLPKFSFEEESEEEAEDPRQDLVNKILEYEKYKEISEKLKESSQYEQKSFYKLQEDFSDIKGTDFIDDIELTDLARAFNNIIKRYKTRNAVESIVSDEYTVDVAMEQIMTLLEGNSHVKFTQLLSEYPLLEEIIIYFLSLLELIRMGKIKAHQQEDFSDIVIVRRENAK
>NZ_LM997412.1|WP_045077295.1|270760_271387_+|site-2-protease-family-protein
MFGQYDLLNIIYTIIALLCAIIPHEIAHGYAAYKLGDDTAKSDGRLSLNPLNHIDPIGLLSMIIFKFGWAKAVPINPYKFKNRKRDTLIVSLAGVVTNFVIGFIASLAFVFAYYKSSPVTELFQSIMWYNVMLGVFNLVPIPPLDGSKALISLFPNKIEYFFYKYERYLYILLIIALASGTISKVIGPIILGIINKFIDVGMVLWNTI
>NZ_LM997412.1|WP_045077293.1|269451_270777_+|thymidine-phosphorylase
MNIYSILEKKKNNIKLNKEEISYFVQGYLKDEVKDYQASALLMAICINGLDFDETVYLTEAMINSGDVVNLEKIKGEKVDKHSTGGVGDTTTLVVGPLLASCGLAFTKLSGRGLGHTGGTLDKLESIEGFDIDLSEEEFIDNINRINIAIMGQTATITPADKKIYALRDVTATVDDKSLIASSIMSKKLAIGSDILVLDVKVGAGSFMKTLEEARELGKLMVELGYKFGRKTHAVLSNMDEPLGYAVGNSLEVIEAIKTLKGEGPQDLKELSIAICSKFLILSGICKNHEEAQQLLHQKIENKEALEKFKEMVAAQRGDVSYVDDLDKFKLSSIKIEVLSSKTGYIKEINALKIGEIAKELGAGRATKESKIDHGAGILLNKKTDDYVKEGELLATLYTEIEGAREKAEKDLQSAFVIGQKNSEKYELILGEAGREDVWTI
>NZ_LM997412.1|WP_045077311.1|278981_279251_+|ACT-domain-containing-protein
MKAVITFIGNDQIGIVHKATAILVKYNLNIVDINQTIMDNYFTMIMLVDISKSTVEFSEIVEAYKELGEEIGMYIKVQHEDIFNAMHQI
>NZ_LM997412.1|WP_045077313.1|279259_280615_+|PFL-family-protein
MDNKKILETIKMLEQEHLDIRTVTMGISLIDCIDSDHKKANQKIYDKMMHHTEKLVETTSQISQLYGIPIINNRISVTPISIIAGATDLTDYTPYAQTLDKVAKEVGVDFVGGFSALVHKGFNKSDYTLIDSIPQALSTTDYVCSSVNVGSTKTGINMDAVALMGQKIIELAQLTKEKDSIGCAKLVVFANAVEDNPFMAGAFHGVGEPDSTINVGVSGPGVVKCALENVRGKTFDEVAETIKKTAFKITRMGELVGREVSAKLNTTFGIIDLSLAPTPAVGDSVARILEEIGIDTVGGHGTTAALAMLNDAVKKGGIMASSHVGGLSGAFIPLSEDEGMISAAKSGHLSFDKLEAMTSVCSVGLDMIAIPGDTPKETISAIIADEAAIGVINNKTTAVRVIPVIGKTVGEEAQFGGLLGYAPIMDIGANSSKRFIERGGLIPAPIHSFKN
>NZ_LM997412.1|WP_082047573.1|280999_281518_+|hypothetical-protein
MPTSSRIIAYENKYIKYERSFMNNKKFPTRKLLRMQNYDYSNMGVYFITICSRGKEKIFGDIITGKNVELTLNENGKIIKNYIENIDELLIYKIMPNHVHILLLLDEESRKNNRSVPMIVRSLKSLSSKKIGFSCWQRSYHDRIVRNKREFEMIWNYIEHNEETWNRDCYNV
>NZ_LM997412.1|WP_052658358.1|282311_284921_+|S-layer-homology-domain-containing-protein
MNKKILSLVLALVMVLGAFTTVFAEEATTEKVEKVVGKDNKIQYVIDKKLVEGYGDGDYGYDKNIKRSEITKLLVYANGNKALAEKLQGSMQLYSDVDHAYWANGVISVGSTVPSAANGQPMLNGYPDGSFKPENDVTYAELAKMLVVLVKKDLTADMVKQANANWASQWMTWAAQLGILDDVVVANSDAAANRADAFTMLYNALYKMTAFKRVPANEKIGVLSALNRSKLTLNQDSEQTYTITDETVFVLAGELSSTNSNVIKVKSINDPDYYLGSLVRIMVNDKKEVSHILELGNPRYLALGLANDKLVGDNARWQGVADATVETPYTNVATLNTTMKPVMSGWAKINFNSAKTKVDSITFQTTATTNVATVKVNSDTKVYVANPANNQMREVKNIDEAMTLIGYDKAKWDMIPNVYAGFDTDGHVAAIHGYNTDGRNTAKVVVFNVVTKAKGGDAYRIINQATSLGNATLEKTNGELADKNLFGNISAFPYNYGDLYDVIELKWYSGNNNYDQIAKVIDHSNTDKYPIVQIVRTYNDGKSLEVVDQYGYKALIDTRDADIFSAKRFDKLVEGAKIQFATEDQNKAVDTVSILPREMAVKGSLRAVFSDAVYGNTYVGRVISVHVNGNNSTVAIDAYNNIFDKDANQGYTTFYVSEDTARALKNAYEGKEVNFKVTDMSGIYGRYYAQDFHDNATGRVIAPVSAPLTALEAAQAAIEKAIQTKSVADVLAAEEALQYIPAADKDNLETIPAYVTAKATATAVAAADADAAVEALKVKLTETMNTGDYAANITDNATAADEKAKIEAAKTEYAAAKAAVEDAVALDPAFDTTDFDRYKGNLEIKINAFNAHIAAGSMFTAVQPIAPIA
>NZ_LM997412.1|WP_045077318.1|286285_286837_+|sigma-70-family-RNA-polymerase-sigma-factor
MYEKIEKLFSSAREGDDDAKLELLEILNPLIISSIKRYCPLWREYGDLLQDGIVVVLKCIDLYDSSKGYFLAFVKSYLKFYFLETFRYLLRLEQVSSTDDEGLGDFLSDDYDMEQSLLGREFSLELKRALMLLTKRQREVVLMYYFLDMSLSDIAASLDIKRWTVINTKRRGMEILRRFFDVN
>NZ_LM997412.1|WP_045077321.1|286826_287297_+|N-acetylmuramoyl-L-alanine-amidase
MLIEKLPIGMNFSKRGGSPKFIVVHDTGNSSKGADAIAHFRYFDGGYRGASAHYFVDDKRVVETVEVANSAWHCGDGRGKYGIYNYNSIGVELCVNSDGDWEKTKANALELIRFLMRFYDIPKSRVVRHYDASRKVCPRKISADNWREWWIFREMI
>NZ_LM997412.1|WP_045077323.1|287358_287583_+|DUF1659-domain-containing-protein
MAYTNRVDKVTLKLGIVKGIDEDGAEVLRSRSFRNINPAVTDDVLGTGAAKLGAFFSKELRTIKKVVEHELIEG
>NZ_LM997412.1|WP_045077325.1|287611_287830_+|DUF2922-domain-containing-protein
MTKKTLELSFVDENDKSIRFSLQDPRDGILKGELVEFESYIVTNELFIGPTGKITGFGTAKYKEVTETDLLV
>NZ_LM997412.1|WP_071387806.1|287851_287998_+|YvrJ-family-protein
MDELFANIANIGFPIAISCYLLTRVESKIADLTGSINELSKNIEKYMN
>NZ_LM997412.1|WP_045077328.1|288149_288455_+|hypothetical-protein
MGFFEELSFIANIYIWPIIVFLVNLAMLVWIYRDAKNYNTYPILWVLAAVILNFPLGLILYLLYGRKDPKVVCRHCHNKQSSDLEYCANCGAEMDNREYYA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LM997412_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LM997412_2

1279986-1280070

Orphan

Consensus_repeat	Method
CTTCCGATTGAGTTGTGTCTTCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LM997412_2

>merge|NZ_LM997412|2|1279986-1280070|CRISPRCasFinder
CTTCCGATTGAGTTGTGTCTTCTTCTGCCGTGCCCGCTTCCTGTACACTTTCTTCTGTAACTTCCGATTGAGTTGTGTCTTCTTC

>NZ_LM997412|2|2|1279986-1280070|CRISPRCasFinder
CTTCCGATTGAGTTGTGTCTTCTTC	TGCCGTGCCCGCTTCCTGTACACTTTCTTCTGTAA
CTTCCGATTGAGTTGTGTCTTCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LM997412.1\|WP_045078427.1\|1286543_1287434_+\|fructose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|180045
NZ_LM997412.1\|WP_082047610.1\|1272589_1273531_+\|YegS/Rv2252/BmrU-family-lipid-kinase	unknown	unknown	gnl\|CDD\|224513
NZ_LM997412.1\|WP_045078411.1\|1269276_1269852_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239109
NZ_LM997412.1\|WP_045078413.1\|1270817_1271495_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_LM997412.1\|WP_045078423.1\|1283217_1283835_-\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_LM997412.1\|WP_052658411.1\|1281967_1282963_-\|DUF348-domain-containing-protein	unknown	unknown	gnl\|CDD\|270620
NZ_LM997412.1\|WP_045078420.1\|1276763_1277594_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LM997412.1\|WP_045078785.1\|1283837_1284962_-\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|132848
NZ_LM997412.1\|WP_045078426.1\|1285830_1286427_-\|reverse-transcriptase-like-protein	unknown	unknown	gnl\|CDD\|260009
NZ_LM997412.1\|WP_045078422.1\|1281033_1281705_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LM997412.1\|WP_045078421.1\|1280388_1280961_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LM997412.1\|WP_045078412.1\|1270102_1270825_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_LM997412.1\|WP_045078419.1\|1276199_1276649_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_LM997412.1\|WP_045078416.1\|1273584_1274187_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380317
NZ_LM997412.1\|WP_045078428.1\|1287503_1288775_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|349915
NZ_LM997412.1\|WP_045078424.1\|1284951_1285398_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|234795
NZ_LM997412.1\|WP_045078425.1\|1285408_1285831_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131622
NZ_LM997412.1\|WP_045078417.1\|1274285_1275020_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235506
NZ_LM997412.1\|WP_082047611.1\|1275399_1275948_-\|DUF3783-domain-containing-protein	unknown	unknown	gnl\|CDD\|378901
NZ_LM997412.1\|WP_082047609.1\|1271500_1272394_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270338

Protein	Function_ID	Function_description	E-value
NZ_LM997412.1\|WP_082047610.1\|1272589_1273531_+\|YegS/Rv2252/BmrU-family-lipid-kinase	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	1.13917e-44
NZ_LM997412.1\|WP_045078411.1\|1269276_1269852_-\|hypothetical-protein	gnl\|CDD\|239109	cd02549, Peptidase_C39A, A sub-family of peptidase family C39. Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic). The cleavage is mediated by the transporter as part of the secretion process. Bacteriocins are antibiotic proteins secreted by some species of bacteria that inhibit the growth of other bacterial species. The bacteriocin is synthesized as a precursor with an N-terminal leader peptide, and processing involves removal of the leader peptide by cleavage at a Gly-Gly bond, followed by translocation of the mature bacteriocin across the cytoplasmic membrane. Most endopeptidases of family C39 are N-terminal domains in larger proteins (ABC transporters) that serve both functions. The proposed protease active site is conserved in this sub-family of proteins with a single peptidase domain, which are lacking the nucleotide-binding transporter signature or have different domain architectures.	7.88784e-05
NZ_LM997412.1\|WP_045078413.1\|1270817_1271495_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	7.25839e-75
NZ_LM997412.1\|WP_045078423.1\|1283217_1283835_-\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	1.0331e-44
NZ_LM997412.1\|WP_052658411.1\|1281967_1282963_-\|DUF348-domain-containing-protein	gnl\|CDD\|270620	cd14667, 3D_containing_proteins, Non-mltA associated 3D domain containing proteins, named for 3 conserved aspartate residues. This family contains the 3D domain, named for its 3 conserved aspartates, including similar uncharacterized proteins. These proteins contain the critical active site aspartate of mltA-like lytic transglycosylases where the 3D domain forms a larger domain with the N-terminal region. This domain is also found in conjunction with numerous other domains such as the Escherichia coli MltA, a membrane-bound lytic transglycosylase comprised of 2 domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, corresponding to the 3D domain and Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial LTs, which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond.	4.72328e-34
NZ_LM997412.1\|WP_045078785.1\|1283837_1284962_-\|patatin-like-phospholipase-family-protein	gnl\|CDD\|132848	cd07209, Pat_hypo_Ecoli_Z1214_like, Hypothetical patatin similar to Z1214 protein of Escherichia coli. Patatin-like phospholipase similar to Z1214 protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	1.4292e-45
NZ_LM997412.1\|WP_045078426.1\|1285830_1286427_-\|reverse-transcriptase-like-protein	gnl\|CDD\|260009	cd09277, RNase_HI_bacteria_like, Bacterial RNase HI containing a hybrid binding domain (HBD) at the N-terminus. Ribonuclease H (RNase H) enzymes are divided into two major families, Type 1 and Type 2, based on amino acid sequence similarities and biochemical properties. RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner in the presence of divalent cations. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, Type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Prokaryotic RNase H varies greatly in domain structures and substrate specificities. Prokaryotes and some single-cell eukaryotes do not require RNase H for viability. Some bacteria distinguished from other bacterial RNase HI in the presence of a hybrid binding domain (HBD) at the N-terminus which is commonly present at the N-termini of eukaryotic RNase HI. It has been reported that this domain is required for dimerization and processivity of RNase HI upon binding to RNA-DNA hybrids.	1.94171e-57
NZ_LM997412.1\|WP_045078427.1\|1286543_1287434_+\|fructose-bisphosphate-aldolase	gnl\|CDD\|180045	PRK05377, PRK05377, fructose-1,6-bisphosphate aldolase; Reviewed.	0
NZ_LM997412.1\|WP_045078412.1\|1270102_1270825_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.12067e-153
NZ_LM997412.1\|WP_045078419.1\|1276199_1276649_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	1.98262e-33
NZ_LM997412.1\|WP_045078416.1\|1273584_1274187_-\|nitroreductase-family-protein	gnl\|CDD\|380317	cd02140, Frm2-like, nitroreductase family protein. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.	5.81383e-81
NZ_LM997412.1\|WP_045078428.1\|1287503_1288775_+\|amidohydrolase	gnl\|CDD\|349915	cd05665, M20_Acy1_IAAspH, M20 Peptidases aminoacyclase-1 indole-3-acetic-L-aspartic acid hydrolase. Peptidase M20 family, bacterial and archaeal aminoacyclase-1 indole-3-acetic-L-aspartic acid hydrolase (IAA-Asp hydrolase; IAAspH; IAAH; IAA amidohydrolase; EC 3.5.1.-) subfamily. IAAspH hydrolyzes indole-3-acetyl-N-aspartic acid (IAA or auxin) to indole-3-acetic acid. Genes encoding IAA-amidohydrolases were first cloned from Arabidopsis; ILR1, IAR3, ILL1 and ILL2 encode active IAA- amino acid hydrolases, and three additional amidohydrolase-like genes (ILL3, ILL5, ILL6) have been isolated. In higher plants, the growth regulator indole-3-acetic acid (IAA or auxin) is found both free and conjugated via amide bonding to a variety of amino acids and peptides, and via an ester linkage to carbohydrates. IAA-Asp conjugates are involved in homeostatic control, protection, storing and subsequent use of free IAA. IAA-Asp is also found in some plants as a unique intermediate for entering into IAA non-decarboxylative oxidative pathway. IAA amidohydrolase cleaves the amide bond between the auxin and the conjugated amino acid. Enterobacter agglomerans IAAspH has very strong enzyme activity and substrate specificity towards IAA-Asp, although its substrate affinity is weaker compared to Arabidopsis enzymes of the ILR1 gene family. Enhanced IAA-hydrolase activity has been observed during clubroot disease in Chinese cabbage.	7.69037e-138
NZ_LM997412.1\|WP_045078424.1\|1284951_1285398_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|234795	PRK00567, mscL, large-conductance mechanosensitive channel protein MscL.	1.5651e-52
NZ_LM997412.1\|WP_045078425.1\|1285408_1285831_-\|hypothetical-protein	gnl\|CDD\|131622	TIGR02571, putative_dCMP_deaminase, ComE operon protein 2. This protein is found in the ComE operon for "late competence" as characterized in B. subtilis. Proteins in this family contain homology to a cytidine/deoxycytidine deaminase domain family (pfam00383), and may carry out this activity.	2.59728e-58
NZ_LM997412.1\|WP_045078417.1\|1274285_1275020_+\|SDR-family-oxidoreductase	gnl\|CDD\|235506	PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	8.62285e-103
NZ_LM997412.1\|WP_082047611.1\|1275399_1275948_-\|DUF3783-domain-containing-protein	gnl\|CDD\|378901	pfam12646, DUF3783, Domain of unknown function (DUF3783). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 60 amino acids in length.	3.09483e-08
NZ_LM997412.1\|WP_082047609.1\|1271500_1272394_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270338	cd13620, PBP2_GltS, Substrate binding domain of glutamate or arginine ABC transporter, a member of the type 2 periplasmic binding fold protein superfamily. This family comprises of the periplasmic-binding protein component (GltS) of an ABC transporter specific for glutamate or arginine from Lactococcus lactis, as well as its closely related proteins. The GltS domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.65234e-76

>NZ_LM997412.1|WP_045078420.1|1276763_1277594_-|hypothetical-protein
MYTKENLLDRYIREMTRYMTYEDAKSAKEDFYSLVEDKLGKNYDLAELENLLLKFGSPHNFSTKYGSSSNIFISGKNYRILKALLQTLFLILILSTVIYIFIWEKVDYSLLLKSIKDIVITMLISSVLSLWIAENVKNIKILNKLLKPFEIKDLYKSREKFVFKKSKLINLIFYSTVIFLSIHIMAGSGSILRKKTLQVIFFLFILRDSNRTSEGEYGKYVTMLSIFCNVLISVVLVYFLKFDFEIKIFKYFYYFIIFTTLVDLYSVILKLRRFYG
>NZ_LM997412.1|WP_045078419.1|1276199_1276649_-|Hsp20/alpha-crystallin-family-protein
MSIRPYIKNNLGLADRGFEDFYNMIDNFFKDDFTPQRALRSSTFKVDISEDDKGYIIEAELPGFEKEDISIILEEGKLTLSAEKKEESDKSDEEKNYIHKERKFSKMERTMYFKDIDENGLKATLNNGVLEIKVPKKEVENKAKNIAID
>NZ_LM997412.1|WP_082047611.1|1275399_1275948_-|DUF3783-domain-containing-protein
MEGNAMDKKILLYGFEGNRFENIKNLATEYDFEITYADEKDLNKRIGEIFTVKYTEEEDKIYNGENVETEFILFSDFDRNLLRKFLTDLRIREILVDHKSVITKHTVNWELGYLISHIIDEHQVVTAAEELNALMRQAREYLNEEENEKVQEAVDYALTLNQKMDVKLEDIHDRIKKLEEAL
>NZ_LM997412.1|WP_045078417.1|1274285_1275020_+|SDR-family-oxidoreductase
MKTVLITGASRGIGKATALKLSEEKLYNIVLNYNNSKKEALQLEEELLHKGINALAIKADVSNLSQVEDMFSEIKNRFKGVDILINNAGISHSVQFQDLRPDDWNRMFSVNVGGVFNTIHCALEYMLSKKNGVILNFSSIWGSHGASCEVSYAATKGAIEAITKSLALELAPSNIRVNAIAPGTVNTDMMKTYSQNDIKLICSGIPMMRMAEPEEIAELVKFLISDKNSYMTGQIISPTGGMGV
>NZ_LM997412.1|WP_045078416.1|1273584_1274187_-|nitroreductase-family-protein
MQSKALEILKARRSYYDLDKNVDIPKDEIGQYIKDVIYNLPSSYNSQSQRAVLLFGEDHDYLWGKIVMETLRKKVDDEEKFKKTEEKINGFKNGFGTILIFEDEKTNKKLKENFPSYAHNVEPWSEQNSGIITLGLWIALRDIGLGANIQHYNPIIDDEVKEKWDIDANWILKSQMVFGNIVSEPSPKKKQPIDERVLIK
>NZ_LM997412.1|WP_082047610.1|1272589_1273531_+|YegS/Rv2252/BmrU-family-lipid-kinase
MGYNIIKKFGDFVMKKLFILSTKAGYKNFIDFGNNIYETYRSNNRIKELEIQKTLHKNHAGELAKNFAAENSDGIIYVCGGDGSLNEVANSIFGTDTSLGLIPMGTANDFSKNFNYKNFKIEDTFAPDLEHIDMIKINEKYCLNIMSLGFDTVILNTAYEILEKCPGLQSSAYLLSVLKSLKNIETERLYMNLTLETGDEIDVKGNFIISALCNGSYYGSGFNPAPTADLSDGLLNLITLEETPFFKLIPLIFKYRKGTHLNDKRVKEYIVKKGIIKSDKKIIANIDGEIFKSDVFDFEIIENAITFHKVGVN
>NZ_LM997412.1|WP_082047609.1|1271500_1272394_-|transporter-substrate-binding-domain-containing-protein
MLINGGKKMKKILITCLMLALLLVGCSSDKPEEKSADQPANKNTAETQSAEGTSDVGPVIEKIKSDGYITMGTSAEYPPYEWHDIEGSKDEIIGVDIEIAKAIAEDLGVELKIKDMQFEGLLTALGVGEMDFVIAGMAATDERREAVDFSNPYTSQEQVLLVLTENADKYKSAEDLKGVTIGTQLGSTQETYAREVFEKENGATVNSMPDNNNMVMELKNGTYDVIFMSGIPAEKYADMQEGLSVVDIGAPPEDAYSIAVKKGNTELVEAINKVVDKLIEEDQIKTWEKEFMDLTDK
>NZ_LM997412.1|WP_045078413.1|1270817_1271495_-|amino-acid-ABC-transporter-permease
MMFIKEELEFIQTYYFAYLSGVGITILLSILGVVFGTILGLILSIMRLSESKILRLISKAYVEIIRGTPLMVQLLIVFFGLKLVIPTNMEFLRNSIILCSIAISLNAGAYIAEIIRGGINSVDKGQWEASRSLGLSKGQTLEKIILPQALKIILPSLGNEFIALIKETAIVIVVGVPDIIYKATAVKAKTYMAVKPMIYAAICYFILTFSLSKVMTAWERRLDND
>NZ_LM997412.1|WP_045078412.1|1270102_1270825_-|amino-acid-ABC-transporter-ATP-binding-protein
MIKTVDLKKSFKNLEVLKGINEEVNKGEVVAIIGPSGSGKSTFLRCLNMLEKPTSGDIYVNDEKINSPDVDLDKIRQKMGMVFQSFNLFPHMNVLENIILAPMMTKKIEREKAVEIAMTLLKRVGLEDKKDEYPKKLSGGQQQRIAIVRALAMEPEVMLFDEPTSALDPEMVGEVLDVIKFLAKEGMTLIIVTHEMGFAREVADRVLFMAGGYIVEKGTPEEIFGNPRNERTKNFLSKVL
>NZ_LM997412.1|WP_045078411.1|1269276_1269852_-|hypothetical-protein
MLSNNRSRKILKRNIHYGFLTEEKLPKVEFIEHNLTNESDWVITGEYKEFAKNHCATVCAANLTIFFRATRDDKNKIFMDIYKYMGNGPKIDIGYAMKKYFKDLDYDLKLKNLKSPGELKKSLDDRKPVILLLAGSLINWHWVLVTGYRIYGDEFYLKIVDGWHRIGRTYYKPGVGSKILLAIQCGLNKKN
>NZ_LM997412.1|WP_045078421.1|1280388_1280961_+|hypothetical-protein
MFSERLDAVMNVAGVSNSMLGRAVSMDGSYISRLRSGARKLPKKHDYVSLMSKYISGKITTDYQMQALLKLTGMSPEVFGNEINRAMYLEEWLLKEPSQSWNFADWMILSFAATSSINTSTHAQGESDTEVNRLKPYLYGNGGKRKAVEQFFQLILQEDKPQTLLLFPDEDMSWLYENASFSRKWAELFF
>NZ_LM997412.1|WP_045078422.1|1281033_1281705_+|hypothetical-protein
MIKWIPIYTSGAIEPYYYPRLRDGLFQRTLFIAPKTAAITSSSVQNHTEGMLNQLITDGRAIEALSKEYDRYFDLCRPLMKIYTESDMHRFANVMELFRQEKGDVCIRCKVPPLFVIPESVINMSGDKNSELYKLWKSSVSIFRSSVKRNQINISILNPKTALKNPQNLTPSFVSLFTEEKFIYSVQQYNDLTEQLKKLERRYENLHVYMHENTAEDTFLYAK
>NZ_LM997412.1|WP_052658411.1|1281967_1282963_-|DUF348-domain-containing-protein
MSFKGESSRKRLILIAVITVLAASALVMGFSTVFAKNVNLIIDGKEERVVTFSETVGELLKTKEIVLGEDKVVSPAEDTELTEGMDIVISELKTIVLTDGSGEKEVKAVGDTVEEILDYLEIEIDKDDVVTPTIEKEAEDNQRITIERVDKKHYNKVSEIPYETEIVENPEMYEGDSKTIQQGVVGQRIEKIQNTYVNDNLVSIDVIERTDKVEPVKHIVEKGTKKIESPVEGKSVKKVIVMEATAYDPTAGSKTAMGTKARVGAVAVDPKVIPLGTKLYIESMDGFPTYGYAVAEDTGGAIKGNRIDLFYNTNAQALKFGRRNVKVYVLD
>NZ_LM997412.1|WP_045078423.1|1283217_1283835_-|CoA-pyrophosphatase
MKFEKIKNIVRDSPSVPIDINHRYSVLIPFIEIGGEPHLLYELRSKTLKNQPGEICFPGGRIEKGEEIIDAAARETCEELLINPEDIEIYGEGDYLINPYGSILYSVVGKLNVDFKSIKPSAGEVEDVFTIPFNYFMEKPPKSYEVKFDARRDKYFPYELIPNGKNYKFKKSKDNVLFYQYKGMIIWGFTAKMTYNFIKKIKKNL
>NZ_LM997412.1|WP_045078785.1|1283837_1284962_-|patatin-like-phospholipase-family-protein
MSSKKVYGLTLEGGGAKGAYHIGSYFALKEKGFEFDCVVGTSIGAINAAMIVSGDVHKCANLWRNTTMADYYNRDDEVSEIVDKDISDIEELILKIKNLVSDTISKAELSIEPVRNLINKNIDERKVRESNTRFGLVTLNLTDKKTEELFIDEIPQGKLKKYILASCYLPIFKMEPLEGKYYLDGGFVNNIPYNMVQKMGLTPVIIRTKHSIVKNFYMPKDAIIIEPSKSYTSLMDFDPVKADEIIRIAYFDTYKALDGLLGNKYYIKPFSDEYALEVLRKIFFKEDTQEGENLTSKYKKLLEEAVMDIAKKYDVDWDYNYAKLLVIILEKIAQEKNIEYLKIYEMEEFIEEIRKTEKIKEDKNSFFKRLAKRI
>NZ_LM997412.1|WP_045078424.1|1284951_1285398_-|large-conductance-mechanosensitive-channel-protein-MscL
MGKLIDEFKDFIAKGNVLDMAVGVVIGGAFGKIITSLVEDIIMPIVGMALGNVDFSNIFITIGGADYATYEEAKAAGAAIGIGSFINNVVNFLIIALCIFIFIRQIGKMKEKYGKAEEDAPVTTKICPYCKSEIDIEASRCPHCTSEL
>NZ_LM997412.1|WP_045078425.1|1285408_1285831_-|hypothetical-protein
MRKSWNEYFMEITEMVATRSTCDRAFVGCVLVNQDNRIISTGYNGSIAGNKHCDEVGHTMRDGHCIATIHAEMNALLYCAREGISVKGARCYVTHFPCLNCTKALIQAGIKAIMYKEAYRIDDYALELIERNKIELKQIK
>NZ_LM997412.1|WP_045078426.1|1285830_1286427_-|reverse-transcriptase-like-protein
MYYAVKKGRETGIFKTWEEAKKQVVGYSGAVYKKFIEKSDAEDFMKDEIAKFDEALEEKTLNADELIAYVDGSYNIKDKSFSYGVLLFDNLGIYEEHSKRFYDEDSSMRNVAGEIKGAAFAMKRAIELGKRKIYLHYDYSGIENWAKKSWKANKIGTMEYRDYYAEIKDELEVVFVKVKAHSGVKYNEVVDKLAKDAK
>NZ_LM997412.1|WP_045078427.1|1286543_1287434_+|fructose-bisphosphate-aldolase
MNKEQLQRMKEGKGFIAALDQSGGSTPKALRLYGINEDQYSSEEEMFKLVHEMRSRIIKSPAFTSERILAAILFKVTMNSKIDDMYTADYLWEKKGIVPILKIDEGLDELKSGVQMMKPLKQIDELLKIAKERNIFGTKMRSVIKELNEEGIKKVVEQQFDFANKIAKAGFVPIIEPEVDIHSDKKEEIEELLKEEILKHLETLDKDIFVIFKLTLPTKANIYDEFLNYPQVVRIVALSGGYSREESVKLLSQNKNTIASFSRALTEGLNYSQSDEEFNELLDKSIEDIYKASIEK
>NZ_LM997412.1|WP_045078428.1|1287503_1288775_+|amidohydrolase
METYKEYLIEKRRKFHKIPEAGFMEIETTVEIIKELKKLGFKNIKYGRSIHHERLGVPDEESIKAHLRESHINADFDIKEIEEGYTGLIAEYDSGISGPKFGFRFDIDGLALEETKNKDHIPNKFAFNSKNEDFMHACGHDGHISIGLALAKYIISKKNLIGSYRFIFQGAEEGVRGGKSMADAGCAENLDYFFSSHLGMGFKTGEIGFGSVGFFATKKFDIDFIGKSSHASGAPEQGRSALLAAASLALVLNSLTQYSRGATRVNVGVLNSGTERNIVPEHAHMELEIRAEYQALLDDMESRVLKALEGTSIAFEVKNQIRLMGTSIAYNYIDEDFFEDLKNYLTSLGYNLILKPKFKASEDVSSMLKRVAEKGGKSLHFIIGSDLKSNHHTNSFDFDENSLYIGFQFYKDIIDYLNIKYKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

432788 : 448785

Staphylococcus_phage(40.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045077603.1\|432788_433556_+	alpha/beta hydrolase	A0A0Y0ADV3	Mycobacterium_phage	5.0e-10	33.3
WP_052658366.1\|433565_435098_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_045077605.1\|435107_436286_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_045077607.1\|436282_438382_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.2e-84	38.7
WP_045077609.1\|438365_438830_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.5e-45	61.6
WP_045077611.1\|439101_440232_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.5e-50	35.3
WP_045078709.1\|440233_440872_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.8e-37	39.2
WP_045077614.1\|440883_442098_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.6e-103	48.5
WP_045077617.1\|442110_442578_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.6e-36	53.0
WP_045078710.1\|442624_443218_+	HAD family hydrolase	NA	NA	NA	NA
WP_045077619.1\|443393_443660_+	protein veg	NA	NA	NA	NA
WP_045077621.1\|443719_445399_+	hypothetical protein	R4TVC0	Phaeocystis_globosa_virus	5.9e-11	31.5
WP_045077624.1\|445601_446372_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.2e-08	25.3
WP_045077626.1\|446481_447096_-	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
WP_045077629.1\|447180_448233_+	DNA polymerase IV	NA	NA	NA	NA
WP_045077632.1\|448275_448785_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	8.8e-27	42.6

DBSCAN-SWA_2

655295 : 704624

Deep-sea_thermophilic_phage(25.93%)

portal,protease,plate,tail,terminase,integrase

attL 647190:647209|attR 699021:699040

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
647190:647209	attL	NA	NA	NA	NA
WP_045078725.1\|655295_656216_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_045077852.1\|656227_656965_+	NAD-dependent deacylase	S5M4R0	Bacillus_phage	1.7e-23	29.8
WP_045077853.1\|656961_657684_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_045077854.1\|657696_658581_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_045077855.1\|658873_659065_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_045077856.1\|659343_659697_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_045077857.1\|659707_661384_+	DAK2 domain-containing protein	NA	NA	NA	NA
WP_045077858.1\|661429_663472_+	ATP-dependent DNA helicase RecG	Q9T1H9	Lactobacillus_phage	3.7e-07	22.6
WP_045077859.1\|663524_664070_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_045077860.1\|664066_664546_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.9e-23	41.4
WP_045077861.1\|664548_664989_+	ATPase	NA	NA	NA	NA
WP_045077862.1\|665099_666266_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_045077863.1\|666354_667557_+	acetate kinase	NA	NA	NA	NA
WP_045077864.1\|667644_668169_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_045077865.1\|668171_668351_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_045077866.1\|668456_669185_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_045077867.1\|669188_669800_+	flavodoxin family protein	NA	NA	NA	NA
WP_045077868.1\|669786_670443_+	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_045077869.1\|670432_671167_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_045077870.1\|671163_671928_+	hypothetical protein	NA	NA	NA	NA
WP_045077871.1\|671920_673153_-	aminopeptidase	NA	NA	NA	NA
WP_045077872.1\|673240_673849_+	hypothetical protein	NA	NA	NA	NA
WP_045077873.1\|674151_675297_-\|integrase	site-specific integrase	A0A2R2ZGM9	Clostridioides_phage	5.8e-18	26.2
WP_045077874.1\|675468_675855_-	PH domain-containing protein	A6N235	Microbacterium_phage	7.8e-36	62.5
WP_045077875.1\|675939_676506_-	cell division protein Fic	NA	NA	NA	NA
WP_045077876.1\|676521_677163_-	helix-turn-helix domain-containing protein	E5DV74	Deep-sea_thermophilic_phage	4.5e-28	37.7
WP_045077877.1\|677318_677525_+	helix-turn-helix transcriptional regulator	A0A0A7RTP5	Clostridium_phage	4.1e-07	46.9
WP_045077878.1\|677571_677781_+	helix-turn-helix domain-containing protein	A0A2H4J2S7	uncultured_Caudovirales_phage	8.9e-10	49.2
WP_045077879.1\|678139_678340_+	hypothetical protein	NA	NA	NA	NA
WP_052658378.1\|678282_678981_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	4.7e-31	36.4
WP_045077880.1\|679072_679261_+	hypothetical protein	NA	NA	NA	NA
WP_045077881.1\|679497_679728_+	hypothetical protein	NA	NA	NA	NA
WP_045077882.1\|679752_680070_+	hypothetical protein	NA	NA	NA	NA
WP_045077883.1\|680079_680610_+	hypothetical protein	E9LUU0	Lactobacillus_phage	6.8e-22	36.6
WP_045077884.1\|680611_681451_+	hypothetical protein	A6M982	Geobacillus_virus	4.9e-59	46.2
WP_052658379.1\|681490_682405_+	DUF4373 domain-containing protein	R9TLQ3	Paenibacillus_phage	2.9e-20	34.2
WP_045077885.1\|682401_682734_+	VRR-NUC domain-containing protein	W0G8N0	Listeria_phage	3.4e-11	45.0
WP_045077886.1\|682795_682987_+	hypothetical protein	NA	NA	NA	NA
WP_045077887.1\|682976_683321_+	hypothetical protein	NA	NA	NA	NA
WP_045077888.1\|683626_684025_+	hypothetical protein	NA	NA	NA	NA
WP_045077889.1\|684089_684782_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_045077890.1\|685086_685563_+\|terminase	terminase small subunit	A0A0A8WDX8	Clostridium_phage	1.5e-20	39.5
WP_045077891.1\|685546_686821_+\|terminase	PBSX family phage terminase large subunit	A0A0M4R5F3	Bacillus_phage	6.4e-135	55.5
WP_045077892.1\|686821_688234_+\|portal	phage portal protein	I1TJV4	Clostridium_phage	6.8e-69	37.5
WP_045077893.1\|688196_689372_+	hypothetical protein	A0A1P8BLD7	Lactococcus_phage	1.7e-12	27.3
WP_045077894.1\|689637_690237_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_045077895.1\|690240_691110_+	hypothetical protein	A0A1P8BLL0	Lactococcus_phage	3.1e-104	65.0
WP_045077896.1\|691124_691388_+	hypothetical protein	NA	NA	NA	NA
WP_045077897.1\|691405_691711_+	hypothetical protein	NA	NA	NA	NA
WP_045077898.1\|691691_692198_+	hypothetical protein	E5DV55	Deep-sea_thermophilic_phage	2.1e-25	37.1
WP_045077899.1\|692200_692584_+	hypothetical protein	NA	NA	NA	NA
WP_045077900.1\|692564_693086_+	hypothetical protein	NA	NA	NA	NA
WP_045077901.1\|693082_694078_+	DUF3383 family protein	E5DV56	Deep-sea_thermophilic_phage	1.1e-41	35.2
WP_045077902.1\|694077_694491_+	hypothetical protein	E5DV57	Deep-sea_thermophilic_phage	1.4e-19	42.6
WP_045077903.1\|694527_694788_+	hypothetical protein	NA	NA	NA	NA
WP_045077904.1\|694950_696984_+\|tail	phage tail tape measure protein	A0A0A7RVT5	Clostridium_phage	3.6e-55	39.7
WP_052658380.1\|696989_697466_+	hypothetical protein	NA	NA	NA	NA
WP_045077905.1\|697462_697771_+	hypothetical protein	E5DV60	Deep-sea_thermophilic_phage	5.9e-10	35.9
WP_045077906.1\|697754_698603_+	hypothetical protein	A0A1L2JY62	Aeribacillus_phage	3.1e-29	32.9
WP_052658381.1\|698599_699103_+	hypothetical protein	NA	NA	NA	NA
699021:699040	attR	NA	NA	NA	NA
WP_045078730.1\|699123_699387_+	PAAR repeat-containing protein	NA	NA	NA	NA
WP_045077907.1\|699387_699750_+	hypothetical protein	NA	NA	NA	NA
WP_045078731.1\|699769_700975_+\|plate	phage baseplate protein	E5DV64	Deep-sea_thermophilic_phage	2.8e-63	37.9
WP_052658382.1\|700964_701654_+	hypothetical protein	E5DV65	Deep-sea_thermophilic_phage	1.1e-08	35.4
WP_045077908.1\|701650_701956_+	hypothetical protein	NA	NA	NA	NA
WP_045077909.1\|701945_702413_+	hypothetical protein	NA	NA	NA	NA
WP_045077910.1\|702487_702709_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_045077911.1\|702705_702981_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_052658383.1\|703064_704624_+	hypothetical protein	H7BVN1	unidentified_phage	5.9e-58	36.7

DBSCAN-SWA_3

853084 : 867330

Bacillus_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045078059.1\|853084_853696_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	3.8e-16	27.9
WP_045078060.1\|853696_854146_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_052658445.1\|854154_856239_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.1e-11	40.0
WP_045078062.1\|856276_858058_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.5e-81	33.4
WP_045078063.1\|858154_859525_-	thioether cross-link-forming SCIFF peptide maturase	I7KLS1	Campylobacter_virus	3.9e-13	23.7
WP_045078064.1\|859561_859708_-	six-cysteine peptide SCIFF	NA	NA	NA	NA
WP_045078748.1\|859721_860006_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	6.8e-05	43.8
WP_045078065.1\|860042_861155_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.1e-97	52.3
WP_045078066.1\|861163_862186_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_045078067.1\|862200_863331_-	SpoIID/LytB domain-containing protein	Q2XU88	Pseudomonas_phage	2.5e-21	33.6
WP_045078068.1\|863327_864344_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.8e-10	28.6
WP_045078069.1\|864350_864941_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_045078070.1\|864942_865437_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_045078071.1\|865473_866250_-	hypothetical protein	NA	NA	NA	NA
WP_045078072.1\|866331_867330_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	2.2e-61	41.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LM997412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection