CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LN681226	Legionella hackeliae strain ATCC 35250 plasmid II, complete sequence	0 crisprs	PD-DExK,WYL	0	0	0	0
NZ_LN681225	Legionella hackeliae strain ATCC 35250 chromosome I	2 crisprs	cas3,DinG,DEDDh,WYL,RT,PD-DExK	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LN681225_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN681225_1

2030014-2030115

Orphan

Consensus_repeat	Method
TCAAATAACTCCTCACCATTCTTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN681225_1

>merge|NZ_LN681225|1|2030014-2030115|CRISPRCasFinder
TCAAATAACTCCTCACCATTCTTCCTACGTGCCTCGACTTGTCCGAGGCGCGAGACACAGAGTCGTTTACGGCCCTTTCAAATAACTCCTCACCATTCTTCC

>NZ_LN681225|1|1|2030014-2030115|CRISPRCasFinder
TCAAATAACTCCTCACCATTCTTCC	TACGTGCCTCGACTTGTCCGAGGCGCGAGACACAGAGTCGTTTACGGCCCTT
TCAAATAACTCCTCACCATTCTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN681225.1\|WP_045107498.1\|2029323_2029785_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_082060398.1\|2021199_2021544_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|119400
NZ_LN681225.1\|WP_045106254.1\|2024984_2025659_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226647
NZ_LN681225.1\|WP_045106263.1\|2033137_2033938_-\|PhzF-family-phenazine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|223461
NZ_LN681225.1\|WP_045106264.1\|2034021_2034441_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_LN681225.1\|WP_052673656.1\|2037242_2037920_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380407
NZ_LN681225.1\|WP_045106256.1\|2026394_2027123_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
NZ_LN681225.1\|WP_045106258.1\|2028415_2028622_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_LN681225.1\|WP_045106253.1\|2022510_2024991_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|225669
NZ_LN681225.1\|WP_045106252.1\|2021607_2022408_-\|Tim44-domain-containing-protein	unknown	unknown	gnl\|CDD\|214950
NZ_LN681225.1\|WP_045106267.1\|2036488_2036884_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_045106260.1\|2030379_2031651_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_LN681225.1\|WP_045106255.1\|2025657_2026266_+\|arylesterase	unknown	unknown	gnl\|CDD\|238860
NZ_LN681225.1\|WP_045106259.1\|2028686_2029067_-\|protease-inhibitor-I42-family-protein	unknown	unknown	gnl\|CDD\|378179
NZ_LN681225.1\|WP_045106265.1\|2034595_2035603_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176214
NZ_LN681225.1\|WP_147292334.1\|2031703_2032561_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_172480789.1\|2037930_2038107_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_045106266.1\|2035689_2036448_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_045106262.1\|2032532_2032940_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_045106257.1\|2027125_2028238_+\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	unknown	unknown	gnl\|CDD\|272978

Protein	Function_ID	Function_description	E-value
NZ_LN681225.1\|WP_082060398.1\|2021199_2021544_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|119400	cd06661, GGCT_like, GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) catalyzes the formation of pyroglutamic acid (5-oxoproline) from dipeptides containing gamma-glutamyl, and is a dimeric protein. In Homo sapiens, the protein is encoded by the gene C7orf24, and the enzyme participates in the gamma-glutamyl cycle. Hereditary defects in the gamma-glutamyl cycle have been described for some of the genes involved, but not for C7orf24. The synthesis and metabolism of glutathione (L-gamma-glutamyl-L-cysteinylglycine) ties the gamma-glutamyl cycle to numerous cellular processes; glutathione acts as a ubiquitous reducing agent in reductive mechanisms involved in protein and DNA synthesis, transport processes, enzyme activity, and metabolism. AIG2 (avrRpt2-induced gene) is an Arabidopsis protein that exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae pv maculicola strain ES4326 carrying avrRpt2. avrRpt2 is an avirulence gene that can convert virulent strains of P. syringae to avirulence on Arabidopsis thaliana, soybean, and bean. The family also includes bacterial tellurite-resistance proteins (trgB); tellurium (Te) compounds are used in industrial processes and had been used as antimicrobial agents in the past. Some members have been described proteins involved in cation transport (chaC).	3.30932e-14
NZ_LN681225.1\|WP_045106264.1\|2034021_2034441_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.90965e-18
NZ_LN681225.1\|WP_045106254.1\|2024984_2025659_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226647	COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism].	1.04326e-100
NZ_LN681225.1\|WP_045106255.1\|2025657_2026266_+\|arylesterase	gnl\|CDD\|238860	cd01822, Lysophospholipase_L1_like, Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.	5.76902e-86
NZ_LN681225.1\|WP_052673656.1\|2037242_2037920_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380407	cd07003, cupin_YobQ-like_N, Bacillus subtilis YobQ and related proteins, N-terminal cupin domain. This family includes bacterial proteins homologous to Bacillus subtilis YobQ and Photobacterium leiognathi LumQ, both uncharacterized proteins thought to be DNA-binding proteins that may function as AraC/XylS family transcriptional regulators. YobQ has an N-terminal cupin beta barrel domain (represented by this alignment model) and a C-terminal AraC/XylS family helix-turn-helix (HTH) DNA-binding domain. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	6.2294e-20
NZ_LN681225.1\|WP_045106256.1\|2026394_2027123_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	2.89108e-16
NZ_LN681225.1\|WP_045106258.1\|2028415_2028622_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	8.56308e-26
NZ_LN681225.1\|WP_045106253.1\|2022510_2024991_-\|FtsX-like-permease-family-protein	gnl\|CDD\|225669	COG3127, COG3127, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	1.65892e-162
NZ_LN681225.1\|WP_045106252.1\|2021607_2022408_-\|Tim44-domain-containing-protein	gnl\|CDD\|214950	smart00978, Tim44, Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane. Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region.	1.35825e-27
NZ_LN681225.1\|WP_045106260.1\|2030379_2031651_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.21044e-26
NZ_LN681225.1\|WP_045106263.1\|2033137_2033938_-\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	7.26635e-74
NZ_LN681225.1\|WP_045106259.1\|2028686_2029067_-\|protease-inhibitor-I42-family-protein	gnl\|CDD\|378179	pfam09394, Inhibitor_I42, Chagasin family peptidase inhibitor I42. Chagasin is a cysteine peptidase inhibitor which forms a beta barrel structure.	5.47955e-23
NZ_LN681225.1\|WP_045106265.1\|2034595_2035603_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176214	cd08252, AL_MDR, Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_LN681225.1\|WP_045106257.1\|2027125_2028238_+\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	gnl\|CDD\|272978	TIGR00236, UDP-N-acetylglucosamine_2-epimerase, UDP-N-acetylglucosamine 2-epimerase. This cytosolic enzyme converts UDP-N-acetyl-D-glucosamine to UDP-N-acetyl-D-mannosamine. In E. coli, this is the first step in the pathway of enterobacterial common antigen biosynthesis.Members of this orthology group have many gene symbols, often reflecting the overall activity of the pathway and/or operon that includes it. Symbols include epsC (exopolysaccharide C) in Burkholderia solanacerum, cap8P (type 8 capsule P) in Staphylococcus aureus, and nfrC in an older designation based on the effects of deletion on phage N4 adsorption. Epimerase activity was also demonstrated in a bifunctional rat enzyme, for which the N-terminal domain appears to be orthologous. The set of proteins found above the suggested cutoff includes E. coli WecB in one of two deeply branched clusters and the rat UDP-N-acetylglucosamine 2-epimerase domain in the other. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	5.42997e-88

>NZ_LN681225.1|WP_045107498.1|2029323_2029785_+|hypothetical-protein
MTTDYLKLTHLDIPGLIDAASNLPSIGYLKQSNDGLVYLDLANGYIHNLYPFLKNYSSTIVKPDYFGQKTAGAHISVIYPEENTKVDQQELGSSHYFELLHTFAGDIGNKRYYVLTVHAPTLIALRQRYGLGSQLKFKEHWIDLHITLGVSFS
>NZ_LN681225.1|WP_045106259.1|2028686_2029067_-|protease-inhibitor-I42-family-protein
MKTLWSSILLACATFTHADNMSLNVNPNQNQFVVTLPANPTTGYQWTVEKYDKSILKLLSSKYVSAQTKLIGAGGQMLFTFQLLKEKAYPQSTSMQFKYARPWEPETGSLKQVVVNFGTNKKPTQQ
>NZ_LN681225.1|WP_045106258.1|2028415_2028622_+|cold-shock-protein
MSEKIRGKVKWFNDKKGFGFIESEGKDYFVHFSAIQSSGFKTLAEGAAVLFKAGHGQKGPQAEDVEIA
>NZ_LN681225.1|WP_045106257.1|2027125_2028238_+|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)
MTKSKICSLGCIVGTHTEVIKIAPLLFELRSEPWVKTALISTGECQGELDAIFAVFDLKPDYHLNKMPKQQTLQEFAATLCNKLNLLIKKHHFDALLGAGNTTTVFISSLMAFYNQLAFGHIEAGLRTNPGKSFPEETHQILTAPLSTWHFAPSTFEKENLIREKIAVNKIFVTGSTVTDALHWIIKNKSETNEFRHIYNFVIVSTRQNGEHLKNICNAILELTTRFDDINFIFSLTETSESQQFFKTIFSNQPRVHLLPAVPYDEFVHLMRRAILLLTDSVTMQEEAPVLHKPILILNNDAEKPQLIKEGIGLLVGTSRETIVEIVSQLLTDGKLYLKMTRSHCPEGDEHAAKRIVEILKNKLPLKNTY
>NZ_LN681225.1|WP_045106256.1|2026394_2027123_+|L,D-transpeptidase
MKSGILLFCFLPTFLWAKAEIQEANYYGPKLCKYTPYTCVKVTRGKTWQKLFLDPVQRDLVQRLNRTNNRLWNGKILAVPKNLTTVTLFDISPFPLKINSSDNKQIIVDQEKLAWGAYDSHGYLVRWGPISSGSDKCSDSDNSCLTLTGMFEIFGKEDKHCISNAFPAGRGGAQMPYCMFFHKGFALHGSDDIPGYRASHGCIRMFIQDVKWLNENFVTLYDPKKKTGGTVVIVLPLYLKES
>NZ_LN681225.1|WP_045106255.1|2025657_2026266_+|arylesterase
MKCKTLFIFLFIFIIAPLQAKTILVLGDSLSAAYGINTKEGWVNLLNTKLKKNNFDYRVINISASGDTTRNGLAKLSSALKTYQPNIVIIQLGANDGLRGLSLAEMKSNLEKIIQESQNAKAKILLIATKLPPNYGPTYLKKFASVYGDLANQYQIPLIPMFLEGVAGDSLLMQKDGLHPNQKAQSKILANIWPHLQPLLTS
>NZ_LN681225.1|WP_045106254.1|2024984_2025659_-|ATP-binding-cassette-domain-containing-protein
MSHLDVIRLNNINFTVKSGSFDLLILQDISFAIKKGITVAITGASGSGKTSLLNIMAGLDLPTTGDVFYENQEITHLSEDERAKLRARRVGFIFQSFQLLPNLTGLENVMLPLEMNHYEDAFSKASYWLDKVGLSNRGHHYPLQLSGGEQQRVAIARAFAVEPDILFADEPTGNLDKKTGQTVADLLFTLNEQHKTTLVIVTHDEALAGRCQLHWRLDGGKLLC
>NZ_LN681225.1|WP_045106253.1|2022510_2024991_-|FtsX-like-permease-family-protein
MLKIPLIVKSLIRDWRSGELTLLFLALVTAMTCISALNIFAGRVNDQLTKQTSQLLGADLVVRSSFPIKDVWVKKAQVLQLKQTLTLSFLSMVEHEENLQLAQVKAVKEPFPILGELWISPRLHAPSVKLFEPPKPGTVWLAPRLFSLLKINVGESLMIGAASFTVAGVLTEEPGQTGDWFNISPRILMNWEDVPKTQVVQIGSNVAYRWLLTGTKDKLSTLKAYVTPQLTEQQELTDSTSTNPSITQIIQRTLNYLNLGTLMSLVLAGVAISMASLRYSMRHMQQVAVLRCFGASEYQILKIYLGSILLLGVLACLLGIGLGYAIQPLLAQWLYGLLPQFENHLPLKPALFSFAIGLIVLLVFSSVNILKLRHITAATIFRHEQPSLKISTWFSYSLAFLLLGGLAYFYTNSWRLTLSVVLGCAFFVGLVISTLWLIFNYLSKAKHYIHINWRFGFANIARNFGNSALQVIGIGLALTAILSLFILRTDLLESWQQQRSENSANYFIINIEPSQVSEIDKFLTVNTIKVSYFYPIVKGRLIAINNVPVQKIFGERAEQINVLRRELNLSWTNNLPLANEISEGVWDPKTQEDWISVEKGMMDKLKLALGDKISFRIGDTIVTAVITSVRTVDWTTFSPNFFTLFKPGILNNLPQTYIASMHLLPAQQPVLNNIVSQFPNVTVIDIANILKKVQSIVTNMAKAINFMSFFGLFAGLIIVILAMLSFVGVKQQETHILKVLGMGKTQLLLIQSSESFLIGFYAGFMAVLTASIITNYLAKVVLELNFTIPWKLILIVPVATASFTVLINSLVLRSQYQKKGLTRASL
>NZ_LN681225.1|WP_045106252.1|2021607_2022408_-|Tim44-domain-containing-protein
MRTLILSLLIGLLSFGLVVNEAAAKRFGGGRSFGVQRSYNSLFSSKPKPNTIGQQTNRSRWGGMLGGLLAGGLLASLFMGNGLGSGLLSWLIVGAVLLFIINIYRRRIQPGFQTANASRPSAYNWQSNSMNYQATGNYHMNSAGFSEEDFLREAKVKFIRLQTAYDQKNLQDLQEFTAPEVFAEIKMQLDERGNESNKTEVINLNAQLLDVSEQGDSTIASVRFTGSIKENDDPVSTLDEIWHFRKFYGTNAWVVGGLQQEASQPM
>NZ_LN681225.1|WP_082060398.1|2021199_2021544_-|gamma-glutamylcyclotransferase
MEKLFSYGTLQLEQVQLATFSRLLKGQKDKLKGYKLTDLEITDPYVIEVSGKSVHQILSPTTDEKASVEGMVFELTLEELLKADEYEVKDYRRIKVSLASGLEAWVYAHQSILD
>NZ_LN681225.1|WP_045106260.1|2030379_2031651_+|MFS-transporter
MFKSKSKFLPFFMWFFPLSFFTYQFILRLWPGLMMHQIMEQFSIDASRFGVLAALYYYGYSGMQIPVAIMLERFKVRYVVFAFSLLCGLATLLFSYTNNWYLAGLSRFLVGAGSAVGFLAVSKVISQWFPKSKYAKMVGFSFTLGLLGAIYGGKPVSLLVANYPWQNVALILALIAMLLGVGSYYFLRSPQQNNTKTDEPTTSFKASYFRTLLSSPTIWILAVANLLMVGSLEGFADVWGVSYLTTAFELDKSNAAQLVSFIFVGMLFGGPLLAFLSKYLGNYTVIAFCGVGMAFVFKLLLSTTTYNWYWLAALFFLIGLMCCYQVIVFAAGSDLVETKLLGVTIAFLNCINMLGGSFFHTLIGKAMDATWGGALSEEGLRIYALESYKTALLLIPGCAVVGSCLVGLIGFNLHRRQAHSLQA
>NZ_LN681225.1|WP_147292334.1|2031703_2032561_-|hypothetical-protein
MIPLIVILYMLLASIFPLSSYLLSLSFFGVTHIFYELSYIYKHLAHKLPRAFIILVVGALLLLLMIKTIAIFLSIPYSLLLIIEFSFILILMTIACYFKTTFLTVLILLLFMVGIIVNPVILFMCLAFLHNLTPWGFLVAENAAHKAWIVFIICPLIVFFMSLFLAIDPGFYSLSKVNLYLSHYLVTEHINAFMFACFATAVYLQLIHYHYVIKILPSFCKTPIKLPGVVIGVFLIMGLIFLCNFQESKKFYSLIAMFHAYLEIPLLLYCLPRKENKLNSAVLLD
>NZ_LN681225.1|WP_045106262.1|2032532_2032940_+|hypothetical-protein
MYKITINGIIFYLHSNLNIFLTLGITIVSELITFFIFLKKGLPKEHSTNWVWFIIGMNLITVPLAQIFYSHIPINPLAIDWYLTEILVILTEALLMYGIMRATFKNALFYSILLNMSSILGGAILCWLNLLPWCV
>NZ_LN681225.1|WP_045106263.1|2033137_2033938_-|PhzF-family-phenazine-biosynthesis-protein
MTKQSMFQVDAFTAKLFGGNPAAVCPLEEWLSDELMQSIASENNLSETAFIIKEGHHFHIRWFTPNSEVALCGHATLASAYVIFEKLGYPGDSLSFQSLSGELRVNRLGNALQLDFPALPYTEITPSSALLAAMNVVPKKVYESTFDLLLIFDDEADVKNAQLDLNAISRLQTRGVILSAPSTKYDVYSRCFYPGCDVPEDPVTGSAHCVIAPYWSERLGKKKIYALQGLRRQGELLCEVNNGRVLLKGECRLYLEGEISLPNVYE
>NZ_LN681225.1|WP_045106264.1|2034021_2034441_+|MarR-family-transcriptional-regulator
MLTSSLLKKANRLLIKKANELLKPYNITHAYTSFLLELFKQNGLTQAQMCKQIGIEQPTAVRTLDRMERDGFIYRKASETDRRVFLVHLTEKALDAKKDMDNCAANLNKVALAGFSKEEKEQFNQFIKRVNANLEKLKE
>NZ_LN681225.1|WP_045106265.1|2034595_2035603_+|zinc-binding-alcohol-dehydrogenase-family-protein
MKAIGYNKSLPIEDPNSLMDIELPTPTATGRDLLVEVKAIAVNPVDYKVRQREEAQPGAYRVLGWDAAGVVKAVGEQVTSFKPGDEVWYAGDITRAGCNSEFHLVDERIVGLKPKSLSFEKAAALPLTSLTAWELLFDRLCITASEKSSLLITGAAGGVGSILVQLARQLTSLTIIGTASREESKQWILNQGAHYAIDHSKPMHEQLVHLGIHEVDYVISLTHTDDHVEELIKCLKPQSKFALIDDPEYLNIRLFKLKSISIHWEMMYTRSMFKTPDMIKQHNILNEIAHLVDKEIIKTTFNENFGTINAHNLRKAHQLLESHQSRGKIVLSGFA
>NZ_LN681225.1|WP_045106266.1|2035689_2036448_-|hypothetical-protein
MRYVNMGEIKKYARDVQAACERTGVAARFPADTWEGNAAYVVEAQQELSAQPTKQNFEKYAQAIFLAAGWLKEDVGSDRTREQAFLTPYIVSLQAGVNHFLNINIPAPKRVVYDPEDKLTPAAQIFFRSQVFKQLLAYRDFLKNGRNNHFFGLLHFKKDYDVLNELINALNAQKSIEGIQAVFEDFYHEQVQNGYTRYDSINRGQDILNYILRLFGIKEKTSTALLEELSHYAENTTEYRSENERQLTSSTV
>NZ_LN681225.1|WP_045106267.1|2036488_2036884_-|hypothetical-protein
MSANELLAEIGKVIKSYDWTKEVRLNWLRDFGRNLVFFQNSSHALEFDRLSREESQGPRGINAINRFLNGTFSDTQKISGIKKILQERGYEGENKGNSWKRTDNTHAVYAQLAEMIANFENKESCYIPILL
>NZ_LN681225.1|WP_052673656.1|2037242_2037920_+|AraC-family-transcriptional-regulator
MSNSLSLRSYTSETHTHSHDFAQLVLPLRGQLELEIGGKSGIVNEATGAYIHSNTQHCFASGEDNLFLVVDFLNTSANWNCHHMPSFMQLNAPLKNYLAFAHSYLGSHSNPQTDSLLYQLLINLLTSELTTPDRCVIQVKLWIEQHLATPIDIGHLAKQCHISKSQLQRRFKQNTGFSVAQYCSTAVMPLATVILAWIILGEQLTVWQCVGMGLVLLSIVIYAKK
>NZ_LN681225.1|WP_172480789.1|2037930_2038107_-|hypothetical-protein
MVNLVSLQAMLLNERELNTAYERLNCHETKWKDAVTVLTRGLGNERRHQHWLETILEQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN681225_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN681225_2

2340310-2340417

Orphan

Consensus_repeat	Method
AGATAGCTTCTTGGAAGCCAAGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN681225_2

>merge|NZ_LN681225|2|2340310-2340417|CRISPRCasFinder
AGATAGCTTCTTGGAAGCCAAGGCACCTAAGCGACTGCATCAGATAGCTTCTTGGAAGCCAAGGCACCTAAGCGACTGCATCAGATAGCTTCTTGGAAGCCACGGCAC

>NZ_LN681225|2|2|2340310-2340417|CRISPRCasFinder
AGATAGCTTCTTGGAAGCCAAGGCAC	CTAAGCGACTGCATCAGATAGCTTCTTGGAAGCCAAGGCACCTAAGCGACTGCATC
AGATAGCTTCTTGGAAGCCACGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN681225.1\|WP_045106484.1\|2344951_2345560_-\|outer-membrane-lipoprotein-chaperone-LolA	unknown	unknown	gnl\|CDD\|178807
NZ_LN681225.1\|WP_044011715.1\|2349836_2350058_+\|translation-initiation-factor-IF-1	unknown	unknown	gnl\|CDD\|178954
NZ_LN681225.1\|WP_045106478.1\|2338224_2339226_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236901
NZ_LN681225.1\|WP_045106479.1\|2339505_2340171_+\|DedA-family-protein	unknown	unknown	gnl\|CDD\|182775
NZ_LN681225.1\|WP_045107533.1\|2349017_2349710_+\|leucyl/phenylalanyl-tRNA--protein-transferase	unknown	unknown	gnl\|CDD\|234720
NZ_LN681225.1\|WP_045106473.1\|2333084_2333741_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|307978
NZ_LN681225.1\|WP_045106474.1\|2333806_2334796_-\|flagellar-motor-switch-protein-FliG	unknown	unknown	gnl\|CDD\|235561
NZ_LN681225.1\|WP_045106476.1\|2336475_2336790_-\|flagellar-hook-basal-body-complex-protein-FliE	unknown	unknown	gnl\|CDD\|178948
NZ_LN681225.1\|WP_045106483.1\|2343654_2344941_-\|replication-associated-recombination-protein-A	unknown	unknown	gnl\|CDD\|237355
NZ_LN681225.1\|WP_045106470.1\|2327493_2331258_-\|TIGR02099-family-protein	unknown	unknown	gnl\|CDD\|273971
NZ_LN681225.1\|WP_045106471.1\|2331281_2331752_-\|flagellar-export-protein-FliJ	unknown	unknown	gnl\|CDD\|376722
NZ_LN681225.1\|WP_045107534.1\|2350209_2351568_-\|metalloprotease-PmbA	unknown	unknown	gnl\|CDD\|182922
NZ_LN681225.1\|WP_045106482.1\|2342501_2343608_-\|type-III-polyketide-synthase	unknown	unknown	gnl\|CDD\|238427
NZ_LN681225.1\|WP_045106477.1\|2336877_2338197_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_LN681225.1\|WP_045106472.1\|2331751_2333098_-\|flagellar-protein-export-ATPase-FliI	unknown	unknown	gnl\|CDD\|274607
NZ_LN681225.1\|WP_045106481.1\|2341730_2342453_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN681225.1\|WP_045106475.1\|2334797_2336423_-\|flagellar-M-ring-protein-FliF	unknown	unknown	gnl\|CDD\|235668
NZ_LN681225.1\|WP_158644245.1\|2340506_2341037_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_LN681225.1\|WP_102046690.1\|2348058_2349015_+\|thioredoxin-disulfide-reductase	unknown	unknown	gnl\|CDD\|182343
NZ_LN681225.1\|WP_045106485.1\|2345562_2347986_-\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|236669

Protein	Function_ID	Function_description	E-value
NZ_LN681225.1\|WP_045106484.1\|2344951_2345560_-\|outer-membrane-lipoprotein-chaperone-LolA	gnl\|CDD\|178807	PRK00031, lolA, outer membrane lipoprotein chaperone LolA.	2.57442e-54
NZ_LN681225.1\|WP_044011715.1\|2349836_2350058_+\|translation-initiation-factor-IF-1	gnl\|CDD\|178954	PRK00276, infA, translation initiation factor IF-1; Validated.	1.77146e-46
NZ_LN681225.1\|WP_045106478.1\|2338224_2339226_-\|ATP-binding-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	1.64071e-43
NZ_LN681225.1\|WP_045106479.1\|2339505_2340171_+\|DedA-family-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	3.35299e-82
NZ_LN681225.1\|WP_045107533.1\|2349017_2349710_+\|leucyl/phenylalanyl-tRNA--protein-transferase	gnl\|CDD\|234720	PRK00301, aat, leucyl/phenylalanyl-tRNA--protein transferase; Reviewed.	1.28591e-120
NZ_LN681225.1\|WP_045106473.1\|2333084_2333741_-\|hypothetical-protein	gnl\|CDD\|307978	pfam02108, FliH, Flagellar assembly protein FliH.	2.75548e-22
NZ_LN681225.1\|WP_045106474.1\|2333806_2334796_-\|flagellar-motor-switch-protein-FliG	gnl\|CDD\|235561	PRK05686, fliG, flagellar motor switch protein G; Validated.	1.16128e-133
NZ_LN681225.1\|WP_045106476.1\|2336475_2336790_-\|flagellar-hook-basal-body-complex-protein-FliE	gnl\|CDD\|178948	PRK00253, fliE, flagellar hook-basal body protein FliE; Reviewed.	3.12806e-31
NZ_LN681225.1\|WP_045106483.1\|2343654_2344941_-\|replication-associated-recombination-protein-A	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0
NZ_LN681225.1\|WP_045106470.1\|2327493_2331258_-\|TIGR02099-family-protein	gnl\|CDD\|273971	TIGR02099, probable_transmembrane_protein, TIGR02099 family protein. This model describes a family of long proteins, over 1250 amino acids in length and present in the Proteobacteria. The degree of sequence similarity is low between sequences from different genera. Apparent membrane-spanning regions at the N-terminus and C-terminus suggest the protein is inserted into (or exported through) the membrane. [Hypothetical proteins, Conserved].	2.03752e-156
NZ_LN681225.1\|WP_045106471.1\|2331281_2331752_-\|flagellar-export-protein-FliJ	gnl\|CDD\|376722	pfam02050, FliJ, Flagellar FliJ protein.	6.5289e-11
NZ_LN681225.1\|WP_045107534.1\|2350209_2351568_-\|metalloprotease-PmbA	gnl\|CDD\|182922	PRK11040, PRK11040, peptidase PmbA; Provisional.	0
NZ_LN681225.1\|WP_045106482.1\|2342501_2343608_-\|type-III-polyketide-synthase	gnl\|CDD\|238427	cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs. PKS generate an array of different products, dependent on the nature of the starter molecule. They share a common chemical strategy, after the starter molecule is loaded onto the active site cysteine, a carboxylative condensation reation extends the polyketide chain. Plant-specific PKS are dimeric iterative PKSs, using coenzyme A esters to deliver substrate to the active site, but they differ in the choice of starter molecule and the number of condensation reactions.	1.80531e-112
NZ_LN681225.1\|WP_045106477.1\|2336877_2338197_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	0
NZ_LN681225.1\|WP_045106472.1\|2331751_2333098_-\|flagellar-protein-export-ATPase-FliI	gnl\|CDD\|274607	TIGR03496, FliI_clade1, flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively. [Cellular processes, Chemotaxis and motility].	0
NZ_LN681225.1\|WP_045106475.1\|2334797_2336423_-\|flagellar-M-ring-protein-FliF	gnl\|CDD\|235668	PRK06007, fliF, flagellar basal body M-ring protein FliF.	0
NZ_LN681225.1\|WP_158644245.1\|2340506_2341037_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.33333e-57
NZ_LN681225.1\|WP_102046690.1\|2348058_2349015_+\|thioredoxin-disulfide-reductase	gnl\|CDD\|182343	PRK10262, PRK10262, thioredoxin reductase; Provisional.	1.55328e-159
NZ_LN681225.1\|WP_045106485.1\|2345562_2347986_-\|DNA-translocase-FtsK	gnl\|CDD\|236669	PRK10263, PRK10263, DNA translocase FtsK; Provisional.	0

>NZ_LN681225.1|WP_045106479.1|2339505_2340171_+|DedA-family-protein
MEYLQQLLNYLLHIDTYLFSFVSNYGTWTYLVLFTIIFCETGLVILPFLPGDSLLFASGSVAAQTDSSLNIFLLFVLLVVASIVGNQLNYLIGRKIGPQVFTNNNSRFLNKKHLQKTHSFYEKHGGKTIIMARFIPIIRTFAPFVAGIGYMNHSHFFLYNLISATLWIGSLIGLGYFVGALPIVRENFTLVIYGIIVLSLLPPIVTFLYRKLFPVYQKVKE
>NZ_LN681225.1|WP_045106478.1|2338224_2339226_-|ATP-binding-protein
MVIKESLCREEFIDIPAQDILASLPCGLLVLNANGKIIWLNTAAEALLGANLRGASWREVIQQAFAPREDDGHEVSLVDGRRVRVAISSLDNLPGQLVILTDLTATRVYEQAKANQHRLMSIGRMTAQLAHQIRTPLSSAILYSEHLAAHPEMDSRCLQWILRLQECHASIEQQIQDLLLFARGETIELSPVRIQDWLNQLMERAQPLIEAQSAKLSINNTLMGNKEVLLHIESLTGALLNLIINALQAKASFITVDILEPEKSKVQIKVTDNGMGMSDEVKSQAFAPFFTTKAQGTGLGLAVVNAVVNAHDGEVVLDSSSGQGSCITINLPG
>NZ_LN681225.1|WP_045106477.1|2336877_2338197_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MSDVLIVEDDPVLREALAETMNLAGHSYLSAKDGKEALAMLERHSPAIVLSDIRMDKLDGQQLLAEIQRRNPGVPVILMTAHGSVEDAVDAMRHGAVDYLQKPFSAHALTEKINRYIKPLSTDDDSQPVAQDPKSQALLSMALRVAQSDVGVMISGESGTGKEVLAHFIHDHSPRKQHPFIAINCAAIPEQMLEATLFGYEKGAFTGAYKSTPGKFEQAQGGTLLLDEVSEMSLSLQAKLLRVLQEKEVERIGANKLIQLDVRVLATSNRKLLDEVKAGRFREDLYYRLNVFPLHWLPLRERVCDIIPLANYLIRRHCQNNQPVIPVLSEEAKKALLEYSWPGNARELDNVVQRALVLQTHGTIEVPHLQLPQQIEEVVENTEIKKTEGKSLQNHEFELILRTLKEHNGNRQQVATILGVSERTLRYKLAKMREEGYSV
>NZ_LN681225.1|WP_045106476.1|2336475_2336790_-|flagellar-hook-basal-body-complex-protein-FliE
MSEINAVSLLNQLRAMAAKAEGGTVEVGAPALPFGSVLQNALDATNNLQQNADALKARFETGDPKVGIGEVMVASQKSNLAFEATLRVRNKLVQAYQDVMNMPV
>NZ_LN681225.1|WP_045106475.1|2334797_2336423_-|flagellar-M-ring-protein-FliF
MALADNASTAAARFASLSIPRQVGLMLGLAASVAIGVAVVLWSREPSYMPLYNEISTRDAADIVDSLQRNGIPFKVDQNQGTILVPTDEAQNARLKLAADGLPRGSGAGYELFADKSTFNTSQFMENARYKQALETELARTISQFHDVKSARVHLAIPRESAFVRDNREPSASVFIDVYPGVEIKKQTIASIINLVASSIPSLSASKVTVVDQNGQLLSEGGGQTLFTNTERYMEYRQTLEQQYVQKIQDILTPLLGFGRVKAKVSADIDFTNFEQTQETYNPESQSLRSEQKMEEKHNVDATATGVPGALSNTPPANAALKQNKDNKNNNNNNKQITNATETAQGNDYRAQTTKNFELDKTISHTKNQPGTVKRLTVAVLVDDRNVLNPKTKQMEAKPLTQAEVEQIKILVANAIGLNPKRGDSINVVNSHFVKPEPIDPIPDLHFWQKDSFWSIIKQVGAAIFILALVFGLFRPLFKSLIGQKREEEEQPEQAELTYQAQQNLLPHANDYESQLALLRQVVDKEPKRVAQVVKTWVERG
>NZ_LN681225.1|WP_045106474.1|2333806_2334796_-|flagellar-motor-switch-protein-FliG
MDGIERAAILLLGMGEKNAAEVLKHLEPRQVQKVGMAISTMSSVSKAKMQGVLGEFLNAIEDQTSLTVDAENYLRTILINALGEENAIPFIDRILVSDKDSGLNRLKWLDARLIADVIRNEHPQIIATILIHLDSEQSAEVVGYFSSEKRAEVLLRMCTIDTVKPEAISELGHVIERQLSGQKVGKAASAGGIKSVADVINFLEGSVETDVLDRIQEWDTELCDKIKDKMFVFENLVDMDNRSVQTLLRDISTEQLMLALKGTTEPVKEKIFGNMSKRAADLLRDDLEMQGPVKVSEVEKAQRDILAIARSLAEEGKIALGTKGGDEMI
>NZ_LN681225.1|WP_045106473.1|2333084_2333741_-|hypothetical-protein
MDKEFQPLYQERDKESFDIWELQVPEPEPIVEVDPQKEFEDECERLREEARQQGYQEGMQQAALELETKRQELLTWFNLLKKPVILLDKKLSYELVQTITWICETCIGIELSIHPEKILILLEEIKKELPALQGDKQLLMNPMDVQYLRSELNEQEAAELKDILVADEKLERGDFYLKSDYSELDGRLKTRLQEIFKKQLMEASPTDNQGEDSHNDML
>NZ_LN681225.1|WP_045106472.1|2331751_2333098_-|flagellar-protein-export-ATPase-FliI
MTCYESQLIKTLNNLRLKPKSGLLHCGRVSRAVGLTLEARGFHQAVGARCWVKINKTAQVEAEVVGFDNENAYLMSIGHTQGVGPGMLIIPSGKVAQVGVGYNLLSRVLNGAGVPIDDKEGIETFENYPLISQPFNPLKRAAIDTPMDVGVRAINGLLTIGRGQRIGLFAGSGVGKSVLLSMMTRFTAADLVVVGLIGERGREVKEFIENNLGQEGLSRSVVVAAPADESPLMRLHGAMVATSIAEYFRDQGKHVLLLMDSLTRFAQAQREIGLSIGEPPATKGYPPSVFAKLPQLVERAGNGKPGSGSITAFYTVLTEGDDQQDPIADAARAILDGHIVLDRELAEAGQFPAINIEASISRVMPNVATEPQIKQMLLVKKYLSIYEKNKDLILLGAYSKGNDPQLDKAIKFRDKINEYIVQNMDEKVDFNTSLQLLDELAALLKEAN
>NZ_LN681225.1|WP_045106471.1|2331281_2331752_-|flagellar-export-protein-FliJ
MNSRKERLLRLLTIKEQATKVAIDNLIRSREQFLSGKTRHNQLLGYRQDYVEQLHNLGDAGCTVGRIRNRIDFIAQLDTALGQMNQHLAQLAKQRSHYETIYMKAKSEQDAVKRLLERLEEQQHLKQERMEQKESDEYAQKQWYSKNSTINFNKTR
>NZ_LN681225.1|WP_045106470.1|2327493_2331258_-|TIGR02099-family-protein
MPLAILIIAAAVISSLFRALTPWATQYKTDVEHHLSTLLGEPVTISTMETGWYWFEPVIKLNQVEVLDGSKAVLKLKKLFVGINIFSSLWHWQIQPGVLFIDDLHLNLRQTDEGWQIDGIANRQNMAFDTETLKPILEWILDQQKIILKDVSAHLFFKDGTVIPFDDLDLSIANHSGHYRIKGNAFLEQTTATKFELLADLYLDADALNKTSGHAFFSVHQVLPAQWQKFLPQNRFQILGGKGDVQLWADFNKGNLTNAQGRLNFSHLAWADTDTEKGQLIQSLKANLAWAPQNDGSWQLTGDHIGLRLSGTSWPENSFVIRYQQTTKNYFIYIKNILLQSLCSTSIAWPESMHTILAMKPYGELHDTQVYVNNEKIDYVLSRFVNLGWLPSESRPGAENLSGVIHWQPTEGRLEFDSKNAVIVPQNQPPINFSLLNAAFDWKELDQGLRVSMERLVLSHSNLLFSAQGVADEVSKDSMGPVRLKAQFSASNAEEWMPYLPSKHLKRKLDAWLKNDIKHIAKMTGELTLNGNMKDFPFDTQPGEFSIKSYLSGVDLVFARNWPVTREIEAYLNVTKRTLEADIVHANLQGIEVDKGNLRVNDLGLDRETLLIHTKAETDAKKALAYVRASPLNKKLSALNILQMKGPVAVDLQLEAPLYPENDDILALGDIVFNKNNVQVHHAIDDVELKNLSGTLQFDQDSVLDSHLQALLLGNPVTILIKSVKGPSPSTEVRVKGQTNISVLRDKFKLPVFSLMQGSLWLESLLTITDEPSDLDHVRIQTSLQGLNIDLPPPLGKTKDSKVPLKIDIDFNSKKAVRLRFNYDNRLSSDLLFSGVKGAFALQKGKIILGNTDTSNDEQLHGLQILGSLPEFDLQQWLAVKEKMTTDNQEMPNALSLIDVKLELAKVFNQSYKNLSFKAKKQEKGNWEIRLNQEKIAANLRYQPSSNTVTGLFEKLHLDNEKPVDFKSASKLKPTNLPNLNLRVASFQVGELNIGDVSLKTTALKDQWELNTCKIKSPFYELTARGNWRENDKINTTQLQADLHITNLAKSLENWKVSPVVEANKGDVQFRGGWSGPIYKFSLAKLHGQLAMRFKDGRITNLSPETEEKLGLGKLLSILSLQTIPRRLKLDFSDLSEDGYSFDEFSGSFTISKGVMATQDSYIDGPVAYASMKGNLDIAKQYYDLDLKVNPHITASLPVVATIAGGPIAGIATWVASKLINQGMQKISGYTYKISGPWRQPVVQQIKIIKKRNV
>NZ_LN681225.1|WP_158644245.1|2340506_2341037_-|diguanylate-cyclase
MNQKQQKALEIIRKLSATDSLTGLYNRRYFEIKLKDESSRAKKNKHPLNLVFIDVDNFKSINDNFGHPCGDVFLKDLAGVIKNSQRVNDSVFRIRGDEFAAIFADTSLEETIQICSGIKEQFKKNNKQREVTISMGILCVPPASLDDLEEIVSAADKILYKAKKTGKNKIVSQQLS
>NZ_LN681225.1|WP_045106481.1|2341730_2342453_+|hypothetical-protein
MSFSFFTTAKNVFEQAFDLARYQEEKVTFDPKNPTHTKLLEDSTNLVTTKLKALHSIDSQIATSFTVGTFALGVSVLLAPFGTLAGICYAYGAYQLGQRKAAYAEYTSALENLARCCHWALGDVSNRDAKVIKENSAINNMMNTLYPLTNEAQLRLFISDNIENAYIEKSQEAKQDLSFMEHHLNQEEARLYFKIYGYKQGSFLDILQGIGFAIKNGFQAFGQLFSKKPVEEVSAPLNTM
>NZ_LN681225.1|WP_045106482.1|2342501_2343608_-|type-III-polyketide-synthase
MQPAITAIGIANPPYKRSQQEIAALICDGFNLKGAQKRLVKAIYKASGIEQRYSVINDYCKSPGEFDFFPNEPDAPLPSTAKRMQLYKEHALKLALQAINDCLSGLAFNKIEITHLITVSCTGMYAPGLDIELVQHLELQSTTKRTAINFMGCYGAFNGIKIADTICRADPHANVLVVCVELCTIHFQRAQSMENVISNAIFADGAAAVLIQGKKTNPIYLSLESFHCDLVPQTSQEMAWQIADYGFDIVLSSYVPQAIKSGITQFSEKLLQTVNWSFKDIDYFAIHPGGLKILQACEEALSISYEDNKHSYEVLSKFGNMSSATILFVLKKIWNSLEKQDHGKNIFSCAFGPGLTLESMLLKTGYLA
>NZ_LN681225.1|WP_045106483.1|2343654_2344941_-|replication-associated-recombination-protein-A
MQPKAPLAELLRPTHWDDVIGQEHLLGAGKPLRVAFDSGIPHSMILWGPPGVGKTTLARLSAKAFDCEWIALSAVLSGVKDIRAAIDEAEHYLEQNRRTVLFIDEIHRFNKSQQDALLPFTESGLITIIGATTENPSFEVISALLSRAQVYVLKPLTAVNLRELLQRAENQVFPELKFTEDAISNLIDYADGDARRLLNLVEQANTAAQNQDVTEVTVELIQNALSPANRRFDKGGENFYDQISALHKSVRGSHPDAALYWLCRMLDGGVDPLYLVRRIIRMAWEDIGLADPRAMQLANDAAATYERLGSPEGELALAQAVIYMAVAPKSNAGYKAYNEAMAFIKKDKSREVPIHLRNAPTRLMKQLGYGHEYRYAHDEPHAYAAGETYLPEGMKEPGWYEPVSRGLEMKIAEKLAFLRTLDKETKKK
>NZ_LN681225.1|WP_045106484.1|2344951_2345560_-|outer-membrane-lipoprotein-chaperone-LolA
MKKIGLLGVLLLLSTTVFSDSAADLQTKLNSIRSMSANFSQVVKAKERELSSSSGKMALERPGRFRWETKDPMEQLVIADGEKLWVYDVDLEQVTVKKQEKGVGGTAALFLSGYDDTVARDFDVTATTKGKTQLYDLRSKSNKANFQRVKLIFTGEILSGIEMYDQLGQHTIVNLKNVKTNPKLATTLFKFKPPKGTDVVQQ
>NZ_LN681225.1|WP_045106485.1|2345562_2347986_-|DNA-translocase-FtsK
MAKQQANNQTGNRKQALPNFLVKRLSEGGFILVTTLALYVLLSLITYDLSDPNWTHVSKSNTEITNAGGQVGAYIADALYFVFGYLSFCIPLVFAYIAWIVLKDYRALQSINKPAMLLRGSGFVFMVLGGCSLLSLDSELALDAQHSAGGVLGSFIADGFNGALSTQGAALLLSAIFLVGVTLLTGLSWIHLIELIGEYTTVAMHRVIRSALAGTRLIRARLKQINERQEKNQPVVKPERNLLSRKKEKMESAPVVIPSLEPLPAVSSVAPPAISLPTPQLIAPPPAPAPVKIKEPARPASKPNPAVQMGGSLPSLNLLDKGMQGKHMGGYTHQELENVSREVEQHLLDFGIQADVVAVHPGPVITRFELQLAAGIKVSKLSALAKDLARSLSVTSVRVVEVIPGKTVVGLELPNQHRDMVRLSEVLSADVYQQAHSPIALALGVDIAGHPMVVDLAKMPHLLVAGTTGSGKSVGINAMILSLLFKSTPEEVRLIMVDPKMLELSIYDGIPHLLTPVVTDMKEAASALRWCVGEMERRYRLMAALGVRNLAGFNAKLAEAQAKGESLTDPLWKPGNSMEETAPVLQKLPYIVVIIDELADMMMVVGKKVEQLIARIAQKARAAGIHLILATQRPSVDVLTGLIKSNIPTRMSFQVSSKIDSRTILDQQGAEQLLGHGDMLYLAPGSGAPLRVHGAFVDDKEVHRVADDWRARGEPEYIDEITQINEISEGGSFGEEGQETEEADPLYDQAVEFVIQTRKASISAVQRRLKIGYNRAARLVEEMERTGIVGPLDGGFRDVLVSTVTED
>NZ_LN681225.1|WP_102046690.1|2348058_2349015_+|thioredoxin-disulfide-reductase
MGNSNHHRLIILGSGPAGYTAAVYAARANLNPVLITGMQPGGQLTTTTEVDNWPGDIEGLQGPALMERMQKHAERFETKIVFDHIVKADLQQRPFVLKGDSETYTCDALIIATGASARYLGLESEKSYQGRGVSACATCDGFFYRNKAVCVVGGGNTAVEEALYLSNIASSVTLIHRRDTLRSEKILQDKLFEKARTGNIKLLWHHTLEEVLGDDMKVTGVRVHNVLDGSEQELKFDGVFIAIGHDPNTGIFKDQLTMKDGYITIRSGLEGMATATTIPGVFACGDVADHVYRQAITSAGFGCMAALDAEKYLDMLEK
>NZ_LN681225.1|WP_045107533.1|2349017_2349710_+|leucyl/phenylalanyl-tRNA--protein-transferase
MARVTLLTNDNLEFPDPENSDPQGLLAVGGDLSPERLLEAYRRGIFPWFEPGYLPLWWSPDPRLILKPNSFKISRSLKQSIKKPHRFTVDTVFPKVIQACASSEGRINKTWITNEMQEAYTTLHLMGYAHSFEIWQDSHLVGGLYGISLGRAFFGESMFHRTRDSSKLAMYYLCKTLKNWQFDFIDCQLPTEHLQSLGAVVISRREFLGLLRKSLEYPTHQGLWTHNVDG
>NZ_LN681225.1|WP_044011715.1|2349836_2350058_+|translation-initiation-factor-IF-1
MAKEDHIEMLGTVIDTLPNTMFRVELENGHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLTKGRIIFRDKN
>NZ_LN681225.1|WP_045107534.1|2350209_2351568_-|metalloprotease-PmbA
MRTLPENNNRVEGKSTSNLSKLMHEVLDMAKAQGATDAMVSVNNDSGFSVDVRMGEVETVAFNEDKGISLVVYIGNRKGAASSTDTSPAALSSLVTAACEIAKVSAEDPCFGLADRELMTTQYPDLDLYHPWTITPQEAIEMALSCESHALSLDKRISNSDGVNLSTHAFCNGFANTYGGEGIIQSTRHGISCSLIAKEGETMQRDYEYTTARHANALQPLEQIAKTAAERATSRLGARQLKTQKVPVLFSSRISSGLLSSFINAVSGGNLYRKNSFLLDSIGKAIFPKGFKIYEQPHLLRGLGSSPFDSEGVPTRNNIFIEDGILQQYVLGSYSARRMGLKTTANGGGVHNLTIDATAGGLQELLKEIDRGLLVTELMGQGVNGLTGDYSRGASGFWVENGELQYPVEEITIASNLKDMFKAIVAVGTDINPNYSTRCGSVLIKEMMVAGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

670402 : 679225

Micromonas_pusilla_virus(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045105239.1\|670402_672340_+	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	7.7e-148	50.1
WP_045105240.1\|672494_673634_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.6e-26	34.8
WP_045105241.1\|673725_674868_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	9.1e-48	34.0
WP_045105242.1\|674860_676009_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.5e-122	57.5
WP_045105243.1\|676036_677362_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.2e-46	30.5
WP_045105244.1\|677551_679225_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	1.6e-16	26.8

DBSCAN-SWA_2

1059087 : 1097238

Catovirus(12.5%)

tRNA,integrase,transposase

attL 1083028:1083044|attR 1100526:1100542

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045105535.1\|1059087_1060491_-\|tRNA	asparagine--tRNA ligase	A0A1V0SAP3	Catovirus	1.5e-76	35.0
WP_052673589.1\|1060746_1061319_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_045105536.1\|1061890_1062322_-	heme-binding protein	NA	NA	NA	NA
WP_045105537.1\|1062965_1064297_+	hypothetical protein	NA	NA	NA	NA
WP_158644240.1\|1065930_1066077_-	deoxyribodipyrimidine photo-lyase	NA	NA	NA	NA
WP_045105539.1\|1066389_1066728_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_045105540.1\|1066729_1067326_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_045105541.1\|1067325_1069320_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_045107401.1\|1069322_1070246_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_045105542.1\|1070369_1070762_+	hypothetical protein	NA	NA	NA	NA
WP_045105543.1\|1071557_1072820_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	8.4e-95	43.5
WP_045105544.1\|1072822_1073338_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	8.0e-28	45.7
WP_045105545.1\|1073489_1073720_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	4.5e-15	56.2
WP_045105546.1\|1073747_1075142_-	GIY-YIG nuclease family protein	I7B6P2	Escherichia_phage	3.1e-05	29.8
WP_156413540.1\|1076503_1077121_+	hypothetical protein	NA	NA	NA	NA
WP_045105549.1\|1079715_1080735_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_045105550.1\|1080842_1081463_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_045105551.1\|1081584_1081839_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_045105552.1\|1081835_1082192_+	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_045105553.1\|1082208_1083057_+	hypothetical protein	NA	NA	NA	NA
1083028:1083044	attL	NA	NA	NA	NA
WP_045105554.1\|1083455_1083833_+	hypothetical protein	NA	NA	NA	NA
WP_045105555.1\|1083829_1084558_+	hypothetical protein	NA	NA	NA	NA
WP_045105556.1\|1084554_1085043_+	hypothetical protein	NA	NA	NA	NA
WP_045105558.1\|1085876_1086368_+	hypothetical protein	NA	NA	NA	NA
WP_045105559.1\|1086475_1086865_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_045105560.1\|1086857_1087160_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_058393141.1\|1087597_1087987_+	hypothetical protein	NA	NA	NA	NA
WP_045105562.1\|1088584_1088875_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_045105563.1\|1088877_1089186_-	hypothetical protein	NA	NA	NA	NA
WP_045105564.1\|1089997_1090630_+	hypothetical protein	NA	NA	NA	NA
WP_052673590.1\|1090669_1091290_+	hypothetical protein	NA	NA	NA	NA
WP_158644241.1\|1091292_1091991_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_052673592.1\|1092003_1092771_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_045105565.1\|1092757_1093423_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	2.4e-08	24.6
WP_147292316.1\|1093663_1095640_+	hypothetical protein	NA	NA	NA	NA
WP_052673593.1\|1095725_1096061_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0N9RU54	Staphylococcus_phage	2.8e-13	37.0
WP_102046632.1\|1096164_1097238_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.0e-56	46.2
1100526:1100542	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1418642 : 1424649

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045105805.1\|1418642_1419713_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.2e-30	31.4
WP_045105806.1\|1419697_1420315_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.7e-21	35.2
WP_045105807.1\|1420311_1421520_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.2e-104	49.9
WP_045105808.1\|1421529_1422015_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.3e-24	46.4
WP_045105809.1\|1422199_1423837_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	51.7
WP_045105810.1\|1423833_1424649_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.6e-54	45.1

DBSCAN-SWA_4

1754953 : 1812449

Tupanvirus(33.33%)

tRNA,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045106052.1\|1754953_1756732_+\|tRNA	aspartate--tRNA ligase	A0A2K9L424	Tupanvirus	5.4e-15	26.6
WP_045106053.1\|1759636_1760323_+	DNA mismatch repair endonuclease MutH	NA	NA	NA	NA
WP_082650291.1\|1760319_1761207_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_102046642.1\|1761296_1761638_+	hypothetical protein	NA	NA	NA	NA
WP_045106055.1\|1761662_1762436_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_065238339.1\|1762697_1764566_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_045106056.1\|1764754_1765840_+	hypothetical protein	NA	NA	NA	NA
WP_045106057.1\|1766036_1766402_+	hypothetical protein	NA	NA	NA	NA
WP_045106059.1\|1766618_1766927_+	hypothetical protein	NA	NA	NA	NA
WP_045106060.1\|1766923_1767577_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_045106061.1\|1768090_1768909_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_156413559.1\|1769685_1769859_+	hypothetical protein	NA	NA	NA	NA
WP_082060393.1\|1770180_1770252_-	DUF4113 domain-containing protein	NA	NA	NA	NA
WP_045106062.1\|1770789_1773729_+\|tRNA	CCA tRNA nucleotidyltransferase	A0A2D1GNF6	Pseudoalteromonas_phage	6.5e-05	28.6
WP_045106063.1\|1773982_1774189_+	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_045106064.1\|1774750_1775614_+	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_156413558.1\|1775827_1775992_+	hypothetical protein	NA	NA	NA	NA
WP_102046683.1\|1777708_1777987_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_045106067.1\|1777976_1778294_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052673578.1\|1778629_1779112_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_115678705.1\|1779498_1779678_-\|transposase	transposase	NA	NA	NA	NA
WP_045106068.1\|1779738_1780968_+	hypothetical protein	NA	NA	NA	NA
WP_052673643.1\|1781257_1781746_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_052673644.1\|1781749_1782037_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_045106069.1\|1783156_1784044_-	hypothetical protein	NA	NA	NA	NA
WP_045106070.1\|1784329_1784863_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_052673645.1\|1785528_1786158_+	hypothetical protein	NA	NA	NA	NA
WP_045106072.1\|1786187_1786733_-	hypothetical protein	NA	NA	NA	NA
WP_045106073.1\|1786710_1786905_-	hypothetical protein	NA	NA	NA	NA
WP_045106074.1\|1787250_1787688_+	hypothetical protein	NA	NA	NA	NA
WP_147292331.1\|1788158_1789205_-	hypothetical protein	NA	NA	NA	NA
WP_045106077.1\|1789425_1791093_-	hypothetical protein	NA	NA	NA	NA
WP_082060394.1\|1791343_1791505_+	undecaprenyl diphosphate synthase family protein	NA	NA	NA	NA
WP_156413579.1\|1791786_1791942_-	hypothetical protein	NA	NA	NA	NA
WP_045106078.1\|1791970_1793008_-	saccharopine dehydrogenase NADP-binding domain-containing protein	NA	NA	NA	NA
WP_045106079.1\|1793357_1793606_+	hypothetical protein	NA	NA	NA	NA
WP_045106080.1\|1793871_1794825_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_045106081.1\|1794836_1795568_-	hypothetical protein	NA	NA	NA	NA
WP_045106082.1\|1795836_1797561_+	hypothetical protein	NA	NA	NA	NA
WP_045106083.1\|1797718_1798435_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_156413580.1\|1798502_1798676_-	hypothetical protein	NA	NA	NA	NA
WP_045106084.1\|1798848_1799802_+	hypothetical protein	NA	NA	NA	NA
WP_045106085.1\|1799806_1801543_-	hypothetical protein	NA	NA	NA	NA
WP_045106086.1\|1801591_1802224_-	hypothetical protein	NA	NA	NA	NA
WP_045106087.1\|1802292_1803192_-	hypothetical protein	NA	NA	NA	NA
WP_102046684.1\|1803372_1803990_+	hypothetical protein	NA	NA	NA	NA
WP_045106089.1\|1804036_1804921_-	FecR domain-containing protein	NA	NA	NA	NA
WP_045106090.1\|1804938_1806219_-	DUF560 domain-containing protein	NA	NA	NA	NA
WP_045107477.1\|1806426_1807326_+	EamA family transporter	NA	NA	NA	NA
WP_045106093.1\|1809024_1810272_+\|bacteriocin	NHLP bacteriocin system secretion protein	NA	NA	NA	NA
WP_045106094.1\|1810277_1812449_+\|bacteriocin	NHLP family bacteriocin export ABC transporter peptidase/permease/ATPase subunit	W8CYL7	Bacillus_phage	4.3e-30	26.6

DBSCAN-SWA_5

2190993 : 2197674

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045106377.1\|2190993_2191791_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-23	33.0
WP_045106378.1\|2191945_2192908_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	9.7e-35	31.3
WP_045106379.1\|2192941_2193469_+	HAD-IIIA family hydrolase	A0A140XBD6	Dickeya_phage	5.0e-25	46.7
WP_045106380.1\|2193465_2194038_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_045106381.1\|2194018_2194537_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_045106382.1\|2194533_2195259_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-21	27.4
WP_045106383.1\|2195327_2195891_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	3.7e-58	55.0
WP_045106384.1\|2195887_2196907_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.3e-73	43.7
WP_045106385.1\|2196903_2197674_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.5e-59	51.2

DBSCAN-SWA_6

2960284 : 3016718

Erysipelothrix_phage(27.27%)

protease,transposase,integrase

attL 2983409:2983453|attR 2998565:2998609

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102046655.1\|2960284_2961360_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.8e-56	46.2
WP_045106949.1\|2961648_2962539_-	hypothetical protein	NA	NA	NA	NA
WP_045106950.1\|2963435_2964104_-	DUF4199 domain-containing protein	NA	NA	NA	NA
WP_082060356.1\|2964232_2964568_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_045106951.1\|2964980_2966252_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_045106952.1\|2966199_2967891_-	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	1.0e-42	25.9
WP_045107593.1\|2968155_2969475_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	3.0e-42	28.6
WP_045106953.1\|2969485_2970034_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_052673726.1\|2970115_2970574_-	transcriptional repressor	NA	NA	NA	NA
WP_045106954.1\|2970625_2971861_-	phosphopentomutase	NA	NA	NA	NA
WP_045106955.1\|2971863_2973141_-	MFS transporter	NA	NA	NA	NA
WP_045106956.1\|2973157_2974426_-	MFS transporter	NA	NA	NA	NA
WP_045106957.1\|2974520_2975099_-	thymidine kinase	A0A1Z1LYD5	Serratia_phage	4.4e-51	54.3
WP_045106958.1\|2975231_2976281_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	5.5e-76	41.3
WP_045106959.1\|2976737_2978696_+	hypothetical protein	NA	NA	NA	NA
WP_158644250.1\|2978828_2980316_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_045106960.1\|2980431_2981217_+	DUF4239 domain-containing protein	NA	NA	NA	NA
WP_052673727.1\|2981444_2982788_-	GNAT family N-acetyltransferase	A0A2K5B2B6	Erysipelothrix_phage	1.5e-25	37.3
WP_045106961.1\|2983061_2983298_-	DUF1653 domain-containing protein	NA	NA	NA	NA
2983409:2983453	attL	NA	NA	NA	NA
WP_082060358.1\|2983622_2984846_+\|integrase	site-specific integrase	I6R9B6	Salmonella_phage	3.2e-43	28.8
WP_045106963.1\|2984855_2985692_+	antirepressor	NA	NA	NA	NA
WP_052673728.1\|2985900_2987076_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_045106964.1\|2987455_2987920_+	hypothetical protein	NA	NA	NA	NA
WP_045106965.1\|2988629_2989337_+	hypothetical protein	NA	NA	NA	NA
WP_045106966.1\|2989483_2989816_-	hypothetical protein	NA	NA	NA	NA
WP_045106967.1\|2989799_2990120_-	hypothetical protein	NA	NA	NA	NA
WP_045106968.1\|2990884_2991694_+	hypothetical protein	NA	NA	NA	NA
WP_045106969.1\|2991683_2992580_+\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_147292365.1\|2992750_2993176_+	hypothetical protein	NA	NA	NA	NA
WP_052673729.1\|2996255_2997110_-	hypothetical protein	A0A2K5B2C1	Erysipelothrix_phage	3.5e-28	34.5
WP_052673730.1\|2997188_2998313_-	site-specific DNA-methyltransferase	A0A2K5B255	Erysipelothrix_phage	6.6e-67	40.4
WP_045107598.1\|2998758_2999745_-	chitinase	G0T546	Wiseana_iridescent_virus	3.1e-36	35.0
2998565:2998609	attR	NA	NA	NA	NA
WP_045106971.1\|2999907_3000876_+	hypothetical protein	NA	NA	NA	NA
WP_045106972.1\|3000876_3001101_-	hypothetical protein	NA	NA	NA	NA
WP_172480833.1\|3001216_3002326_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_045106974.1\|3002351_3004589_-	MFS transporter	NA	NA	NA	NA
WP_045106975.1\|3004845_3006027_+	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_045106976.1\|3006023_3006296_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_147292366.1\|3006356_3006692_+	hypothetical protein	NA	NA	NA	NA
WP_045106977.1\|3006761_3010361_-	hypothetical protein	NA	NA	NA	NA
WP_045106978.1\|3010544_3011264_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_045106979.1\|3011336_3012173_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_045106980.1\|3012191_3012617_+	DMT family transporter	NA	NA	NA	NA
WP_045107599.1\|3012671_3014468_-	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_045106981.1\|3014505_3015291_-	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	1.6e-11	33.6
WP_045106982.1\|3015398_3015887_-	hypothetical protein	NA	NA	NA	NA
WP_045106983.1\|3015971_3016718_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LN681225

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection