CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009297	Burkholderia pseudomallei 406e chromosome 2, complete sequence	3 crisprs	cas3,DinG,csa3	1	0	4	0
NZ_CP009298	Burkholderia pseudomallei 406e chromosome 1, complete sequence	2 crisprs	DEDDh,csa3,DinG,WYL,RT	0	6	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009297_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009297_1

2735720-2735812

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009297_1

>merge|NZ_CP009297|1|2735720-2735812|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP009297|1|1|2735720-2735812|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009297.1\|WP_004529182.1\|2737274_2737766_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP009297.1\|WP_004524990.1\|2727935_2729501_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP009297.1\|WP_004198321.1\|2731188_2732214_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP009297.1\|WP_004539325.1\|2730041_2730551_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009297.1\|WP_004524980.1\|2742006_2743410_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP009297.1\|WP_044363669.1\|2730608_2731112_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009297.1\|WP_004533337.1\|2732444_2733293_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP009297.1\|WP_004539328.1\|2721207_2724456_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009297.1\|WP_004524979.1\|2743406_2744585_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922
NZ_CP009297.1\|WP_004187193.1\|2736030_2736279_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067
NZ_CP009297.1\|WP_004548632.1\|2740202_2741996_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|213656
NZ_CP009297.1\|WP_004524985.1\|2736973_2737282_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP009297.1\|WP_004524981.1\|2739813_2740071_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009297.1\|WP_004530245.1\|2724458_2725583_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP009297.1\|WP_004524995.1\|2720137_2721211_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP009297.1\|WP_004539323.1\|2738207_2739842_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183615
NZ_CP009297.1\|WP_004533188.1\|2725732_2727568_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP009297.1\|WP_004529181.1\|2733289_2735284_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP009297.1\|WP_004187346.1\|2736275_2736977_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP009297.1\|WP_004188221.1\|2737762_2738218_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057

Protein	Function_ID	Function_description	E-value
NZ_CP009297.1\|WP_004529182.1\|2737274_2737766_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	6.86601e-17
NZ_CP009297.1\|WP_004524990.1\|2727935_2729501_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79
NZ_CP009297.1\|WP_004198321.1\|2731188_2732214_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP009297.1\|WP_004524980.1\|2742006_2743410_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP009297.1\|WP_004539323.1\|2738207_2739842_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|183615	PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional.	0
NZ_CP009297.1\|WP_004533337.1\|2732444_2733293_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	4.46992e-34
NZ_CP009297.1\|WP_004539328.1\|2721207_2724456_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.40767e-92
NZ_CP009297.1\|WP_004524979.1\|2743406_2744585_+\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0
NZ_CP009297.1\|WP_004187193.1\|2736030_2736279_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37
NZ_CP009297.1\|WP_004548632.1\|2740202_2741996_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	1.95969e-179
NZ_CP009297.1\|WP_004524985.1\|2736973_2737282_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	4.12229e-10
NZ_CP009297.1\|WP_004530245.1\|2724458_2725583_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	4.38049e-26
NZ_CP009297.1\|WP_004524995.1\|2720137_2721211_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	1.83012e-39
NZ_CP009297.1\|WP_004533188.1\|2725732_2727568_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	3.7779e-132
NZ_CP009297.1\|WP_004529181.1\|2733289_2735284_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP009297.1\|WP_004187346.1\|2736275_2736977_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP009297.1\|WP_004188221.1\|2737762_2738218_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63

>NZ_CP009297.1|WP_004529181.1|2733289_2735284_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSREVSPEASREVSREVSCEVSHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPRPDARGDAARTAPSPQGGADANVDAEAEARHKR
>NZ_CP009297.1|WP_004533337.1|2732444_2733293_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGDTAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAARLEVTERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP009297.1|WP_004198321.1|2731188_2732214_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP009297.1|WP_044363669.1|2730608_2731112_-|hypothetical-protein
MRGAGRASPSRARRYENVSKEPNTHREARAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDMHPGDVTPVHVSRPVQFAVPAHEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPPPVGDDMQDLIH
>NZ_CP009297.1|WP_004539325.1|2730041_2730551_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNSELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP009297.1|WP_004524990.1|2727935_2729501_-|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP009297.1|WP_004533188.1|2725732_2727568_+|response-regulator
MHVEVFAQHSSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLDAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRAKTAAARVQR
>NZ_CP009297.1|WP_004530245.1|2724458_2725583_+|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFVLDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP009297.1|WP_004539328.1|2721207_2724456_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQGGAGGRPGAGERAAGESLAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSDVGSDVGSDVASEAGPEAGLAASAESGAERAREPAADITADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPPSHAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAASVPVILGATILLLKKQER
>NZ_CP009297.1|WP_004524995.1|2720137_2721211_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MIQVTRKQIVAAAAVVVVALGAYYGWTLLRHQGPGDGFASGNGRIEATEIDVATKLPGRIDAILVDEGDFVKAGQPLANMQIQVLRAQYDEATAQRQRALNTAAGVQSQVAQRKSDKAAAQAMVVLRESELDAAERRLARSQTLSREGASSLQELDDDRARARSAQAAVSAAAAQVAAAQAAIEATEAQLVAAHSAVTAADATVARVQADIDDSQLASPRDGRVQYRVAQPGEVLPAGGKVLNLVDLSDVYMTFFLPETVVGRVALGADARIILDAAPNYVIPATVSFVSSTAQFTPKTVETANERQKLMFRVKARIDRELLQKHLKLVKTGLPGVAWVRVDPSKPWPAQLMVKVPQ
>NZ_CP009297.1|WP_004187193.1|2736030_2736279_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP009297.1|WP_004187346.1|2736275_2736977_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP009297.1|WP_004524985.1|2736973_2737282_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFVAGACHFVSLGWNSRLFVAGRAGVALALQLARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP009297.1|WP_004529182.1|2737274_2737766_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREARDDAARGDARHAGAGAAPDDPRGAARRDPPPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP009297.1|WP_004188221.1|2737762_2738218_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP009297.1|WP_004539323.1|2738207_2739842_-|F0F1-ATP-synthase-subunit-beta
MADPQATNGTGAACAERDASDVGDARDEGAGRVVAVRGAVIDVAFDGGALPALNEALTIPVDGAAPILAEVHAHLSDAAVRALALGPTGGLRRGAAVRATGGPIRVPVGDAVLGRLLSVTGAPGDDGAALAADVERRPIHRGAPPLAEQKSANALFATGIKVIDLLAPLAQGGKAAMFGGAGVGKTVLVMELIHAMVERYRGISVFAGIGERSREGHEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDFTDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRRVIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIADTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAVASGAGPGTTSGTTSGTTSGTTSGTTSDPASGSAEPQGARHGR
>NZ_CP009297.1|WP_004524981.1|2739813_2740071_+|hypothetical-protein
MPFVACGSATVAPVWLVRRWLHHNGARRPPADLGQETGNRQTKRGIAQSETIDASASGADTVRAASIVDSNQIPQTYAWLQWPCQ
>NZ_CP009297.1|WP_004548632.1|2740202_2741996_+|alpha/beta-fold-hydrolase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAGAWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASVTLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP009297.1|WP_004524980.1|2742006_2743410_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGARLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP009297.1|WP_004524979.1|2743406_2744585_+|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHTVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPLAPLHQPQSVRLIRALRHVRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009297_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009297_2

3144859-3145004

Orphan

Consensus_repeat	Method
GCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGCTCGATCGCCGAAG	PILER-CR
CGGAATGCCCGATCATCGGGATGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009297_2

>merge|NZ_CP009297|2|3144859-3145004|PILER-CR,CRISPRCasFinder
TCGTCGGGATGCTCGATTGCCGCAGTCACCCTCCGCCGGGGCTCCGTCGTCGGAATGCCCGATCATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGCTCGATCGCCG

>NZ_CP009297|2|1|3144859-3145004|PILER-CR
TCGTCGGGATGCTCGATTGCCGCAGTCACCCTCCGCCGGGGCTCCGTCGTCGGAA	TGCCCGAT
CATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAAT	ACCCGATCA
TCGGGATGCTCGATCGCCG

>NZ_CP009297|2|2|3144909-3144994|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGC	CTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGC
CGGAATACCCGATCATCGGGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009297.1\|WP_004532579.1\|3134818_3135421_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009297.1\|WP_004532563.1\|3145580_3146846_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP009297.1\|WP_038716541.1\|3137580_3138516_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP009297.1\|WP_004196898.1\|3135392_3135833_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP009297.1\|WP_004523279.1\|3151313_3152345_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP009297.1\|WP_004200700.1\|3136167_3137283_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP009297.1\|WP_004536946.1\|3139181_3141080_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP009297.1\|WP_004530663.1\|3154658_3155108_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP009297.1\|WP_004188282.1\|3131858_3132902_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP009297.1\|WP_004529498.1\|3156282_3156717_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP009297.1\|WP_004187469.1\|3143769_3144165_-\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|224648
NZ_CP009297.1\|WP_004530664.1\|3154325_3154655_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009297.1\|WP_004538003.1\|3147061_3148903_+\|ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|180772
NZ_CP009297.1\|WP_004538004.1\|3152341_3154204_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP009297.1\|WP_004538001.1\|3138531_3139122_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009297.1\|WP_004188244.1\|3157122_3158253_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP009297.1\|WP_004532595.1\|3148977_3150789_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP009297.1\|WP_004532550.1\|3141363_3143637_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP009297.1\|WP_004200705.1\|3155561_3156215_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP009297.1\|WP_004523292.1\|3132907_3134140_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	unknown	unknown	gnl\|CDD\|223997

Protein	Function_ID	Function_description	E-value
NZ_CP009297.1\|WP_004532563.1\|3145580_3146846_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	1.43745e-113
NZ_CP009297.1\|WP_038716541.1\|3137580_3138516_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.81428e-62
NZ_CP009297.1\|WP_004196898.1\|3135392_3135833_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	3.1145e-25
NZ_CP009297.1\|WP_004200700.1\|3136167_3137283_-\|hypothetical-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.16274e-11
NZ_CP009297.1\|WP_004536946.1\|3139181_3141080_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	4.48837e-35
NZ_CP009297.1\|WP_004530663.1\|3154658_3155108_-\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.14402e-50
NZ_CP009297.1\|WP_004188282.1\|3131858_3132902_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
NZ_CP009297.1\|WP_004529498.1\|3156282_3156717_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	9.00264e-33
NZ_CP009297.1\|WP_004187469.1\|3143769_3144165_-\|conjugal-transfer-protein-TraR	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14
NZ_CP009297.1\|WP_004538003.1\|3147061_3148903_+\|ribonucleotide-reductase	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0
NZ_CP009297.1\|WP_004538004.1\|3152341_3154204_+\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.27089e-105
NZ_CP009297.1\|WP_004523279.1\|3151313_3152345_+\|hypothetical-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	3.7258e-30
NZ_CP009297.1\|WP_004188244.1\|3157122_3158253_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	2.53339e-55
NZ_CP009297.1\|WP_004532595.1\|3148977_3150789_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	3.75845e-75
NZ_CP009297.1\|WP_004532550.1\|3141363_3143637_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	7.68683e-57
NZ_CP009297.1\|WP_004200705.1\|3155561_3156215_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	6.31252e-20
NZ_CP009297.1\|WP_004523292.1\|3132907_3134140_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	gnl\|CDD\|223997	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion].	5.32689e-143

>NZ_CP009297.1|WP_004187469.1|3143769_3144165_-|conjugal-transfer-protein-TraR
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP009297.1|WP_004532550.1|3141363_3143637_-|FAD-dependent-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKTKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
>NZ_CP009297.1|WP_004536946.1|3139181_3141080_+|GMC-family-oxidoreductase
MLGATRSTLWGSRERPRIAAARAPGAVASRMREEARECAGPRGAGRAPHRATAAGGKTGRRTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETPVAA
>NZ_CP009297.1|WP_004538001.1|3138531_3139122_+|hypothetical-protein
MCRARGIGRQARGNATAPSPIAAAAIGARPRSAPRGPRISDAGRLAAARSAFAMHQERRKRNADRHGTHPYDADSRAAPREAPRFEHEPKKQRDAAQHEVDRDRAAREIHERIEHKARPDVRRAERPISQDVAQTPIGAAGAISPSTAHSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP009297.1|WP_038716541.1|3137580_3138516_+|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVGLTHRAIIGCDEHAPA
>NZ_CP009297.1|WP_004200700.1|3136167_3137283_-|hypothetical-protein
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRVERESAYSLTLLKRRLEAARDA
>NZ_CP009297.1|WP_004196898.1|3135392_3135833_+|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPAKIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP009297.1|WP_004532579.1|3134818_3135421_+|hypothetical-protein
MNSILAPDNAPPAPANRTSPLMSALARAVVTAPLPGSDRAAEASTRVSTMRAQSASAIRVRSCRRSRSSRHGLPESPACRRKSPARPRSRRAPRPLADHTRMRFSPPRLGVRTARPPPAGRSKPARGASAIRLRVQRRSSRLTMTLINVIVIARAPQTAIVAHRGIGPRAIGRLTARRRAARPSTLETRPSYETATHRNR
>NZ_CP009297.1|WP_004523292.1|3132907_3134140_-|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha
MSQYGPLRLHVPEPTGRPGCKTDFSYLRLSPAGKVRKPPIDVAPADTSDLAYGLVRVLDEHGRAVGPWAPDLDPDILRKGIRAMLKTRIFDARMQIAQRQKKISFYMQCLGEEAIAVAHTLALERGDMCFPTYRQQGILMVREYPLVDMMCQLMSNERDPLKGRQLPVMYSTRDAGFFSISGNLATQFIQAVGWAMASAIKGDTRIASAWIGDGATAEADFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGATFAGRGVGCGIASLRVDGNDFLAVYAASRWAAERARRNLGPTLIEWVTYRAGPHSTSDDPTKYRPGDDWTNFPLGDPLERLKRHMIGIGVWSEQDHEDTKAALEAEVLAAQKEAERYGTLADEHVPNVASIFEDVYKEMPAHLRRQRQQLGV
>NZ_CP009297.1|WP_004188282.1|3131858_3132902_-|alpha-ketoacid-dehydrogenase-subunit-beta
MTTASKEGPAASPMTMIQALRSAMDVMLERDGNVVVFGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPINEGGIVGAAVGMGAYGLRPVCEIQFADYFYPASDQIVSEAARLRYRSAAEFIAPLTIRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLISAIENDDPVIFLEPKRLYNGPFDGHHERPVTPWSKHPASLVPDGYYTVPLDSAAIVRAGGDVTVLTYGTTVHVSLAAAEETGIDAEVIDLRSLWPLDLDTIVESVRRTGRCVVVHEATRTCGFGAELIALVQEHCFHWLEAPVERVTGWDTPYPHAQEWAYFPGPNRVGDALRRAMEN
>NZ_CP009297.1|WP_004532563.1|3145580_3146846_+|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGARPAGWPTWGPMARAADAVPAPPPFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPLEAGAFGLDDYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRRAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPQRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGPRWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP009297.1|WP_004538003.1|3147061_3148903_+|ribonucleotide-reductase
MRTINKRTRTIAHADSFVRMIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDEARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHTAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPGLVFVDAIDAADPLRGRERIGATSPCGAQPLPPYGSAMLGAIDLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRTGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP009297.1|WP_004532595.1|3148977_3150789_+|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRPPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAVRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACEAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLERALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDHSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP009297.1|WP_004523279.1|3151313_3152345_+|hypothetical-protein
METSPLKTTTPEAIPPFDPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGFAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAELIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDFATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP009297.1|WP_004538004.1|3152341_3154204_+|STAS-domain-containing-protein
MTERERAARGRNDARRGGGDSGGDDEAWRRWLPGIATLRAYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLGTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVAYAHVAYAHVANAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLVAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVQGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEADAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARR
>NZ_CP009297.1|WP_004530664.1|3154325_3154655_-|hypothetical-protein
MLSSRLVSSRLAPCCVYIDIQGEGDVDVDAEGNGNGNIDVIDSKRCEPSGVEPVERAVRRPRYRAQSGCLSGIHRNGIVMPDPMPPTNRFDRLRASAVIVDRMKPRRSP
>NZ_CP009297.1|WP_004530663.1|3154658_3155108_-|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKDVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP009297.1|WP_004200705.1|3155561_3156215_+|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDIYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLAEALSLNEDELPILAQTVGKPAAHP
>NZ_CP009297.1|WP_004529498.1|3156282_3156717_-|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP009297.1|WP_004188244.1|3157122_3158253_-|porin
MMNAKSIAAAALAVAQAGLAHAQSSVTLYGALDAGVLWQNTSAASFSPTAPNTGAVVRFKDGGVYSSLWGIKGTEDLGGGYRVNFRLQGAFDGGTGKFGLSDAPGAVAAFNQIATLGVSGPFGTFNAGRQIVPMIYAMADTDVRAARFFGSVLTAWLGLNTAAGWPGNSTNAPIGALYDSDALVYQSPAFGGASLALEYAPGGVPGGVQRGARASIVLKYASNALNLAAVYYNGHDTNPAPGASATGLDNNRFVYVGAQYKLKDVAVSASYGNGRNPARGDRVNLDMFAFGLGYRVSPFFRVSSGVYYLKDRNRSANRSTSIVLGADYELSKHTTLYAQGGRVDNRGTMAQMLAYGQPVAPGLATTAAMLGMRHSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009297_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009297_3

3216265-3216407

Orphan

Consensus_repeat	Method
CGCCGCAGTCGTCGCCGCAGTCGTCGCCG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009297_3

>merge|NZ_CP009297|3|3216265-3216407|CRISPRCasFinder
CGCGACAGGCGTCGGCGACGTGGCCGACGGCGCGGCGAGGACCGACGGCGATGCGTAAAGGTGAGAAGAAACGGGAGCCGCCGCAGTCGTCGCCGCAGTCGTCGCCGCAGTCGTCGCCGCAGTCGTCGCCGCAGTCGTCGCCG

>NZ_CP009297|3|3|3216265-3216407|CRISPRCasFinder
CGCGACAGGCGTCGGCGACGTGGCCGACG	GCGCGGCGAGGACCGACGGCGATGCGTAAAGGTGAGA
AGAAACGGGAGCCGCCGCAGTCGTCGCCG	CAGTCGTCGCCGCAGTCGT
CGCCGCAGTCGTCGCCGCAGTCGTCGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009297.1\|WP_004538016.1\|3200986_3202090_-\|triacylglycerol-lipase	unknown	unknown	gnl\|CDD\|224001
NZ_CP009297.1\|WP_004523242.1\|3207000_3207702_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP009297.1\|WP_004523246.1\|3203010_3203409_-\|DUF4345-domain-containing-protein	unknown	unknown	gnl\|CDD\|372978
NZ_CP009297.1\|WP_004190283.1\|3198228_3200847_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|182070
NZ_CP009297.1\|WP_009961232.1\|3204743_3205526_-\|outer-membrane-lipoprotein-sorting-protein	unknown	unknown	gnl\|CDD\|379924
NZ_CP009297.1\|WP_004530642.1\|3205582_3207001_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226957
NZ_CP009297.1\|WP_009935523.1\|3202183_3202948_-\|4'-phosphopantetheinyl-transferase-superfamily-protein	unknown	unknown	gnl\|CDD\|225002
NZ_CP009297.1\|WP_038717629.1\|3209221_3213343_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|365848
NZ_CP009297.1\|WP_004530640.1\|3207701_3209189_-\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|109787
NZ_CP009297.1\|WP_004538018.1\|3203448_3204747_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009297.1\|WP_004538016.1\|3200986_3202090_-\|triacylglycerol-lipase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	2.10698e-42
NZ_CP009297.1\|WP_004523242.1\|3207000_3207702_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.92366e-104
NZ_CP009297.1\|WP_004190283.1\|3198228_3200847_-\|EAL-domain-containing-protein	gnl\|CDD\|182070	PRK09776, PRK09776, putative diguanylate cyclase; Provisional.	8.23599e-119
NZ_CP009297.1\|WP_009961232.1\|3204743_3205526_-\|outer-membrane-lipoprotein-sorting-protein	gnl\|CDD\|379924	pfam17131, LolA_like, Outer membrane lipoprotein-sorting protein. This is likely to be a family of outer-membrane lipoprotein-sorting proteins.	2.23171e-41
NZ_CP009297.1\|WP_004530642.1\|3205582_3207001_-\|ABC-transporter-permease	gnl\|CDD\|226957	COG4591, LolE, ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane].	1.1854e-31
NZ_CP009297.1\|WP_009935523.1\|3202183_3202948_-\|4'-phosphopantetheinyl-transferase-superfamily-protein	gnl\|CDD\|225002	COG2091, Sfp, Phosphopantetheinyl transferase [Coenzyme metabolism].	5.36352e-25
NZ_CP009297.1\|WP_038717629.1\|3209221_3213343_-\|cytochrome-P450	gnl\|CDD\|365848	pfam00067, p450, Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.	2.3135e-72
NZ_CP009297.1\|WP_004530640.1\|3207701_3209189_-\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|109787	pfam00743, FMO-like, Flavin-binding monooxygenase-like. This family includes FMO proteins, cyclohexanone mono-oxygenase and a number of different mono-oxygenases.	2.28514e-73
NZ_CP009297.1\|WP_004523246.1\|3203010_3203409_-\|DUF4345-domain-containing-protein	gnl\|CDD\|372978	pfam14248, DUF4345, Domain of unknown function (DUF4345). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 125 and 141 amino acids in length. There is a single completely conserved residue E that may be functionally important.	8.95852e-20

>NZ_CP009297.1|WP_038717629.1|3209221_3213343_-|cytochrome-P450
MSKHRQAPGPRGGLVMGNLAAYKRNPITMLLRLHQQYGDVARNRLGPFVTHALAHPDHIQYVLQENHRNYVRGRFYDNFKMFFGDGLLTTDGEFWRRHRRVVQPLFHKKQVDAHTAAVGDAALALAHRWSALPPGKALDVVEEMMHLSLRMLGLMVFNTDVSSHAEAVGPAVRFGIEAMMPQGNLNDFIPRWAPTRFNRRIAHARRAIDTIVAKIIADHREARCEPSDVISLLLNARDPDTGAPMTQQEVHDEVMTVFLAGHETTGAGLAWALYALAQHPAVLRQLRDELDARLGGRAPTVQDFEQLPYLSQVVDEVLRVYPPIWGFTRDLVEDDEIGGYRIPARSSVFMSPYVTHRHPAFWRNPDAFDPENFASDAPARHRFVYFPFGGGMRKCIGFQTALLQMRVLVAVVAQHFDLNALPGHPIELGATISLRPVHGIRLIVKPRERQQSHLARVREHESARALRPLGDTATTAGAACPMTAAREPGASAAALAAVEAGALDAAHRGGAAAAAAGEPCPPRNPAEAAPLPLAASPAPASPAVDADASARGVPAWRFTWRPVPVDPVPDEPSPALSGRRIALVNGRGGTAERVAAALARTCAKVSVFAPAASADHAEAARVFVNEAGPLDGIVDLGLEAPFALDDAGAWEAPMRRTVELLKACYGDWAAEDDTSRLFYVALTWMDGQMGYGETAGAQPLGGLWAGLAKTLPQELPNCNVRVLDIAPDETGRVDRLVVNELYRWGLFEVGYRGGVRYTLHAKRNELPPHAVDARTTLGAGDTVLFSGGARGIGLLCARALAERHGCTVIVTGRETPPDGGEPWMALDEPGFKHYGLEQLRAATPEHPPKAIRAALQRLKRRRELKTALDEMAALGLPVHYRVCDVTDRAAVRALCDELGDSLRMVIHNAGVDRPVRLIQKRAEDFADTVRTKVLGFANLCDAVRAQPRLVQFCNVGSLTGRWGGMTGETDYAAANEALARLGLWAARHAFSPACGVKTLVWPTWEGVGMITNFAVTQRYVSPMNVDEGVRHWLRELATPGSGEVMFMGAVGRAPTPVQIKGFVPIRELPNIGELVTRRHHVGEPVRFRPFKRFESRYAIDPAVAPYAHAFRFNGRAVLPASLVLEHACAVGDWVMPPTGEPRELSEMTNVVLRLDALPDVPAGGAPVELASEAAGYMIGDVWCVDVRCSDARTQAELLSMTLVYRPQPEQIGAAFARAPDTTPEPAPLTSAPHAAWNGELLPAGDWSVPDDASAGIVRIGRVPPAAVLSLWALPFPLELRLPVNHVEHVLRVLLAEWGAARADAPAVWRIGGAKLARLPAASADGVVEYAAGRFAVLDARGYVLLRIDDARVDGEPAQAALPETGALADPLTA
>NZ_CP009297.1|WP_004530640.1|3207701_3209189_-|NAD(P)-binding-domain-containing-protein
MTTTTNTTANTTTEPAAPGAARAAPATPPIRDCLDRYCIIGGGAAGIATAKNLREHGIAFDLIEREDDIGGTWYYGKPCSAIYQSVHMISSREFSEYTDYPMPADYPTYARGDQALAYLRDYARRFGVYEHAQFNRTVLEVAPLAHGGAWRVELDGHDVRHYKGVFVCNGHLSKPQVPDYPGRFDGLQLHSALYKTPDVLKGKRVLVVGAGNSGCDIAVEAVHHASAVFHSTRRGYFYWPKFLFGIPADRWAEWPLKLRMPLWARRFFGERLLRLTTAGQPEDYGLPKPDHKLFEAHFIINSTLFYHLGHGDLVAKPDVVELKGDRVAFSDGSEERIDAIVYATGFQLSFPFLDQSYLQWDKMQPRLYLNMFDRAHPNLFFIGLFQTSTGNWPLMDYQAQLVARYLRARDAAPRKAARLDRMIGRDRSNWNGGIRFSDTQRHVIEVEHFAYRLQLKRLIRALPDSRVAARQARPVAVASAVPAPAAAARARTGDA
>NZ_CP009297.1|WP_004523242.1|3207000_3207702_-|ABC-transporter-ATP-binding-protein
MAIVRVENVSKTYLLDSVKVTGLAGVSVDIEANRFTVLSGPSGSGKTTLLNMIGCIDRPDAGRVIVAGQDTAALCDDALSDFRAREVGHVFQSFNLLPVLSAYENVEYPLLMARTPARERARRVAYLLDAVGLAGKGAHRPSQLSGGQRQRVAIARALAAGPSLVLADEPTANLDSVTGRAIIALMREMQRESGVSFIVSSHDPQVLEAADDVVQIRDGRIVERRRIAQEAQG
>NZ_CP009297.1|WP_004530642.1|3205582_3207001_-|ABC-transporter-permease
MHTFMLALRNLQRNRRRSITTLLAMVVGVCAVLLFGGFSKDITFGLQTDFVRRSGHLQIQRHGYYQYGSGNPVAYGIGGYARLIAQLRDDPVLAPMIAVITPTLQFGGIAGNFEAGVSRTVLAQGAIADEQDRMQQWNDYGFPLTPKPYPLVGTAPDAAIVGNGVARVLHLCAPLRVPDCGDGDVARQAAPQAASGADAPADVLALAAAEAHAQESGRGERAGAAHIEVLAANAYGAPNVGGFTVAKAEQQGVKELDDVYLAMHLPRAQRLVYGGDAPRVTAIEIQLRHTAQLPAARARLDRLFGGRFEGQPLDVLDFAALNPFYDQTNRMFSMIFGFVFVLIGAIVLFVVSNTMSTAILERTVEIGTLRSMGVRRGGIQALFVCEGALLGVVGASIGVLVALALAFVVNHSGLAWTPPARIDSVALTVRVWGEWRLIALTFVGLAFVAGFSAWLPARHAARLSIVDALRYA
>NZ_CP009297.1|WP_009961232.1|3204743_3205526_-|outer-membrane-lipoprotein-sorting-protein
MRRLFRQWWAGLSFCAAALAYAQTAPDPQVLLAQSDAIRTPAKSFVLTATLTEYRAGKQVDGNTLSIYSKPDAPGGAFRTLVRFVAPARDTGKLMLKNGNDLWFYDPANQASIRISPDQRLLGQAANGDVVTVNLAHDYRAALKGAEDVMDGDRQTRHCYKLSLTGNAPGLTYHRIEMWLDASNSRPVKAKFYSESDRLLKSAFYRRYTAELGVERPTETVIIDGLDPNWVTVMRFSGYAWRDIPDAWLQRDYLPRFQAQ
>NZ_CP009297.1|WP_004538018.1|3203448_3204747_-|hypothetical-protein
MTRRAWAILMCAAAAAMPLRAAATGDADAVNDATNAALDLADATPVAAPETARPWKFSVQDAVRWSDGRGAASSWRNQLSLEFQFAHALTPTLGVNFAMRFDRFDPLSSGAASHRDVTLVKEAYASWKPSALLALDAGRINERIGAAIGYNPTDFFKAGAVSLDVPPDPDSRHTNRLGSVAVRAQRVWDSGSIALMLSPRLASRSVPGDPFATSDLQRTNGVDRWMLVGSQRIAPAIQPQWVLYGESGQSPQFGQNLSVLLGNAVVAYAEWTGGWRASLIGSATGGGNRDRAFRTRSAVGFTWTLPVDLSLTAELQGNSGGASASRWRALQASDAYAWGRAVRTSIAAQELPSRHGLFLMAAWRNVFVRRVDLTGFAQLDLGAGQQYWLELRRRFDKFDLAVQFLRQTGPAWSRFGAMPEASSVQVLGIFYQ
>NZ_CP009297.1|WP_004523246.1|3203010_3203409_-|DUF4345-domain-containing-protein
MSKRILQIATAILAAVPVTTGALGMMGIHDPLYASLGVALPADATLDGNLRFYAGVWFGLGLGAFWTIPNIERNGVLFRALWTMIFVGGIGRLISLVSLGAPFAPFIGFTVLEIVGAPLFVWWQSRVAATAG
>NZ_CP009297.1|WP_009935523.1|3202183_3202948_-|4'-phosphopantetheinyl-transferase-superfamily-protein
MMVEGLPRATPRAAGATLAFSVARPSAALMARLMRGEVHVWRARAEEAGSYLKRDCLSLSEHERAARLRYGAHRELFVFARAMLRVVLGEYLSADPARLVFDVEPGGKPVLFGRDLEFSVSHASGAVLLALARKRVGCDLESLGRKLDIDALAAASLGERERDVFARTPRRAQARLLLQCWTRKEALLKAHGAGLRRDPRELEMPWPARRAARDECACGGVRWAVADIALGAGWRAAVAMEECGADVHGFCLGW
>NZ_CP009297.1|WP_004538016.1|3200986_3202090_-|triacylglycerol-lipase
MKSRFASAAAAVRGARKTLAKVWAAALVAAMCAFAAPAAHADAATGALDDYAATRYPIILVHGLTGTDDYFGVVPYWYGMRPDLQQHGATVFVADLSGFQSDIGPNGRGEQLLAYVQQVLAVTGAQKVNLVGHSQGGLTSRYVAAVAPELVASVTTIATPHRGSPFADFVLGALSLDPTGLSTPIFGALLNVFGILTSHTHNTNQDAIAALNALSTPYATQFDAQFPSAGLGAPGACASGAPSETVGGNVHLLYSWSGSAYQPITLLGLTTGALDKSTIPLVDPANVLDPSTLVFLTAGNIMALKQAGLNDGFTSTCSSLYGTVISTDYKWNHFDEINQLLGIRGAYAADPVAVLRTHANRLKLQGV
>NZ_CP009297.1|WP_004190283.1|3198228_3200847_-|EAL-domain-containing-protein
MASLRTIYTSDSATGHASGIWRRTRNGPPPVRFRRWRAPGKYETAATKRRGGGAEARWTMNGTSSMREQALGMNDGGGQAAELRPALDVWPILLMVSVLVCVVIVSLAVVSFLRVYIGGESTWSKSQKDAVIYLIRYAETGDERAYKLYEAAIDKPYRLSLARAALQRKPPDRASAREAIIASGIDPTDATAAALLLPALSWVAKINYALQCWMQADVELAEFRSVASQLHALVSSGHRDDARVKALEYRAWEINERVSGLPDRFSKAFSDEFRSSVALLLVCYFVASMFLMYLALVWARKAALQRLSIQYALDRSEAFAEAALSSVAEAVITVGLAKNVDFINNAAEQLLGYPAAACVGAPVSSVLMLLDKETGHAVDIVDEFWAREERTPIKREVHLLRRDHSKIVVQTTISEMGDRVHGHIGYVLILRNMTREQQFLESLAWQATHDVLTGLVNRVEFERRLEIALADTASGKERADSMLLMLDLDRFKEINDTCGHAAGDAMLREVTQRFQSCLDDDDVLARLGGDEFGVLLPHGAGSWPSKNKAERLRRSLEDFVFLWEGERFTVSVSIGVLELCKAPRNLEMAVKLADIACYIAKERGRNRIQLADPSDLQQARHVGDVQWSRRIKTALENDGFRLYVQPIVHTRPDSRTPERAEVLLRMMDSAGRDISPAAFLPAAERYGLMGLIDRWVIRTVFRKLSALPAREYHEYNVNLSGASISDERFLEFVIAELLSSGLEPSVICFEITETIAVKNLELASRFMGELRTIGCRFALDDFGAGMSSFRYLRSLPIDYLKIDGEFVSNMMSDRVSYGVVSAINEVAHSMRCSTVAEHVESEVELAMLRELGIDFCQGYFFAQPSPWREGGY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_CP009297_3	3.2\|3216360\|19\|NZ_CP009297\|CRISPRCasFinder	3216360-3216378	19	NZ_CP009297.1	3216396-3216414	1.0
NZ_CP009297_3	3.2\|3216360\|19\|NZ_CP009297\|CRISPRCasFinder	3216360-3216378	19	NZ_CP009297.1	3216408-3216426	1.0
NZ_CP009297_3	3.2\|3216360\|19\|NZ_CP009297\|CRISPRCasFinder	3216360-3216378	19	NZ_CP009297.1	3216420-3216438	1.0

1. spacer 3.2|3216360|19|NZ_CP009297|CRISPRCasFinder matches to position: 3216396-3216414, mismatch: 0, identity: 1.0

cagtcgtcgccgcagtcgt	CRISPR spacer
cagtcgtcgccgcagtcgt	Protospacer
*******************

2. spacer 3.2|3216360|19|NZ_CP009297|CRISPRCasFinder matches to position: 3216408-3216426, mismatch: 0, identity: 1.0

cagtcgtcgccgcagtcgt	CRISPR spacer
cagtcgtcgccgcagtcgt	Protospacer
*******************

3. spacer 3.2|3216360|19|NZ_CP009297|CRISPRCasFinder matches to position: 3216420-3216438, mismatch: 0, identity: 1.0

cagtcgtcgccgcagtcgt	CRISPR spacer
cagtcgtcgccgcagtcgt	Protospacer
*******************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

599277 : 608584

Burkholderia_virus(57.14%)

integrase,transposase

attL 594207:594223|attR 620392:620408

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
594207:594223	attL	NA	NA	NA	NA
WP_004188376.1\|599277_601260_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.8e-83	44.8
WP_004545569.1\|601357_601738_+	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_004529901.1\|601731_603747_+	cation acetate symporter	NA	NA	NA	NA
WP_004538073.1\|604042_605242_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A4JX31	Burkholderia_virus	3.3e-226	99.7
WP_009971437.1\|605238_605376_-	hypothetical protein	Q8W6Q6	Burkholderia_virus	2.9e-17	97.8
WP_004542548.1\|605643_606225_+	hypothetical protein	A9YX38	Burkholderia_phage	2.2e-21	100.0
WP_160469016.1\|606455_606755_-	hypothetical protein	Q6JIH9	Burkholderia_virus	1.0e-35	98.6
WP_004538072.1\|606721_606943_-	hypothetical protein	NA	NA	NA	NA
WP_004537565.1\|607219_607495_-	bacteriophage protein Gp49	Q6JIH4	Burkholderia_virus	5.2e-42	95.6
WP_009971435.1\|608046_608316_+	BrnT family toxin	NA	NA	NA	NA
WP_004525420.1\|608299_608584_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	1.4e-10	50.0
620392:620408	attR	NA	NA	NA	NA

DBSCAN-SWA_2

761236 : 832991

Vibrio_phage(25.0%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525541.1\|761236_762004_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_004206084.1\|762042_763044_-	HpnL family protein	NA	NA	NA	NA
WP_004538026.1\|763040_763814_-	hypothetical protein	NA	NA	NA	NA
WP_004188272.1\|763810_764500_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_004188420.1\|764864_766379_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_004530037.1\|768088_769027_+	hypothetical protein	NA	NA	NA	NA
WP_004202234.1\|769060_769609_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190846.1\|769611_771117_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530039.1\|771260_771788_+	hypothetical protein	NA	NA	NA	NA
WP_004190879.1\|771867_772299_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_004196180.1\|772312_774175_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190851.1\|774171_775161_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004525547.1\|775163_778034_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	2.4e-60	27.2
WP_004538025.1\|778024_780316_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004535223.1\|780481_782770_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_009933072.1\|782773_784990_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_004525550.1\|784989_786060_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004525551.1\|786062_786779_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004190606.1\|786821_787211_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004530042.1\|787216_787810_+	type VI secretion lipoprotein TssJ	NA	NA	NA	NA
WP_004525552.1\|787806_789168_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004525553.1\|789250_790909_+	OmpA family protein	NA	NA	NA	NA
WP_004525554.1\|790905_794409_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190863.1\|794467_794827_+	hypothetical protein	NA	NA	NA	NA
WP_004190471.1\|794849_795275_+	hypothetical protein	NA	NA	NA	NA
WP_004536812.1\|795595_795871_+	hypothetical protein	NA	NA	NA	NA
WP_004528661.1\|796421_797321_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_004542286.1\|797362_797653_-	hypothetical protein	NA	NA	NA	NA
WP_004524287.1\|797542_798862_+	glycosyltransferase	NA	NA	NA	NA
WP_004524286.1\|798858_800445_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004535065.1\|800727_801723_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_004532079.1\|801848_802031_+	hypothetical protein	NA	NA	NA	NA
WP_004532078.1\|802027_803611_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_025988348.1\|804349_805603_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024431747.1\|806125_807790_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	2.0e-56	31.4
WP_004530051.1\|807922_809488_-	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_004538946.1\|809676_810693_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004523135.1\|811139_812339_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_004198247.1\|812516_813542_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_160457400.1\|813555_813840_+	hypothetical protein	NA	NA	NA	NA
WP_004186965.1\|813975_815250_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	6.9e-105	54.1
WP_004535113.1\|815322_816294_+	membrane dipeptidase	NA	NA	NA	NA
WP_004186987.1\|816444_816978_+	4-vinyl reductase	NA	NA	NA	NA
WP_004538948.1\|817038_819102_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_004538949.1\|819104_821030_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_004202150.1\|821034_822207_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004530055.1\|822203_822989_+	drug:proton antiporter	NA	NA	NA	NA
WP_004535147.1\|823040_824282_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_038717590.1\|824302_825448_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004523141.1\|825557_826421_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004530057.1\|826601_828257_+	APC family permease	NA	NA	NA	NA
WP_004538951.1\|828343_829219_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_038717592.1\|829362_830241_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004186939.1\|830403_831957_+\|holin	choline-sulfatase	NA	NA	NA	NA
WP_004530058.1\|831953_832991_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_3

1624803 : 1689828

Leptospira_phage(100.0%)

integrase,transposase

attL 1618168:1618184|attR 1680457:1680473

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1618168:1618184	attL	NA	NA	NA	NA
WP_004528426.1\|1624803_1626177_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_004528430.1\|1628292_1628643_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.3e-15	38.5
WP_076841855.1\|1628618_1629161_-\|transposase	transposase	NA	NA	NA	NA
WP_009971876.1\|1629136_1629397_+\|transposase	transposase	NA	NA	NA	NA
WP_004539182.1\|1629644_1636898_-	toxin	NA	NA	NA	NA
WP_004539183.1\|1637127_1639986_-	RHS repeat protein	NA	NA	NA	NA
WP_045596434.1\|1640041_1644499_-	virulence protein	NA	NA	NA	NA
WP_004539185.1\|1644586_1647556_-	RHS repeat protein	NA	NA	NA	NA
WP_038717046.1\|1647579_1655136_-	hypothetical protein	NA	NA	NA	NA
WP_009972582.1\|1657021_1657477_+	transcriptional regulator	NA	NA	NA	NA
WP_004539188.1\|1657636_1657840_-\|transposase	transposase	NA	NA	NA	NA
WP_122652984.1\|1657944_1659064_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_079999965.1\|1660019_1660973_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004539190.1\|1661336_1661510_-	hypothetical protein	NA	NA	NA	NA
WP_004539191.1\|1661573_1661768_-	hypothetical protein	NA	NA	NA	NA
WP_143289068.1\|1662584_1662842_+	hypothetical protein	NA	NA	NA	NA
WP_076849360.1\|1663010_1663652_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_076849362.1\|1663807_1663894_+	hypothetical protein	NA	NA	NA	NA
WP_004528452.1\|1664861_1665290_-	hypothetical protein	NA	NA	NA	NA
WP_004528453.1\|1665433_1666069_-	hypothetical protein	NA	NA	NA	NA
WP_076849357.1\|1666468_1666723_-	Com family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004539195.1\|1669097_1673684_+	insecticidal toxin complex	NA	NA	NA	NA
WP_004532472.1\|1673919_1681332_+	hypothetical protein	NA	NA	NA	NA
1680457:1680473	attR	NA	NA	NA	NA
WP_038717050.1\|1681372_1688749_+	toxin	NA	NA	NA	NA
WP_004539515.1\|1688745_1689828_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

2868065 : 2929217

Streptococcus_phage(25.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004539275.1\|2868065_2868794_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-21	31.2
WP_004552566.1\|2868974_2869628_-	glutathione S-transferase	NA	NA	NA	NA
WP_004539274.1\|2869653_2871087_-	amidohydrolase family protein	NA	NA	NA	NA
WP_004539273.1\|2871306_2872035_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-22	31.2
WP_076823033.1\|2872088_2872391_-	hypothetical protein	NA	NA	NA	NA
WP_038717128.1\|2872460_2874221_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_004544755.1\|2874646_2874946_-	hypothetical protein	NA	NA	NA	NA
WP_004539270.1\|2874957_2884209_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_071811406.1\|2884360_2884558_-	hypothetical protein	NA	NA	NA	NA
WP_004533385.1\|2884558_2884822_-	putative Immunity protein 75	NA	NA	NA	NA
WP_004539269.1\|2885413_2890072_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	8.3e-23	34.9
WP_004524859.1\|2890058_2891327_-	hypothetical protein	NA	NA	NA	NA
WP_004539268.1\|2897004_2897472_+	decarboxylase	NA	NA	NA	NA
WP_004539267.1\|2897627_2898653_+	hypothetical protein	NA	NA	NA	NA
WP_004539266.1\|2899216_2899816_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_004524853.1\|2899840_2900251_-	RidA family protein	NA	NA	NA	NA
WP_004539265.1\|2901680_2902028_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.3e-39	71.0
WP_004539264.1\|2902024_2902432_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	2.4e-11	36.5
WP_004539263.1\|2902864_2904898_-	hypothetical protein	NA	NA	NA	NA
WP_038717645.1\|2905138_2907310_-	alpha-galactosidase	NA	NA	NA	NA
WP_004524829.1\|2907314_2908166_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004524828.1\|2908166_2909090_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_004524827.1\|2909152_2910394_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004524825.1\|2910429_2911674_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_038717659.1\|2911716_2912355_-	hypothetical protein	NA	NA	NA	NA
WP_143284288.1\|2913189_2913777_-	hypothetical protein	NA	NA	NA	NA
WP_004536893.1\|2914127_2915282_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_004524822.1\|2917043_2917784_+	hypothetical protein	NA	NA	NA	NA
WP_004539259.1\|2919732_2920443_-	hypothetical protein	NA	NA	NA	NA
WP_004203275.1\|2920458_2922663_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-46	29.9
WP_004539258.1\|2922659_2925326_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.4e-78	30.7
WP_122633429.1\|2925338_2926784_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004529322.1\|2926780_2928652_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004196148.1\|2928656_2929217_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009298

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009298_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009298_1

3341955-3342034

Orphan

Consensus_repeat	Method
ACGGAATGGGCCCCGGCATGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009298_1

>merge|NZ_CP009298|1|3341955-3342034|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATGGGCGGCGGCTACGGGCGCGGAATGATGGGCGGCTACGGAATGGGGCCCGGCATGATG

>NZ_CP009298|1|1|3341955-3342034|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATG	GGCGGCGGCTACGGGCGCGGAATGATGGGCGGCT
ACGGAATGGGGCCCGGCATGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009298.1\|WP_004531075.1\|3343797_3345246_+\|RNA-polymerase-sigma-factor-RpoD/SigA	unknown	unknown	gnl\|CDD\|274108
NZ_CP009298.1\|WP_004537736.1\|3340750_3341719_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP009298.1\|WP_004525842.1\|3337486_3338362_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
NZ_CP009298.1\|WP_004535409.1\|3345259_3346873_-\|glutamate--cysteine-ligase	unknown	unknown	gnl\|CDD\|235001
NZ_CP009298.1\|WP_004530511.1\|3350086_3350641_-\|YaeQ-family-protein	unknown	unknown	gnl\|CDD\|377782
NZ_CP009298.1\|WP_004200731.1\|3334307_3334790_+\|DUF2778-domain-containing-protein	unknown	unknown	gnl\|CDD\|378506
NZ_CP009298.1\|WP_004523110.1\|3338372_3339485_-\|histone-deacetylase	unknown	unknown	gnl\|CDD\|212521
NZ_CP009298.1\|WP_004523120.1\|3347969_3349064_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	unknown	unknown	gnl\|CDD\|185333
NZ_CP009298.1\|WP_004536432.1\|3350860_3351208_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004553744.1\|3332765_3333770_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369676
NZ_CP009298.1\|WP_017881331.1\|3339513_3340608_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP009298.1\|WP_004525837.1\|3342986_3343535_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004523107.1\|3334786_3335071_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004524601.1\|3352930_3353086_-\|lipoprotein	unknown	unknown	gnl\|CDD\|215083
NZ_CP009298.1\|WP_004524603.1\|3351693_3352254_-\|spermidine-N1-acetyltransferase	unknown	unknown	gnl\|CDD\|237916
NZ_CP009298.1\|WP_154218334.1\|3332295_3332664_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004545654.1\|3347031_3347973_-\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP009298.1\|WP_161605795.1\|3336820_3337132_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004197761.1\|3349465_3349882_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319916
NZ_CP009298.1\|WP_024431929.1\|3335144_3336236_-\|phage-portal-protein	unknown	unknown	gnl\|CDD\|222860

Protein	Function_ID	Function_description	E-value
NZ_CP009298.1\|WP_004531075.1\|3343797_3345246_+\|RNA-polymerase-sigma-factor-RpoD/SigA	gnl\|CDD\|274108	TIGR02393, RNA_polymerase_sigma_factor_RpoD, RNA polymerase sigma factor RpoD, C-terminal domain. This model represents the well-conserved C-terminal region of the major, essential sigma factor of most bacteria. Members of this clade show considerable variability in domain architecture and molecular weight, as well as in nomenclature: RpoD in E. coli and other Proteobacteria, SigA in Bacillus subtilis and many other Gram-positive bacteria, HrdB in Streptomyces, MysA in Mycobacterium smegmatis, etc. [Transcription, Transcription factors].	2.83254e-88
NZ_CP009298.1\|WP_004537736.1\|3340750_3341719_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.83868e-70
NZ_CP009298.1\|WP_004525842.1\|3337486_3338362_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP009298.1\|WP_004200731.1\|3334307_3334790_+\|DUF2778-domain-containing-protein	gnl\|CDD\|378506	pfam10908, DUF2778, Protein of unknown function (DUF2778). This is a bacterial family of uncharacterized proteins.	2.57059e-50
NZ_CP009298.1\|WP_004523110.1\|3338372_3339485_-\|histone-deacetylase	gnl\|CDD\|212521	cd09996, HDAC_classII_1, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes bacterial as well as eukaryotic Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Included in this family is a bacterial HDAC-like amidohydrolase (Bordetella/Alcaligenes species FB18817, denoted as FB188 HDAH) shown to be most similar in sequence and function to class II HDAC6 domain 3 or b (HDAC6b). FB188 HDAH is able to remove the acetyl moiety from acetylated histones, and can be inhibited by common HDAC inhibitors such as SAHA (suberoylanilide hydroxamic acid) as well as class II-specific but not class I specific inhibitors.	1.0559e-172
NZ_CP009298.1\|WP_004523120.1\|3347969_3349064_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	gnl\|CDD\|185333	PRK15435, PRK15435, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada.	8.19665e-122
NZ_CP009298.1\|WP_004553744.1\|3332765_3333770_+\|hypothetical-protein	gnl\|CDD\|369676	pfam08065, K167R, K167R (NUC007) repeat. This family represents the K167/Chmadrin repeat. The function of this repeat is unknown.	0.0060801
NZ_CP009298.1\|WP_017881331.1\|3339513_3340608_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.08734e-149
NZ_CP009298.1\|WP_004535409.1\|3345259_3346873_-\|glutamate--cysteine-ligase	gnl\|CDD\|235001	PRK02107, PRK02107, glutamate--cysteine ligase; Provisional.	0
NZ_CP009298.1\|WP_004524601.1\|3352930_3353086_-\|lipoprotein	gnl\|CDD\|215083	PLN00162, PLN00162, transport protein sec23; Provisional.	0.00226922
NZ_CP009298.1\|WP_004524603.1\|3351693_3352254_-\|spermidine-N1-acetyltransferase	gnl\|CDD\|237916	PRK15130, PRK15130, spermidine N1-acetyltransferase; Provisional.	7.47948e-86
NZ_CP009298.1\|WP_004530511.1\|3350086_3350641_-\|YaeQ-family-protein	gnl\|CDD\|377782	pfam07152, YaeQ, YaeQ protein. This family consists of several hypothetical bacterial proteins of around 180 residues in length which are often known as YaeQ. YaeQ is homologous to RfaH, a specialized transcription elongation protein. YaeQ is known to compensate for loss of RfaH function.	1.52049e-103
NZ_CP009298.1\|WP_004545654.1\|3347031_3347973_-\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	8.158e-54
NZ_CP009298.1\|WP_004197761.1\|3349465_3349882_+\|lactoylglutathione-lyase	gnl\|CDD\|319916	cd07253, GLOD5, Human glyoxalase domain-containing protein 5 and similar proteins. Uncharacterized subfamily of VOC family contains human glyoxalase domain-containing protein 5 and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46868e-30
NZ_CP009298.1\|WP_024431929.1\|3335144_3336236_-\|phage-portal-protein	gnl\|CDD\|222860	PHA02536, Q, portal vertex protein; Provisional.	0

>NZ_CP009298.1|WP_004537736.1|3340750_3341719_+|LysR-family-transcriptional-regulator
MRRIDLLSALETFVCAVEEGSLSQAARRLAKTPSAVTKAIAGLEATLGVQLLERTTRRLALTESGRLYLATATDVLRRLADGARQLSERDDEPRGLLRVTTAHSFGHAILAPLCAPFAQAFPRVRIELSLSDHYVDIVGEGFDLALRMGNYDLPSQIVKPIGSNRGLLCASPGYLARRGRPTAPADLARHDCVIYRHPTLANTWTFERGGVRARLEPKGPLVTDDYGLALAAALDGAGVLPCPQWSVVDALEAGRLVPLLVDWRFESASFGEDRICAAYPSSRRGSTKIRRLVERVQARLADSEARVARVLGDALCADLARR
>NZ_CP009298.1|WP_017881331.1|3339513_3340608_-|polyamine-ABC-transporter-substrate-binding-protein
MKRIAWLAAVLASLACAAARAAGGNVLNIYNWAEYFAPDTIAGFEKETGIKVRLDVYDSNEALQTKLTTGNSGYDLVFPSNDFLARQIQAGLYRKLDKSRLPNLTNLDPAIVARAAEVDPGNQYSVPYMQGTFGLGLNVAKVKQALGGPLPANTLELIFNPAYAAKLERCGIAFNDAGSEVFPLALRYIGRDPNTTDPRDYEAALDMMKKIRPTIRQFIATPVMNDLATGDVCVVTGYSGAVLVAARRAAEAKNGQQIVYSLPSAGAPFWFDSMAIPKGAAHADHALRFIDYILRPDVVAKISNKVMYPNPNRVATPLVDRRLTANPAIYPDAATMRTLWVKRPMPPQAMRMQTRYWTRFKTGY
>NZ_CP009298.1|WP_004523110.1|3338372_3339485_-|histone-deacetylase
MIPTGLLFDPAFLSHRQGDLVYVVPHGTLNLGEHFDSPLRLAYTKQLLDAVGMTERLTRVAFARATDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSASTEDVARLAAGAACAAVDAVMTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARHAQAAHGVERVAIVDWDVHHGNGTQQAFYDDPSVLFVSLHEAANFPVDGGEARETGGGAGAGYNANVPLPSGTGDAGYRHAFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQRDGFRHMARALRQAAGGACGGRIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQFVQYPLGEGERAAVKAARAALAPYWPTLHRS
>NZ_CP009298.1|WP_004525842.1|3337486_3338362_-|N-carbamoylputrescine-amidase
MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELFETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIFDADGRALGIYRKTHIPDGPGYTEKYYFTPGDTGFRVWDTAYGRIGVGICWDQWFPECARAMALAGAELLLYPSAIGSEPHDASIDSRAHWHNAQRGHAAANLMPVAASNRVGVERGASGEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRALSEGAADRVR
>NZ_CP009298.1|WP_161605795.1|3336820_3337132_-|hypothetical-protein
MAMLRGGSPRPFAGAAQARGRAVADRGVAFDCEDAEAAAQLLEHAIAVEEVDLMREDAILGDGKPDVVRAAEITFLYRAELHRGGSPCAVGLGMLYFRGSSDH
>NZ_CP009298.1|WP_024431929.1|3335144_3336236_-|phage-portal-protein
MSSWRRRASTTAPSACSNVTSSAATTLRNRPRQIRAPARAEVFTFDDPMPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTFRPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVRRKADFSGFVYVNGWQERHEFEPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHAGFILYMTDAAQKQDDVDKMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKDEFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAELNDWLGDEVVRFDDYEIPLAPVAA
>NZ_CP009298.1|WP_004523107.1|3334786_3335071_+|hypothetical-protein
MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVFRALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA
>NZ_CP009298.1|WP_004200731.1|3334307_3334790_+|DUF2778-domain-containing-protein
MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVADKGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWFALYRIDGQIDDWTIVNGIRRGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK
>NZ_CP009298.1|WP_004553744.1|3332765_3333770_+|hypothetical-protein
MAQKKKVVYFLGAGASFGAGAKATVQAGHQLPIPTQATFRPTFLRFCKSQKNRARIESFLFRYFLGYGKTPVRTPAAKRRHLLTSIDVEEVFTFLSERTRAPSTSTQLRTYALQVWGALAEEIGQVFSRFNANSATKAIYKDFLKHHFRRFDTVVSFNYDTIFENSLPARRSARYVGLRDSAGTIPLLKPHGSVNWVQADDGTITVGNPVGPAVIVAPTHLKFIADPDQKEVQHPGYLDQAHEIQKIWAEMEREMRFARSLVFIGYSFPVADLYFASVLRSVLADRDTTPNIVIVNPDAVAISERLLRRFPLVTVSRFFDLAQFIRAGRAVIAQ
>NZ_CP009298.1|WP_154218334.1|3332295_3332664_+|hypothetical-protein
MLLLPAANSDAPLPPEHCLRRFLYAPPPFKINALRDSQSANPRLIKVNPGHPSTPELSFHCTAQAATSSATCPTNPPRTAPLTRSFAAIDYKAPEIPSTFNNLDKYRVSKTIDCKGFGALSG
>NZ_CP009298.1|WP_004525837.1|3342986_3343535_+|hypothetical-protein
MEEAYARRALLLHLGSVLQILSRLEGAPDNQSIEALLAANGMLADVPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGWKAYAATLREVSPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRERAAASVESATPAGAPVRRESYE
>NZ_CP009298.1|WP_004531075.1|3343797_3345246_+|RNA-polymerase-sigma-factor-RpoD/SigA
MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFAHDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDTTASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADPALGRARAALQRARARGDEGARAFARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPEKSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLRAIEKFEHRRGFKFSTYATWWIRQAISRAIADRARTIRVPVHVGDEARRVRKAADRIERRSGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLFDALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIEKRALQTLRVTAEACNAHDFLDVQP
>NZ_CP009298.1|WP_004535409.1|3345259_3346873_-|glutamate--cysteine-ligase
MPNNMTSRQTDLLQQRLAVLSTSPTREQLPDGLRGIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLERLDELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGASPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYLDALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFGRVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDTHARAIAAQRAKLDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSLAEQAELEGKNAGSFDAFVAAYRAYTLNRFSV
>NZ_CP009298.1|WP_004545654.1|3347031_3347973_-|DNA-3-methyladenine-glycosylase-2-family-protein
MSAAVEPAAVRPDSVVLELPFKSPYDWPRVLRFFAGRAIPGVEAVGDGAYRRTVDHHGAIGTLTVRKHPRKRCLVALVEGDAARHADAAFAARLSTMFDLQADPAAIGAHLARDAWFAPLVGAAPGLRVPGAWSGFELIVRAIVGQQVSVKAATTIVGRLVERAGERLAPHAPGAIGWRFPEPAALAACDLSRIGMPGKRAAALQGVARAVAAGDVPLEAYASDPAGVRAALLALPGIGPWTVEYVAMRAWRDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSARGG
>NZ_CP009298.1|WP_004523120.1|3347969_3349064_-|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada
MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPERIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA
>NZ_CP009298.1|WP_004197761.1|3349465_3349882_+|lactoylglutathione-lyase
MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQLRAGRSLIDLLAVGAPIDRAGSGAPGKGRNMDHLCLRVEPFDAAALRTHLAAHGARPGDEARRYGADGYGPSLYLFDPEGNMVELKGPPEAVAP
>NZ_CP009298.1|WP_004530511.1|3350086_3350641_-|YaeQ-family-protein
MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIAAFALFAHERLEFCKGLSDTDEPDLWQKDLTGAIEVWVDVGQPDERRIAKASGRAGRVNVIAYGGRTSDIWWQGARGKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWLSSATHDPVAIEWTTLKAREDA
>NZ_CP009298.1|WP_004536432.1|3350860_3351208_-|hypothetical-protein
MLKRTGLFLALAGGIVAFSVAQANGDASLKPQQEIQLTKNAWGCLSKDNLDSVLNHERDGKAQAKQQYFDDYRCLSVPEGQRFRVVSVDKGDVQFVSAENSDQQGLWTDARFIKQ
>NZ_CP009298.1|WP_004524603.1|3351693_3352254_-|spermidine-N1-acetyltransferase
MQIQNEQHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFTELSQLYDQHVHDQRERRFVAFDSDGELVGLVELIELDYIHRRGEFQIIIAPNRQGRGFATRATRLAVEYAFKVLNLRKLYLIVDKSNVAAIRVYEKCGFKHEAELIEEFFGNGQYHNALRMCIFQRDYFAAQPGAELHARE
>NZ_CP009298.1|WP_004524601.1|3352930_3353086_-|lipoprotein
MKKIIIALAVSAGILSGCAVYVPDQPGVIMAPQGGPGNGFCPPGQAKKGNC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009298_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009298_2

3488141-3488439

Orphan

Consensus_repeat	Method
AAGCGCTGAAGCGNTGACTC	CRT

6 spacers

The CRISPR arrays of NZ_CP009298_2

>merge|NZ_CP009298|2|3488141-3488439|CRT
GAGCGCTGAAGCGTTCGCTTCGGTCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCGACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGTTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCGACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGTTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCAACCACGGCATGGGATCGGAGTAAGCGCTGAAGCGCTGACTC

>NZ_CP009298|2|1|3488141-3488439|CRT
GAGCGCTGAAGCGTTCGCTT	CGGTCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCGACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGTTGACTC	CGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCGACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGTTGACTC	CGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCAACCACGGCATGGGATCGGAGT
AAGCGCTGAAGCGCTGACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009298.1\|WP_004538602.1\|3481681_3482533_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP009298.1\|WP_004185243.1\|3486633_3488028_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_CP009298.1\|WP_038716750.1\|3491379_3491721_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP009298.1\|WP_004195834.1\|3490861_3491056_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004524499.1\|3497112_3501042_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|236989
NZ_CP009298.1\|WP_004524512.1\|3479634_3480768_+\|citrate-transporter	unknown	unknown	gnl\|CDD\|238537
NZ_CP009298.1\|WP_004530461.1\|3485678_3486554_+\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535
NZ_CP009298.1\|WP_004185283.1\|3483006_3483477_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|180240
NZ_CP009298.1\|WP_004195838.1\|3494380_3496648_+\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|235514
NZ_CP009298.1\|WP_004195828.1\|3482609_3482879_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|180739
NZ_CP009298.1\|WP_004525749.1\|3491920_3492706_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270231
NZ_CP009298.1\|WP_004524510.1\|3481038_3481569_+\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP009298.1\|WP_004546057.1\|3489089_3490820_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP009298.1\|WP_004524502.1\|3492845_3493940_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP009298.1\|WP_004524507.1\|3484065_3485607_+\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NZ_CP009298.1\|WP_004524500.1\|3496923_3497100_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009298.1\|WP_004524508.1\|3483479_3484019_+\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NZ_CP009298.1\|WP_111963022.1\|3491279_3491414_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP009298.1\|WP_004195818.1\|3478739_3479627_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_CP009298.1\|WP_004195832.1\|3488457_3488883_+\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|234796

Protein	Function_ID	Function_description	E-value
NZ_CP009298.1\|WP_004538602.1\|3481681_3482533_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	4.13283e-72
NZ_CP009298.1\|WP_004185243.1\|3486633_3488028_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_CP009298.1\|WP_038716750.1\|3491379_3491721_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	1.61989e-34
NZ_CP009298.1\|WP_004524499.1\|3497112_3501042_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	gnl\|CDD\|236989	PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0
NZ_CP009298.1\|WP_004524512.1\|3479634_3480768_+\|citrate-transporter	gnl\|CDD\|238537	cd01117, YbiR_permease, Putative anion permease YbiR. Based on sequence similarity, YbiR proteins are predicted to function as anion translocating permeases in eubacteria, archaea and plants. They belong to ArsB/NhaD superfamily of permeases that have been shown to translocate sodium, sulfate, arsenite and organic anions. A typical ArsB/NhaD permease is composed of 8-13 transmembrane domains.	7.24581e-60
NZ_CP009298.1\|WP_004530461.1\|3485678_3486554_+\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	2.10577e-157
NZ_CP009298.1\|WP_004185283.1\|3483006_3483477_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|180240	PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated.	5.5546e-56
NZ_CP009298.1\|WP_004195838.1\|3494380_3496648_+\|primosomal-protein-N'	gnl\|CDD\|235514	PRK05580, PRK05580, primosome assembly protein PriA; Validated.	0
NZ_CP009298.1\|WP_004195828.1\|3482609_3482879_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|180739	PRK06876, PRK06876, F0F1 ATP synthase subunit C; Validated.	4.52385e-24
NZ_CP009298.1\|WP_004525749.1\|3491920_3492706_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270231	cd01069, PBP2_PheC, Cyclohexadienyl dehydratase, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes cyclohexadienyl dehydratase PheC. These proteins catalyze the decarboxylation of prephenate to phenylpyruvate in the alternative phenylalanine biosynthesis pathway in some proteobacteria and archaea. The PheC proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. Since they the PheC proteins are so similar to periplasmic binding proteins, (PBP), it is evolutionarily plausible that several pre-existing PBP proteins might have been recruited to perform the enzymatic function.	1.47897e-125
NZ_CP009298.1\|WP_004524510.1\|3481038_3481569_+\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.44425e-11
NZ_CP009298.1\|WP_004546057.1\|3489089_3490820_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP009298.1\|WP_004524502.1\|3492845_3493940_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP009298.1\|WP_004524507.1\|3484065_3485607_+\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NZ_CP009298.1\|WP_004524508.1\|3483479_3484019_+\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	2.00477e-65
NZ_CP009298.1\|WP_111963022.1\|3491279_3491414_+\|hypothetical-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	8.4013e-11
NZ_CP009298.1\|WP_004195818.1\|3478739_3479627_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	6.61248e-79
NZ_CP009298.1\|WP_004195832.1\|3488457_3488883_+\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|234796	PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated.	5.65855e-63

>NZ_CP009298.1|WP_004185243.1|3486633_3488028_+|F0F1-ATP-synthase-subunit-beta
MSTAALVEGKIVQCIGAVIDVEFPRESMPKIYDALILEGSELTLEVQQQLGDGVVRTICLGASDGLRRGVVVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGPIESENKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDPLDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFEKAKKIQ
>NZ_CP009298.1|WP_004530461.1|3485678_3486554_+|F0F1-ATP-synthase-subunit-gamma
MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYAEKVRAIAAHMSRANPEYRHPFMVANDGVKTAGMILVTTDKGLCGGLNTNVLRASLQKFKELEEQGQKVEATAIGGKGLGFLNRFGAKVISQVVHLGDTPHLDKLIGAVKTQLDLYSEGKLSAVYLAYTRFVNTMKQETVIEQLLPLSSEHFDTNDGTPATSWDYIYEPDAQAVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKELSEIVGGAAAV
>NZ_CP009298.1|WP_004524507.1|3484065_3485607_+|F0F1-ATP-synthase-subunit-alpha
MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAIDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVAASASESAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHADLIKRIEDTKDLSKDDESALHAALKDFKKSGAY
>NZ_CP009298.1|WP_004524508.1|3483479_3484019_+|F0F1-ATP-synthase-subunit-delta
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
>NZ_CP009298.1|WP_004185283.1|3483006_3483477_+|F0F1-ATP-synthase-subunit-B
MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL
>NZ_CP009298.1|WP_004195828.1|3482609_3482879_+|F0F1-ATP-synthase-subunit-C
MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQPELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG
>NZ_CP009298.1|WP_004538602.1|3481681_3482533_+|F0F1-ATP-synthase-subunit-A
MAASEGTRAPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWSIVCGLITILLLRLAARKATSGVPGRFQCAVEMLVEMVEDQSKAIVHGNRAFIAPLALTVFVWVALMNSLDFLPVDLPGRVIGWLGLSGIISHHRIVPTADLNGTLGIALGVFVLMLYYSIKIKGAGGFAHELVSAPFGSHPLLWIPNLALNIVEFVAKTVSLGMRLFGNMYAGELVFLLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHDAH
>NZ_CP009298.1|WP_004524510.1|3481038_3481569_+|ATP-synthase-subunit-I
MADRAPDKRHEDRRAAQRTVSGAVGRRAAAADDWDAEQQEDDVVPLTRAEAQALFGPEVSRPSRVTPYRVVVAQMVLSLVATLAWWLFSRSPGAAAQSAFLGGAIGWVPSALFVARLRLSGAGTVMGWVAGEALKLGVTIAMFAAVAFGYPGVHWVPLLVTYLVVLKTYWIALAWR
>NZ_CP009298.1|WP_004524512.1|3479634_3480768_+|citrate-transporter
MSNSVVGRAPARIIAFVRHEPVLSILVAALIALQAVHSLSAIALVRLVDWQTVATLAGLLMLTKALELSGFLMWLAHRIVHRVRSERALAALLVVFAAALSVWLTNDVALFVVIPLVLSLRELTPLPFKRLVIYIALAVNAGAIATPLGNPQNLFLWQLSGVSFGRFVIALGPLALVLMALLLAMVVFAFDGRPLDLSRDSTERPVDRAQAFATVAMFAGFVLLADAHHALAGVLAVAAVFLIVRRDAVLKIDWLLLLIFVLMFIVLRSAASLPAVHQAIAGIGLDTPLRAYAAGALLSQIISNVPAAILLSEFTHDWRALAFGVSVGGFGIAFGSLANLIAIRLSRARGMWLPFHLVSIPFGIASAVLGALLLHYF
>NZ_CP009298.1|WP_004195818.1|3478739_3479627_+|ParB/RepB/Spo0J-family-partition-protein
MNAVAKKKGLGRGLEALLGGSADITEAVKIEGAPNVLALGKLQAGKYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLEEVPVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRSRSAVSNLLRLLNLAMPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRETEKLVAHTTKAEPAVKARAKDDGGRDTRRLEEELSDLLASNVKIKVGRRGRGQLTIDFGDLDALEGILARLRGNVAA
>NZ_CP009298.1|WP_004195832.1|3488457_3488883_+|F0F1-ATP-synthase-subunit-epsilon
MATIKVDVVSAEEQIFSGQAKFVALPGEAGELGILPGHTPLITRIRPGAVRIESESGDEEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEETLQNAKSDIDLAKAQSELATAMAQLEAIQRLAKIRGKH
>NZ_CP009298.1|WP_004546057.1|3489089_3490820_+|AMP-binding-protein
MAADSGMGALIAPMHGLSYVRGPADVPLSDATIGQFLLDTVARFPDRAAVVFREQGVRRTWREFADEVDALAAALIQLGIARGDRVGIWSPNRAEWLLTQFATARIGAVLVNVNPAYRLAELEYALNKVGCKLLIAAERFKTSAYAEMIAEIAPELATTRAGDVLCAARVPSLRTVVTMSDAAHAGMLSFADVLARGRAALASARLDAIGATLDCRDPINIQFTSGTTGSPKGATLTHRNVVNNARSIANVMRLTEADAMCIPVPLYHCFGMVLSVLACVSAGAKMVFPGAAFEPGATLAAVSDERCTALQGVPTMFIAELDHPDFDRFDLSTLRTGIMAGSPCPIETMKRVVAKMHMSEVTIAYGMTETSPVSFQSATTDSLEKRTTTVGRIQPHLEAKIVDATGAIVPVGETGELCTRGYSVMLGYWDDEARTREAVVDGWMRTGDLATLDEEGFCNIVGRLKDMLIRGGENVYPREIEEFLFRHPKIQSVQVFGVPDSKYGEEVCAWIVLRAGETMTDDELREFCSGQIAHYKVPRYVRFVDELPMTVTGKVQKFVMRERMIDELGLSVQQTA
>NZ_CP009298.1|WP_004195834.1|3490861_3491056_+|hypothetical-protein
MSPLKTTRYGVSARRPKVERIGMGRRRLQQGCPWEGIRYETDGLVIRACVRSHAAHETASVLKP
>NZ_CP009298.1|WP_111963022.1|3491279_3491414_+|hypothetical-protein
MTAISTDEVPRKILKRDRVIAVVGFSDKPYRPSYEVAAYLRQNG
>NZ_CP009298.1|WP_038716750.1|3491379_3491721_+|CoA-binding-protein
MKSLLTCDKMVNRIVPVNPLLAGAALLGERVHPSLADARAALAADGIEIDMVDVFRKPEEVPAVVDAAIAIGARSLWLQPGVVHDEAAAKVRTAGLDVVVDRCVKIEHRGRFG
>NZ_CP009298.1|WP_004525749.1|3491920_3492706_-|transporter-substrate-binding-domain-containing-protein
MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCTTGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGGISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFAKQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK
>NZ_CP009298.1|WP_004524502.1|3492845_3493940_+|uroporphyrinogen-decarboxylase
MAQTLLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKQPDYATEVTLQPLERFPLDAAILFSDILTIPDAMGLGLDFAAGEGPKFAHPVRTEADVAKLAVPDIGATLGYVTDAVREIRRALTDGEGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYARPDLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRFSLDYVRRVLAQLKREHDGARVPAIAFTKGGGLWLEELAATGVDAVGLDWTVNLGRARERVAGRVALQGNLDPTILFAPPEAIRAEARAVLDSYGNHPGHVFNLGHGISQFTPPEHVAELVDEVHRHSRAIRSGAGS
>NZ_CP009298.1|WP_004195838.1|3494380_3496648_+|primosomal-protein-N'
MADAFVRVALDHPLPTLFDYRYRGDMPAAPGMLVQVPFGRRSVVGLVCEVTAHTDVPAAKLKAVDAVCTELPPLSRHWLELAAFAADYYQRGLGEVALPALPQALRDVPRWGRLLAPELRYRLLDAGRAALPDALPARGAALRRLAQALADAPALSLAEVRALHPKAVAVLDEWQAQGWAACDEIAITHADAQLVDNPAPASARRPTALPPQLTDQQAEALDAIAAADGFAPFLLHGVTGSGKTEVYLRALAALLERRPEAQALVLVPEINLTPQFEAAFRARFAATLPADAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPALAMIVVDEEHEPAYKQQEGLRYSARDLAVWRAKQLAIPVVLGSATPSLETWWQAEQGRYRRLTLTKRAVADAALPTVRLVDLEEERRRGRGSMGGLSGPLVAALKARLERGEQSLVFLNRRGYAPALACDACGWVAGCPRCSAYVVMHKPEHAVRCHHCGWEARIPRACPECGNVDIAPLGRGTQRVEETLALAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQRVSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLIQTRYPRHALYHALARQDYVGFAGATLGERRDAHLPPFVYQALLRAEGRTLDAALAFLQQAADAFSGLPGAERVTVYDAVPMTIVKVANVHRAQLLIESASRAALQHTLRAWQPLLRELKGVLRWSVEVDPLDI
>NZ_CP009298.1|WP_004524500.1|3496923_3497100_-|hypothetical-protein
MPARCRPRTLKDRKIVRQAIKRCNQISHPVAPHISPLLSIIYQKRQPARTTLNDRYFP
>NZ_CP009298.1|WP_004524499.1|3497112_3501042_+|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGVADLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASLASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEDALKVVPLGAPHAKIALPRELYGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAAPRDVRNPADLRDVVGTVSEATPDEVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRAVMFTGSTEVARLINKTLSSRLDPDGRPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDTHIAAMKDKGHAVTQLEMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLDKLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPRSLEAALVADAPQEGETRDNPSAALTALRDWLIEQREPALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAALATGNRALFAGAAGEALAAALPAQLKAHAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPGPIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	73538-73563	4	0.846
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	306425-306450	4	0.846
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP009298_2	2.1\|3488161\|26\|NZ_CP009298\|CRT	3488161-3488186	26	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	1003771-1003796	5	0.808
NZ_CP009298_2	2.2\|3488207\|27\|NZ_CP009298\|CRT	3488207-3488233	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	119428-119454	5	0.815
NZ_CP009298_2	2.3\|3488254\|26\|NZ_CP009298\|CRT	3488254-3488279	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP009298_2	2.3\|3488254\|26\|NZ_CP009298\|CRT	3488254-3488279	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP009298_2	2.3\|3488254\|26\|NZ_CP009298\|CRT	3488254-3488279	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP009298_2	2.3\|3488254\|26\|NZ_CP009298\|CRT	3488254-3488279	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP009298_2	2.4\|3488300\|27\|NZ_CP009298\|CRT	3488300-3488326	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	119428-119454	5	0.815
NZ_CP009298_2	2.5\|3488347\|26\|NZ_CP009298\|CRT	3488347-3488372	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP009298_2	2.5\|3488347\|26\|NZ_CP009298\|CRT	3488347-3488372	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP009298_2	2.5\|3488347\|26\|NZ_CP009298\|CRT	3488347-3488372	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP009298_2	2.5\|3488347\|26\|NZ_CP009298\|CRT	3488347-3488372	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279887	Mycobacterium phage Timmi, complete genome	40471-40497	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH651175	Mycobacterium phage Gophee, complete genome	40756-40782	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	GQ303264	Mycobacterium phage Puhltonio, complete genome	40765-40791	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	GU247134	Mycobacterium phage Scoot17C, complete genome	40898-40924	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX683293	Mycobacterium phage Daffy, complete genome	40480-40506	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279888	Mycobacterium phage TomBombadil, complete genome	40756-40782	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF957056	Mycobacterium phage Thora, complete genome	40771-40797	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT316463	Mycobacterium phage Slatt, complete genome	40775-40801	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX576645	Mycobacterium phage Derpp, complete genome	40325-40351	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH651184	Mycobacterium phage Phareon, complete genome	40464-40490	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN006063	Mycobacterium phage Serendipity, complete genome	40779-40805	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH779500	Mycobacterium phage Crownjwl, complete genome	40543-40569	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH230875	Mycobacterium phage CheetO, complete genome	40766-40792	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG962365	Mycobacterium phage DoesntMatter, complete genome	40752-40778	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279882	Mycobacterium phage Sophia, complete genome	40470-40496	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX670813	Mycobacterium phage MitKao, complete genome	40468-40494	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH576970	Mycobacterium phage DonSanchon, complete genome	40462-40488	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279866	Mycobacterium phage MRabcd, complete genome	40461-40487	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH513973	Mycobacterium phage Kwksand96, complete genome	40330-40356	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN945899	Mycobacterium phage Skippy, complete genome	40749-40775	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279908	Mycobacterium phage Roliet, complete genome	40764-40790	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_023727	Mycobacterium phage Vista, complete genome	40769-40795	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT897909	Mycobacterium phage Maru, complete genome	40413-40439	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH727555	Mycobacterium phage Mulan, complete genome	40624-40650	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_027985	Mycobacterium phage UncleHowie, complete genome	40468-40494	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN698990	Mycobacterium phage IsaacEli, complete genome	40907-40933	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KY965066	Mycobacterium phage BlackStallion, complete genome	40902-40928	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN703415	Mycobacterium phage Mcshane, complete genome	40462-40488	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX592589	Mycobacterium phage Iridoclysis, complete genome	40748-40774	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH051251	Mycobacterium phage DuchessDung, complete genome	39751-39777	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX576646	Mycobacterium phage TyrionL, complete genome	40325-40351	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279871	Mycobacterium phage Plmatters, complete genome	40764-40790	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279883	Mycobacterium phage Struggle, complete genome	40317-40343	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	40771-40797	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH371107	Mycobacterium phage Doddsville, complete genome	40479-40505	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_028942	Mycobacterium phage Phipps, complete sequence	40744-40770	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KJ567044	Mycobacterium phage EmpTee, complete genome	40765-40791	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279881	Mycobacterium phage Solosis, complete genome	40476-40502	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG944223	Mycobacterium phage Trypo, complete genome	40900-40926	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT897902	Mycobacterium phage Boehler, complete genome	40772-40798	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279855	Mycobacterium phage Haleema, complete genome	40476-40502	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JX649096	Mycobacterium phage Serpentine, complete genome	40766-40792	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK494104	Mycobacterium phage HenryJackson, complete genome	40476-40502	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG944225	Mycobacterium phage Xavier, complete genome	40473-40499	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JX649099	Mycobacterium phage Gyarad, complete genome	40764-40790	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH450116	Mycobacterium phage Buckeye, complete genome	40786-40812	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN638753	Mycobacterium phage Morgushi, complete genome	40469-40495	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG757158	Mycobacterium phage HighStump, complete genome	40603-40629	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112539	Mycobacterium phage Dione, complete genome	40459-40485	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279873	Mycobacterium phage QueenBeane, complete genome	40755-40781	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF668276	Mycobacterium phage Lulumae, complete genome	40455-40481	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT897903	Mycobacterium phage DirtJuice, complete genome	40749-40775	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH513980	Mycobacterium phage Roy17, complete genome	40455-40481	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT316460	Mycobacterium phage Kimbrough, complete genome	40480-40506	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF937097	Mycobacterium phage Hertubise, complete genome	40776-40802	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH230874	Mycobacterium phage Banjo, complete genome	40448-40474	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH651186	Mycobacterium phage Podrick, complete genome	40755-40781	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG962362	Mycobacterium phage AltPhacts, complete genome	40744-40770	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF704103	Mycobacterium phage Vortex, complete sequence	40466-40492	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	FJ174694	Mycobacterium phage Chah, complete genome	40916-40942	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH051264	Mycobacterium phage Cobra, complete genome	40767-40793	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112536	Mycobacterium phage Cannibal, complete genome	40738-40764	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX578071	Mycobacterium phage Mana, complete genome	40470-40496	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919539	Mycobacterium phage Virapocalypse, complete genome	40759-40785	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KC661274	Mycobacterium phage SDcharge11, complete genome	40742-40768	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KJ194579	Mycobacterium phage Swish, complete genome	40890-40916	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH371114	Mycobacterium phage Childish, complete genome	40486-40512	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279852	Mycobacterium phage Fringe, complete genome	40886-40912	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KY385382	Mycobacterium phage ImtiyazSitla, complete genome	40451-40477	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN699010	Mycobacterium phage TallGrassMM, complete genome	40385-40411	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG757159	Mycobacterium phage JangoPhett, complete genome	40759-40785	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279891	Mycobacterium phage Wallhey, complete genome	40329-40355	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919503	Mycobacterium phage Dingo, complete genome	40750-40776	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KY676783	Mycobacterium phage Chorkpop, complete genome	40482-40508	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112527	Mycobacterium phage Altwerkus, complete genome	40450-40476	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JX649100	Mycobacterium phage Alex, complete genome	40792-40818	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_028691	Mycobacterium phage Apizium, complete genome	40650-40676	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH371125	Mycobacterium phage Morty, complete genome	40907-40933	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF937109	Mycobacterium phage Yoshand, complete genome	40903-40929	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279878	Mycobacterium phage Samaymay, complete genome	40755-40781	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	40892-40918	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112551	Mycobacterium phage Riggan, complete genome	40751-40777	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN945903	Mycobacterium phage Jiminy, complete genome	40319-40345	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KM363597	Mycobacteriophage Zonia, complete genome	40780-40806	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KF713485	Mycobacterium phage Suffolk, complete genome	40766-40792	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG770212	Mycobacterium phage Haimas, complete genome	40762-40788	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279861	Mycobacterium phage Legolas, complete genome	40500-40526	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279843	Mycobacterium phage CamL, complete genome	40755-40781	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279846	Mycobacterium phage Cosmolli16, complete genome	40474-40500	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KM408320	Mycobacterium phage Lasso, complete genome	40730-40756	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KR029086	Mycobacterium phage PDRPv, complete genome	40479-40505	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KY385380	Mycobacterium phage Ashraf, complete genome	40451-40477	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH825705	Mycobacterium phage Mesh1, complete genome	40777-40803	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT952849	Mycobacterium phage Windsor, complete genome	40465-40491	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH576954	Mycobacterium phage HSavage, complete genome	40768-40794	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112555	Mycobacterium phage Zelda, complete genome	40810-40836	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_028803	Mycobacterium phage OSmaximus, complete genome	40940-40966	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279904	Mycobacterium phage RedMaple, complete genome	40906-40932	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KR029087	Mycobacterium phage PDRPxv, complete genome	40540-40566	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	40904-40930	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_005259	Mycobacterium phage PG1, complete genome	40909-40935	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112552	Mycobacterium phage Spartan300, complete genome	40761-40787	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX702319	Mycobacterium phage Pinkman, complete genome	40323-40349	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919523	Mycobacterium phage Mikota, complete genome	40748-40774	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KU867907	Mycobacterium phage Potter, complete genome	40479-40505	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH590588	Mycobacterium phage Vaticameos, complete genome	38450-38476	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279885	Mycobacterium phage Surely, complete genome	40772-40798	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279870	Mycobacterium phage Omniscient, complete genome	40775-40801	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN638752	Mycobacterium phage Murdoc, complete genome	40755-40781	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG962375	Mycobacterium phage ProfessorX, complete genome	40756-40782	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG925348	Mycobacterium phage Megatron, complete genome	40898-40924	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH077582	Mycobacterium phage Olive, complete genome	40756-40782	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF155947	Mycobacterium phage LemonSlice, complete genome	40467-40493	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KP027209	Mycobacterium phage Sigman, complete genome	40889-40915	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH450122	Mycobacterium phage KingTut, complete genome	36143-36169	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279859	Mycobacterium phage Kwadwo, complete genome	40455-40481	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112546	Mycobacterium phage LuckyMarjie, complete genome	40470-40496	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX620786	Mycobacterium phage Lego3393, complete genome	40910-40936	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112544	Mycobacterium phage Keitherie, complete genome	40819-40845	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KP027197	Mycobacterium phage FluffyNinja, complete genome	40903-40929	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH651177	Mycobacterium phage KlimbOn, complete genome	40757-40783	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279877	Mycobacterium phage Roscoe, complete genome	41001-41027	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN698989	Mycobacterium phage JacAttac, complete genome	40889-40915	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH479918	Mycobacterium phage Labeouficaum, complete genome	40325-40351	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112553	Mycobacterium Phage Squiggle, complete genome	40485-40511	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_028907	Mycobacterium phage Kikipoo, complete genome	40907-40933	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279850	Mycobacterium phage Durga, complete genome	40917-40943	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279897	Mycobacterium phage Bishoperium, complete genome	40463-40489	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN585965	Mycobacterium phage Duggie, complete genome	40481-40507	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT310868	Mycobacterium phage Telesworld, complete genome	40464-40490	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279865	Mycobacterium phage Mecca, complete genome	40468-40494	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KC576784	Mycobacterium phage ShiVal, complete genome	40765-40791	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH479916	Mycobacterium phage GeneCoco, complete genome	40773-40799	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN444868	Mycobacterium phage Prickles, complete genome	40755-40781	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KY385383	Mycobacterium phage Maskar, complete genome	40451-40477	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH371117	Mycobacterium phage Kahve, complete genome	40473-40499	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH399773	Mycobacterium phage Craff, complete genome	40902-40928	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	GU247133	Mycobacterium phage Fang, complete genome	40910-40936	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_008197	Mycobacterium phage Orion, complete genome	40896-40922	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH479921	Mycobacterium phage Placalicious, complete genome	40461-40487	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT897901	Mycobacterium phage Adriana, complete genome	40892-40918	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN369744	Mycobacterium phage Beaglebox, complete genome	40469-40495	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919530	Mycobacterium phage Sheila, complete genome	40804-40830	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG925356	Mycobacterium phage OliverWalter, complete genome	40778-40804	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JX649098	Mycobacterium phage Nacho, complete genome	40901-40927	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT889369	Mycobacterium phage Inchworm, complete genome	40889-40915	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KP027208	Mycobacterium phage Pipsqueak, complete genome	40768-40794	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919519	Mycobacterium phage Longacauda, complete genome	40463-40489	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF704109	Mycobacterium phage Oosterbaan, complete sequence	40763-40789	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX369585	Mycobacterium phage PhatCats2014, complete genome	40913-40939	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK310139	Mycobacterium phage Emiris, complete genome	40885-40911	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KJ194580	Mycobacterium phage Badfish, complete genome	40917-40943	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KX576647	Mycobacterium phage CharlieGBrown, complete genome	40336-40362	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN369738	Mycobacterium phage Hocus, complete genome	40465-40491	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279889	Mycobacterium phage Valjean, complete genome	40764-40790	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH399775	Mycobacterium phage Gareth, complete genome	40458-40484	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	40763-40789	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279895	Mycobacterium phage Zaider, complete genome	40993-41019	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MN585967	Mycobacterium phage Kloppinator, complete genome	41182-41208	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK279858	Mycobacterium phage JakeO, complete genome	40484-40510	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_028681	Mycobacterium phage Pops, complete genome	40779-40805	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH744417	Mycobacterium phage Grand2040, complete genome	40476-40502	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JX649097	Mycobacterium phage Piglet, complete genome	40874-40900	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MG925350	Mycobacterium phage Mosaic, complete genome	40462-40488	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH479914	Mycobacterium phage FugateOSU, complete genome	40464-40490	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH825702	Mycobacterium phage Hamish, complete genome	40754-40780	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF704091	Mycobacterium phage ABU, complete sequence	40894-40920	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919528	Mycobacterium phage Phunky, complete genome	40761-40787	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_028690	Mycobacterium phage Eremos, complete genome	40758-40784	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	40751-40777	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JN192463	Mycobacterium phage Oline, complete genome	40329-40355	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NC_021310	Mycobacterium phage Newman, complete genome	40760-40786	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MK112542	Mycobacterium phage Jillium, complete genome	40478-40504	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MT310867	Mycobacterium phage Chaelin, complete genome	40461-40487	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KJ194583	Mycobacterium phage Numberten, complete genome	40767-40793	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH590594	Mycobacterium phage PinheadLarry, complete genome	40474-40500	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	KJ174157	Mycobacterium phage Soto, complete genome	40776-40802	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH399780	Mycobacterium phage Mutante, complete genome	40474-40500	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	JF704099	Mycobacterium phage KLucky39, complete sequence	40763-40789	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MH779516	Mycobacterium phage Waterdiva, complete genome	40761-40787	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	MF919507	Mycobacterium phage Horchata, complete genome	40756-40782	5	0.815
NZ_CP009298_2	2.6\|3488393\|27\|NZ_CP009298\|CRT	3488393-3488419	27	NZ_CP045374	Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence	161364-161390	5	0.815
NZ_CP009298_2	2.3\|3488254\|26\|NZ_CP009298\|CRT	3488254-3488279	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977344	6	0.769
NZ_CP009298_2	2.5\|3488347\|26\|NZ_CP009298\|CRT	3488347-3488372	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977344	6	0.769

1. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.846

cggtcgaccgccgcggggccagagta	CRISPR spacer
cggtcgaccgcatcggggccagaaca	Protospacer
***********  **********..*

2. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.846

cggtcgaccgccgcggggccagagta	CRISPR spacer
cggtcgaccgcatcggggccagaaca	Protospacer
***********  **********..*

3. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

4. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

5. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

6. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

7. spacer 2.1|3488161|26|NZ_CP009298|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ttgtcgaccgtcgcggtgccagagtt	Protospacer
. ********.***** ********

8. spacer 2.2|3488207|27|NZ_CP009298|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggccgaccacggcatgggatcggagt	CRISPR spacer
cggccgaccgcggcctgggatcgggtt	Protospacer
.********.**** *********. *

9. spacer 2.3|3488254|26|NZ_CP009298|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

10. spacer 2.3|3488254|26|NZ_CP009298|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

11. spacer 2.3|3488254|26|NZ_CP009298|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

12. spacer 2.3|3488254|26|NZ_CP009298|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

13. spacer 2.4|3488300|27|NZ_CP009298|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggccgaccacggcatgggatcggagt	CRISPR spacer
cggccgaccgcggcctgggatcgggtt	Protospacer
.********.**** *********. *

14. spacer 2.5|3488347|26|NZ_CP009298|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

15. spacer 2.5|3488347|26|NZ_CP009298|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

16. spacer 2.5|3488347|26|NZ_CP009298|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

17. spacer 2.5|3488347|26|NZ_CP009298|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

18. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

19. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

20. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

21. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

22. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

23. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

24. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

25. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

26. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

27. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

28. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

29. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

30. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

31. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

32. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

33. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

34. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

35. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

36. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH513973 (Mycobacterium phage Kwksand96, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

37. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

38. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

39. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

40. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

41. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

42. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

43. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

44. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

45. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

46. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

47. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

48. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

49. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

50. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

51. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

52. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH371107 (Mycobacterium phage Doddsville, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

53. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

54. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

55. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

56. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

57. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

58. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

59. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

60. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

61. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

62. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

63. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

64. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

65. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

66. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

67. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

68. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

69. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

70. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

71. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

72. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

73. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

74. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

75. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

76. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

77. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

78. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH051264 (Mycobacterium phage Cobra, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

79. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

80. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

81. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

82. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

83. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

84. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

85. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

86. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KY385382 (Mycobacterium phage ImtiyazSitla, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

87. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

88. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

89. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279891 (Mycobacterium phage Wallhey, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

90. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

91. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

92. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

93. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

94. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgattt	Protospacer
******.******* ********.  *

95. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

96. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

97. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

98. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

99. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

100. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN945903 (Mycobacterium phage Jiminy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

101. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KM363597 (Mycobacteriophage Zonia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

102. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

103. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

104. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

105. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

106. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

107. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

108. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KR029086 (Mycobacterium phage PDRPv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

109. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KY385380 (Mycobacterium phage Ashraf, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

110. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

111. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

112. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

113. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

114. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

115. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

116. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KR029087 (Mycobacterium phage PDRPxv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

117. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

118. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

119. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

120. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX702319 (Mycobacterium phage Pinkman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

121. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

122. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

123. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

124. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

125. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

126. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

127. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

128. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

129. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

130. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

131. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

132. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

133. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

134. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

135. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

136. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

137. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

138. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

139. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

140. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

141. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH479918 (Mycobacterium phage Labeouficaum, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

142. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

143. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

144. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279850 (Mycobacterium phage Durga, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

145. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

146. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN585965 (Mycobacterium phage Duggie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

147. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

148. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

149. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

150. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH479916 (Mycobacterium phage GeneCoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

151. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

152. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KY385383 (Mycobacterium phage Maskar, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

153. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

154. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

155. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

156. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

157. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

158. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

159. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN369744 (Mycobacterium phage Beaglebox, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

160. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

161. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

162. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

163. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT889369 (Mycobacterium phage Inchworm, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

164. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

165. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919519 (Mycobacterium phage Longacauda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

166. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

167. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

168. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

169. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

170. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KX576647 (Mycobacterium phage CharlieGBrown, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

171. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN369738 (Mycobacterium phage Hocus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

172. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

173. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

174. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

175. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

176. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

177. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK279858 (Mycobacterium phage JakeO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

178. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

179. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

180. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

181. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

182. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

183. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

184. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

185. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

186. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

187. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

188. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JN192463 (Mycobacterium phage Oline, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

189. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

190. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

191. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

192. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

193. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

194. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

195. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

196. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

197. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

198. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

199. spacer 2.6|3488393|27|NZ_CP009298|CRT matches to NZ_CP045374 (Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
cggccatccacggcatgggagcggcgc	Protospacer
.***** ************* *** *.

200. spacer 2.3|3488254|26|NZ_CP009298|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.769

cgatcgaccgccgcggggccagagta	CRISPR spacer
tgatcgaccgcagcggggccagtccg	Protospacer
.********** **********  ..

201. spacer 2.5|3488347|26|NZ_CP009298|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.769

cgatcgaccgccgcggggccagagta	CRISPR spacer
tgatcgaccgcagcggggccagtccg	Protospacer
.********** **********  ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

69585 : 78830

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194034.1\|69585_71538_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004522147.1\|71804_72935_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.6
WP_004538732.1\|72968_74975_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	8.2e-52	34.5
WP_004194137.1\|75158_75974_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004532195.1\|76038_76722_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_004194373.1\|76718_77246_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004522151.1\|77282_78830_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2

DBSCAN-SWA_2

441670 : 450524

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537711.1\|441670_443071_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	4.2e-79	38.5
WP_009921652.1\|443102_444026_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.1
WP_004537712.1\|444084_445077_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004189725.1\|445148_445466_+	competence protein ComE	NA	NA	NA	NA
WP_004550116.1\|445818_446721_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.3e-53	39.9
WP_004537714.1\|446947_448237_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004533906.1\|448415_449339_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_004533881.1\|449681_450524_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	2.1e-17	26.6

DBSCAN-SWA_3

1015532 : 1023726

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196630.1\|1015532_1015796_+	hypothetical protein	Q8W6S4	Burkholderia_virus	2.2e-26	85.5
WP_076833215.1\|1015779_1015965_+	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2
WP_038728419.1\|1015985_1016708_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	1.9e-30	39.9
WP_053293552.1\|1016714_1017317_-	hypothetical protein	NA	NA	NA	NA
WP_004538208.1\|1017658_1018165_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.0e-19	40.1
WP_004538209.1\|1018161_1018587_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.8e-15	49.4
WP_038717461.1\|1018867_1019263_-	hypothetical protein	NA	NA	NA	NA
WP_004531416.1\|1019516_1019744_+	hypothetical protein	Q8W6S4	Burkholderia_virus	3.8e-22	75.8
WP_004527234.1\|1019779_1020013_-	hypothetical protein	A4PE26	Ralstonia_virus	4.3e-13	60.6
WP_004550288.1\|1020088_1020550_-	avidin	NA	NA	NA	NA
WP_045586613.1\|1021103_1021493_+	hypothetical protein	NA	NA	NA	NA
WP_004527233.1\|1021489_1021672_+	hypothetical protein	NA	NA	NA	NA
WP_004193371.1\|1021798_1022422_-	phospholipase D family protein	NA	NA	NA	NA
WP_004527232.1\|1022616_1023726_-	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	3.1e-37	31.6

DBSCAN-SWA_4

1781831 : 1824289

Klosneuvirus(16.67%)

coat,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004204967.1\|1781831_1784456_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.5e-80	39.2
WP_004531186.1\|1785150_1786371_+	CoA transferase	NA	NA	NA	NA
WP_004534928.1\|1786710_1786920_-	hypothetical protein	NA	NA	NA	NA
WP_004193654.1\|1787199_1788909_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	8.8e-188	57.5
WP_004538368.1\|1789266_1789749_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	7.5e-20	41.3
WP_004193860.1\|1789767_1790154_-	hypothetical protein	NA	NA	NA	NA
WP_004531183.1\|1790441_1792541_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_004521727.1\|1792466_1792646_+	hypothetical protein	NA	NA	NA	NA
WP_004521728.1\|1792642_1793503_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_004538370.1\|1793546_1794953_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_038716931.1\|1795186_1796770_+	acid phosphatase	NA	NA	NA	NA
WP_004538372.1\|1796881_1798345_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	6.8e-80	38.6
WP_004538373.1\|1798559_1799753_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_004531180.1\|1800376_1801564_+	HlyD family secretion protein	NA	NA	NA	NA
WP_004538374.1\|1801736_1803356_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004538375.1\|1803357_1805067_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004192810.1\|1805370_1806003_-	response regulator transcription factor	NA	NA	NA	NA
WP_004526787.1\|1806003_1808085_-	response regulator	A0A1V0SGR3	Hokovirus	3.9e-12	26.3
WP_004521738.1\|1808495_1809461_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004538377.1\|1809476_1811888_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_004526784.1\|1811932_1812772_-	molecular chaperone	NA	NA	NA	NA
WP_004526783.1\|1812789_1813314_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|1813390_1813951_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004538378.1\|1814003_1814549_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004534686.1\|1814535_1814724_-	hypothetical protein	NA	NA	NA	NA
WP_076812081.1\|1814809_1814989_-	hypothetical protein	NA	NA	NA	NA
WP_162474212.1\|1815007_1815184_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|1815368_1816262_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004538381.1\|1816678_1817965_+	MFS transporter	NA	NA	NA	NA
WP_004531169.1\|1818009_1818993_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004193855.1\|1819460_1819742_+	H-NS histone family protein	NA	NA	NA	NA
WP_004191144.1\|1819994_1820264_-	hypothetical protein	NA	NA	NA	NA
WP_038716951.1\|1822731_1823652_-	hypothetical protein	NA	NA	NA	NA
WP_154316409.1\|1823769_1823934_-	hypothetical protein	NA	NA	NA	NA
WP_009980631.1\|1823962_1824289_-\|transposase	transposase	S5WIU1	Leptospira_phage	4.4e-24	57.5

DBSCAN-SWA_5

2283219 : 2346015

uncultured_Caudovirales_phage(31.43%)

capsid,plate,terminase,head,tail,protease,integrase,portal

attL 2318075:2318091|attR 2343743:2343759

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538544.1\|2283219_2283891_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	2.9e-110	81.4
WP_038716627.1\|2283970_2284438_+	hypothetical protein	C7BGE3	Burkholderia_phage	2.1e-51	63.0
WP_080292633.1\|2284434_2284716_+	hypothetical protein	NA	NA	NA	NA
WP_004538541.1\|2284775_2285201_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.6e-13	46.0
WP_080292632.1\|2285197_2285707_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	9.4e-21	41.3
WP_004538539.1\|2285699_2286173_+	hypothetical protein	NA	NA	NA	NA
WP_004547844.1\|2286129_2286648_+	hypothetical protein	NA	NA	NA	NA
WP_038741524.1\|2286644_2287388_+	hypothetical protein	A4PE26	Ralstonia_virus	8.0e-37	43.3
WP_038741522.1\|2287423_2287840_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.3e-55	50.4
WP_080292630.1\|2288107_2288563_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_144411680.1\|2288580_2289234_+	hypothetical protein	NA	NA	NA	NA
WP_004538533.1\|2289563_2290352_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	3.0e-151	96.9
WP_004538532.1\|2290494_2291040_-	lysozyme	Q8W6S5	Burkholderia_virus	5.4e-75	87.8
WP_038741520.1\|2291039_2291537_-	lysozyme	A4JX20	Burkholderia_virus	4.5e-68	80.6
WP_004533694.1\|2291529_2291724_-	hypothetical protein	NA	NA	NA	NA
WP_004538530.1\|2291799_2292852_-	phage late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	8.6e-77	43.6
WP_004538529.1\|2292861_2293068_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	5.3e-15	59.7
WP_004538528.1\|2293042_2293924_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.4e-32	37.2
WP_038716612.1\|2293932_2296341_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.4e-61	32.7
WP_004538526.1\|2296428_2296731_-\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	4.3e-05	35.9
WP_143293909.1\|2296977_2298237_-	hypothetical protein	NA	NA	NA	NA
WP_004538524.1\|2298586_2299090_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	3.3e-42	51.9
WP_004538523.1\|2299100_2300270_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	6.9e-160	72.2
WP_004538522.1\|2300333_2301020_-\|tail	tail assembly chaperone	E5E3Q6	Burkholderia_phage	2.0e-58	58.6
WP_004538521.1\|2301032_2302838_-\|tail	tail fiber protein	A4JWS9	Burkholderia_virus	1.5e-150	66.3
WP_004538520.1\|2302825_2303401_-\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	2.1e-32	49.0
WP_004538519.1\|2303393_2304287_-\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	1.7e-49	41.4
WP_004538518.1\|2304283_2304628_-	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.3e-23	50.0
WP_004538517.1\|2304624_2304822_-	hypothetical protein	NA	NA	NA	NA
WP_004538516.1\|2304884_2305565_-\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	1.5e-18	34.4
WP_004538515.1\|2305567_2306101_-	hypothetical protein	Q9JML9	Wolbachia_phage	5.2e-22	40.3
WP_004538514.1\|2306090_2306621_-	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.8e-11	29.9
WP_004538513.1\|2306622_2306913_-	hypothetical protein	NA	NA	NA	NA
WP_004538512.1\|2306916_2307912_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.3e-108	58.5
WP_004538511.1\|2307977_2308322_-\|head	head decoration protein	NA	NA	NA	NA
WP_004538510.1\|2308348_2309449_-	peptidase S14	A0A2H4JDI2	uncultured_Caudovirales_phage	2.8e-46	35.8
WP_004538509.1\|2309445_2310939_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	3.2e-133	51.5
WP_004538508.1\|2310935_2311142_-	hypothetical protein	NA	NA	NA	NA
WP_080231288.1\|2311152_2313141_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	1.1e-178	52.9
WP_080231287.1\|2313103_2313673_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_144241902.1\|2313825_2314257_-	hypothetical protein	NA	NA	NA	NA
WP_004538506.1\|2314425_2315274_-	DUF4747 family protein	NA	NA	NA	NA
WP_004538505.1\|2315654_2316242_-	hypothetical protein	NA	NA	NA	NA
WP_004538504.1\|2316467_2318960_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	1.6e-97	41.3
2318075:2318091	attL	NA	NA	NA	NA
WP_004538503.1\|2319079_2319550_-	hypothetical protein	NA	NA	NA	NA
WP_038716608.1\|2319923_2320385_-	hypothetical protein	NA	NA	NA	NA
WP_004538501.1\|2320383_2320839_+	hypothetical protein	NA	NA	NA	NA
WP_080231289.1\|2320846_2321179_-	hypothetical protein	NA	NA	NA	NA
WP_038716606.1\|2321192_2321720_-	hypothetical protein	C7BGG0	Burkholderia_phage	3.3e-29	47.1
WP_004538499.1\|2321795_2321981_-	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	1.7e-09	59.3
WP_144411681.1\|2322045_2322600_+	hypothetical protein	NA	NA	NA	NA
WP_038741518.1\|2322916_2323135_+	hypothetical protein	NA	NA	NA	NA
WP_004538497.1\|2323189_2323525_+	hypothetical protein	NA	NA	NA	NA
WP_038716605.1\|2323521_2324127_+	hypothetical protein	NA	NA	NA	NA
WP_004538495.1\|2324123_2324573_+	hypothetical protein	NA	NA	NA	NA
WP_038716603.1\|2324572_2325892_+	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_004538494.1\|2326005_2326335_+	hypothetical protein	NA	NA	NA	NA
WP_004538493.1\|2326343_2327120_+	hypothetical protein	Q6J1P0	Burkholderia_virus	3.2e-20	56.2
WP_009964477.1\|2327116_2327347_+	hypothetical protein	NA	NA	NA	NA
WP_038741516.1\|2327379_2328480_-\|integrase	site-specific integrase	A0A2D1GMX8	Marinobacter_phage	1.5e-44	31.0
WP_009970293.1\|2328934_2329339_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	4.5e-10	48.2
WP_051177548.1\|2329272_2331030_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_020850843.1\|2331054_2331279_-	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_004543927.1\|2331297_2331477_-	hypothetical protein	NA	NA	NA	NA
WP_143285126.1\|2331578_2331869_-	hypothetical protein	NA	NA	NA	NA
WP_045596639.1\|2331865_2341189_-	contact-dependent inhibition toxin BcpA	A0A0R6PJK4	Moraxella_phage	2.9e-35	34.4
WP_038717116.1\|2342859_2343336_-	hypothetical protein	NA	NA	NA	NA
WP_004200110.1\|2343792_2344017_+	hypothetical protein	NA	NA	NA	NA
2343743:2343759	attR	NA	NA	NA	NA
WP_038717114.1\|2344241_2345378_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_004522511.1\|2345475_2346015_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA

DBSCAN-SWA_6

2509683 : 2520647

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196461.1\|2509683_2511984_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1
WP_004194131.1\|2511980_2512295_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|2512827_2513031_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_004536101.1\|2513160_2514771_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_004189626.1\|2514783_2514966_+	hypothetical protein	NA	NA	NA	NA
WP_004189552.1\|2514938_2516198_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189780.1\|2516465_2517044_+	pseudouridine synthase	NA	NA	NA	NA
WP_071810810.1\|2517306_2517525_+	hypothetical protein	NA	NA	NA	NA
WP_004526282.1\|2517716_2518226_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	4.2e-13	42.2
WP_004197486.1\|2518532_2520647_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7

DBSCAN-SWA_7

3544514 : 3555743

Shigella_phage(20.0%)

integrase

attL 3541919:3541936|attR 3558528:3558545

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3541919:3541936	attL	NA	NA	NA	NA
WP_004524472.1\|3544514_3546602_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	1.9e-99	35.8
WP_004202928.1\|3546924_3547824_-	cytochrome c	NA	NA	NA	NA
WP_076804979.1\|3548655_3548835_-	hypothetical protein	NA	NA	NA	NA
WP_004538613.1\|3549006_3549594_+\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	1.4e-44	50.6
WP_009932253.1\|3549645_3549966_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	1.0e-12	58.6
WP_009922658.1\|3549973_3550291_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.2e-15	57.0
WP_004530410.1\|3550290_3551208_+	DUF4935 domain-containing protein	A4PE40	Ralstonia_virus	4.0e-46	40.6
WP_009922654.1\|3551461_3552004_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.3e-48	56.4
WP_009932249.1\|3552261_3552714_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.3e-31	58.8
WP_004525722.1\|3552713_3553793_+	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	2.2e-160	99.0
WP_004525721.1\|3553949_3554198_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.0e-41	97.6
WP_004195754.1\|3555098_3555743_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	5.7e-07	30.4
3558528:3558545	attR	NA	NA	NA	NA

DBSCAN-SWA_8

3780212 : 3797518

Pseudomonas_phage(25.0%)

plate,protease,integrase,transposase

attL 3772803:3772819|attR 3790945:3790961

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3772803:3772819	attL	NA	NA	NA	NA
WP_004199890.1\|3780212_3780734_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
WP_076802946.1\|3783582_3783843_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	2.1e-16	68.1
WP_122887193.1\|3783975_3785096_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-48	39.1
WP_004535005.1\|3785379_3786450_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_009932052.1\|3786456_3787257_-	hypothetical protein	NA	NA	NA	NA
WP_004539222.1\|3787691_3788030_+	DUF4102 domain-containing protein	Q8W6M6	Sinorhizobium_phage	2.4e-17	49.0
WP_004521948.1\|3788524_3789310_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004521949.1\|3789306_3790653_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004521950.1\|3790761_3791376_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
3790945:3790961	attR	NA	NA	NA	NA
WP_004531875.1\|3791750_3792422_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004521952.1\|3792458_3792977_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004521953.1\|3792993_3794484_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004527837.1\|3794556_3795060_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004204912.1\|3795117_3795600_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004539223.1\|3795679_3797518_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009297

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009298

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection