CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009473	Burkholderia pseudomallei MSHR840 chromosome II, complete sequence	4 crisprs	csa3,PD-DExK,cas3,DinG	1	0	3	0
NZ_CP009474	Burkholderia pseudomallei MSHR840 chromosome I, complete sequence	1 crisprs	WYL,cas3,DEDDh,csa3,DinG	0	4	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009473_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009473_1

634953-635045

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009473_1

>merge|NZ_CP009473|1|634953-635045|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP009473|1|1|634953-635045|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009473.1\|WP_004524990.1\|627166_628732_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP009473.1\|WP_041197559.1\|629839_630355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_004548632.1\|639408_641202_+\|polyhydroxyalkanoic-acid-synthase	unknown	unknown	gnl\|CDD\|213656
NZ_CP009473.1\|WP_004187346.1\|635508_636210_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP009473.1\|WP_004524993.1\|623665_624790_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP009473.1\|WP_045603666.1\|631683_632532_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP009473.1\|WP_004524989.1\|629272_629782_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_004524985.1\|636206_636515_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP009473.1\|WP_038756598.1\|632528_634517_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP009473.1\|WP_162486917.1\|644522_645956_-\|hexose-kinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP009473.1\|WP_004187193.1\|635263_635512_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067
NZ_CP009473.1\|WP_045603660.1\|620396_623663_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009473.1\|WP_004529178.1\|630419_631445_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP009473.1\|WP_004524980.1\|641212_642616_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP009473.1\|WP_004530237.1\|636507_637008_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP009473.1\|WP_045603667.1\|637449_639048_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183615
NZ_CP009473.1\|WP_024429076.1\|624939_626775_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP009473.1\|WP_004524995.1\|619326_620400_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP009473.1\|WP_045603668.1\|642612_643791_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922
NZ_CP009473.1\|WP_004188221.1\|637004_637460_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057

Protein	Function_ID	Function_description	E-value
NZ_CP009473.1\|WP_004524990.1\|627166_628732_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79
NZ_CP009473.1\|WP_004548632.1\|639408_641202_+\|polyhydroxyalkanoic-acid-synthase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	1.95969e-179
NZ_CP009473.1\|WP_004187346.1\|635508_636210_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP009473.1\|WP_004524993.1\|623665_624790_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	3.93708e-26
NZ_CP009473.1\|WP_045603666.1\|631683_632532_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	1.70945e-33
NZ_CP009473.1\|WP_004524985.1\|636206_636515_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	4.12229e-10
NZ_CP009473.1\|WP_038756598.1\|632528_634517_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP009473.1\|WP_162486917.1\|644522_645956_-\|hexose-kinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	2.85658e-108
NZ_CP009473.1\|WP_004187193.1\|635263_635512_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37
NZ_CP009473.1\|WP_045603660.1\|620396_623663_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.69661e-92
NZ_CP009473.1\|WP_004529178.1\|630419_631445_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP009473.1\|WP_004524980.1\|641212_642616_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP009473.1\|WP_004530237.1\|636507_637008_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	4.39073e-17
NZ_CP009473.1\|WP_045603667.1\|637449_639048_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|183615	PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional.	0
NZ_CP009473.1\|WP_024429076.1\|624939_626775_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	3.29077e-132
NZ_CP009473.1\|WP_004524995.1\|619326_620400_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	1.83012e-39
NZ_CP009473.1\|WP_045603668.1\|642612_643791_+\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0
NZ_CP009473.1\|WP_004188221.1\|637004_637460_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63

>NZ_CP009473.1|WP_038756598.1|632528_634517_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSPEASREVSREVSHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPPPDARGDAARTAPSPQGGADANVNADANVDAEAEARHKR
>NZ_CP009473.1|WP_045603666.1|631683_632532_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGETAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAARLEATERRLLPFDYARFDTAPRTQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP009473.1|WP_004529178.1|630419_631445_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP009473.1|WP_041197559.1|629839_630355_-|hypothetical-protein
MRRAMRGAGRASPSRARRYENVSKEPNTHREAGAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDTHLGDVTPVHVSRPVQFAVPAHEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPSPVGDDMQDLIH
>NZ_CP009473.1|WP_004524989.1|629272_629782_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP009473.1|WP_004524990.1|627166_628732_-|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP009473.1|WP_024429076.1|624939_626775_+|response-regulator
MHVEVFAQHPSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLEAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRKKTAAARVQR
>NZ_CP009473.1|WP_004524993.1|623665_624790_+|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFALDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP009473.1|WP_045603660.1|620396_623663_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWHLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADARTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQDAQEAQEAQGGAGERPGAGERAAGESLAGRGAATDGDTDGAHARPAACANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSDVGSDVASEAGPEAGAESGSERGIAHGAERAREPAADITADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPPSHAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLAHIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAACVPVILGATILLLKKQER
>NZ_CP009473.1|WP_004524995.1|619326_620400_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MIQVTRKQIVAAAAVVVVALGAYYGWTLLRHQGPGDGFASGNGRIEATEIDVATKLPGRIDAILVDEGDFVKAGQPLANMQIQVLRAQYDEATAQRQRALNTAAGVQSQVAQRKSDKAAAQAMVVLRESELDAAERRLARSQTLSREGASSLQELDDDRARARSAQAAVSAAAAQVAAAQAAIEATEAQLVAAHSAVTAADATVARVQADIDDSQLASPRDGRVQYRVAQPGEVLPAGGKVLNLVDLSDVYMTFFLPETVVGRVALGADARIILDAAPNYVIPATVSFVSSTAQFTPKTVETANERQKLMFRVKARIDRELLQKHLKLVKTGLPGVAWVRVDPSKPWPAQLMVKVPQ
>NZ_CP009473.1|WP_004187193.1|635263_635512_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP009473.1|WP_004187346.1|635508_636210_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP009473.1|WP_004524985.1|636206_636515_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFVAGACHFVSLGWNSRLFVAGRAGVALALQLARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP009473.1|WP_004530237.1|636507_637008_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREAREARDDAARGDARHAGAGAAPDDPRGAARRDPPPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP009473.1|WP_004188221.1|637004_637460_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP009473.1|WP_045603667.1|637449_639048_-|F0F1-ATP-synthase-subunit-beta
MADPQATNGTGAACAERDASDVGDARDEGAGRVVAVRGAVVDVAFDGGALPALNEALTIPVDGAAPILVEVHAHLSDAAVRALALGPTGGLRRGAAVRATGGPIRVPVGDAVLGRLLSVTGVPGDDGAALAADVERRPIHRGAPPLAEQKSANALFATGIKVIDLLAPLAQGGKAAMFGGAGVGKTVLVMELIHAMVERYRGISVFAGIGERSREGHEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDFTDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRRVIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIADTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAAASVAGPGTTSGTTSDPASGSAEPQGARHGR
>NZ_CP009473.1|WP_004548632.1|639408_641202_+|polyhydroxyalkanoic-acid-synthase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAGAWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASVTLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP009473.1|WP_004524980.1|641212_642616_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGARLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP009473.1|WP_045603668.1|642612_643791_+|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHAVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPLAPLHQPQSVRLIRALRDLRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKIVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA
>NZ_CP009473.1|WP_162486917.1|644522_645956_-|hexose-kinase
MRGACASRAMFDTGGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASSKQQAASSKQQAASSKQQAASSKQQAASSKQQAASSSRPAPVLMVRRRIERKHCGACPPRSTREPRTRASRCVVFPSRIPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYLAGGGTGLALRGLLAGEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGTALGTKEDIARIYRELPGTIDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009473_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009473_2

873770-873924

Orphan

Consensus_repeat	Method
CACGACAGCACGACAGCACGACAGCAC	CRISPRCasFinder

2 spacers

csa3

The CRISPR arrays of NZ_CP009473_2

>merge|NZ_CP009473|2|873770-873924|CRISPRCasFinder
CACGAACACACGAACACGCGACCGCACGCCCACGCGCACACCCGACCACGCAATCGCGCAATCGCGCAATCGAGCAATCGAGCAATCACACGACAGCACGACAGCACGACAGCACGACAGCACGACAGCACGACAGCACGACAGCACGACAGCAC

>NZ_CP009473|2|2|873770-873924|CRISPRCasFinder
CACGAACACACGAACACGCGACCGCAC	GCCCACGCGCACACCCGACCACGCAATCGCGCAATCGCGCAATCGAGCAATCG
AGCAATCACACGACAGCACGACAGCAC	GACAGCACGACAGCACGACAG
CACGACAGCACGACAGCACGACAGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009473.1\|WP_038769730.1\|862462_863377_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP009473.1\|WP_162186992.1\|877535_877700_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_004190526.1\|868425_869667_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP009473.1\|WP_004533359.1\|877906_878731_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP009473.1\|WP_020850092.1\|879030_880434_+\|indoleacetamide-hydrolase	unknown	unknown	gnl\|CDD\|236030
NZ_CP009473.1\|WP_004266659.1\|880619_881171_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_045603752.1\|864996_865938_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP009473.1\|WP_004524799.1\|861577_862282_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP009473.1\|WP_045604440.1\|866933_867608_-\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238089
NZ_CP009473.1\|WP_045603753.1\|867680_868421_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NZ_CP009473.1\|WP_004190530.1\|885630_885921_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP009473.1\|WP_162486907.1\|884630_885524_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_004529345.1\|872176_873511_+\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP009473.1\|WP_038725562.1\|863562_864900_-\|D-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|235096
NZ_CP009473.1\|WP_004190287.1\|876547_877396_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP009473.1\|WP_004533130.1\|875221_876364_+\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|376451
NZ_CP009473.1\|WP_004529341.1\|866168_866474_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_004529343.1\|869713_870835_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029
NZ_CP009473.1\|WP_004190485.1\|874233_875157_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP009473.1\|WP_045604442.1\|881725_884089_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|131764

Protein	Function_ID	Function_description	E-value
NZ_CP009473.1\|WP_038769730.1\|862462_863377_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	3.44505e-89
NZ_CP009473.1\|WP_004190526.1\|868425_869667_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.81048e-43
NZ_CP009473.1\|WP_004533359.1\|877906_878731_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	7.20348e-44
NZ_CP009473.1\|WP_020850092.1\|879030_880434_+\|indoleacetamide-hydrolase	gnl\|CDD\|236030	PRK07488, PRK07488, indoleacetamide hydrolase.	0
NZ_CP009473.1\|WP_045603752.1\|864996_865938_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	2.55747e-74
NZ_CP009473.1\|WP_004524799.1\|861577_862282_-\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	4.21794e-72
NZ_CP009473.1\|WP_045604440.1\|866933_867608_-\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	4.6266e-23
NZ_CP009473.1\|WP_045603753.1\|867680_868421_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	4.02885e-63
NZ_CP009473.1\|WP_004190530.1\|885630_885921_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	5.135e-20
NZ_CP009473.1\|WP_004529345.1\|872176_873511_+\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.04801e-146
NZ_CP009473.1\|WP_038725562.1\|863562_864900_-\|D-serine-ammonia-lyase	gnl\|CDD\|235096	PRK02991, PRK02991, D-serine dehydratase; Provisional.	0
NZ_CP009473.1\|WP_004190287.1\|876547_877396_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	1.00291e-102
NZ_CP009473.1\|WP_004533130.1\|875221_876364_+\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|376451	pfam01070, FMN_dh, FMN-dependent dehydrogenase.	3.69274e-171
NZ_CP009473.1\|WP_004529343.1\|869713_870835_+\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	7.4565e-168
NZ_CP009473.1\|WP_004190485.1\|874233_875157_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	6.62225e-57
NZ_CP009473.1\|WP_045604442.1\|881725_884089_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|131764	TIGR02717, Uncharacterized_protein_MJ0590, acetyl coenzyme A synthetase (ADP forming), alpha domain. Although technically reversible, it is believed that this group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which it has been characterized. In most species this protein exists as a fused alpha-beta domain polypeptide. In Pyrococcus and related species, however the domains exist as separate polypeptides. This model represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. In reference, one of these (along with its beta-domain partner) was characterized as ACS-II showing specificity for phenylacetyl-CoA. This model has been constructed to exclude these non-ACS-I paralogs. This may result in new, authentic ACS-I sequences falling below the trusted cutoff.	2.24184e-92

>NZ_CP009473.1|WP_004529345.1|872176_873511_+|MHS-family-MFS-transporter
MPTPTPGTPRPPRTPQPVRAALAAFIGTTVEFYDYYTYATAAALVLGDVFFPSDNPFVSTMASFATFFVGFVARPLSGAVFGHLGDRIGRKKMLVLTMFLMGAATTGIGLLPGYATIGVWAPVLLVLLRILQGIAVGGEWGGAVLMASEHASAGRRTLFASFPQMGSPAGLILSLLAFRYVTSLDHARFVAWGWRLPFLASFVLLLIGVAVRLGVNESPEFERVRDSHAVARFPVAEVLRTAWYPIVLAAAATTIGSAGFFFTNTFMISYVTTYLGMSKSFILDCLFAVTLIQLLSQPVSALLAQRFGETRFLVCAALLSMLTPYPMFVLVRTHDPVAIVAGIAFAVVALSAVYAVIAGFMSAAFPTRVRYSGISIAYQLCALVAGGTTPLVGTMIAQRYRGEWLPLALFFSLLAFVSLVGIVGLGRYRRNLHAAAPRAWAVNP
>NZ_CP009473.1|WP_004529343.1|869713_870835_+|cysteine-desulfurase
MTHIYLDYNASTPIDPAVADAMRPLLPEAFGNPSSGHWASVPAKVALDRARAQVATLIGAAPDEIVFTSGGSEANNLALKGTVLASSNAGGHVITQSTEHPAILKPLQFLERLGTKVTCVPVDGNGRVDPDAIRRAITPRTTLITVMHANNETGTIQPIEDIGTIAREHGIRFHTDAAQSIGKIPADVDALGVDLLSIAGHKLYAPKGIGALYVRKGVGLEPLIHGAGHENGRRAGTESALLAAGFGEACALARDLAAMDGIRALRDRLWHALQDRFDDRVRLNGHLEYRLPNTVNVSFVGRVGADVLAALDGVAASTGSACHAGRMTLSPVLAAMGIAEQVGMGAIRFSLGRHTTADEIDTVVAKLSAIARG
>NZ_CP009473.1|WP_004190526.1|868425_869667_+|MFS-transporter
MSKSTMPAGGAAIRLGLKENWRQFALLVLINAFVGGMVGIERTVVPLIGSETFHIQSTTLITSFIVSFGLVKAVANLISGQLADTWGRKRVLVAGWLLGLPVPFMIIAAPNWEWVIAANVLLGLSQGFAWSMTVIMKVDLVGPKARGLAVGLNEFAGYFAVGLTAFLTGYLASRHGLRPAPIYLGVAYAIAGLTLSILVVRDTRDHVCLEAGKPKEATSLSFHDVFLLASLKDRNLFAASQAGLINNLNDGMSWGIFPLFFTGLGLGVERIGILKAAYPIVWGVFQVVTGPLSDRWGRKGLIVAGMWVQAAGLVLTASMGEFRWWLVASVLLGLGTAMVYPSLIAAVSDASDPRWRARALSVYRFWRDLGYAIGALSAGLIADRFGFADAILSIAAVTFLSGAVVAIVMHARH
>NZ_CP009473.1|WP_045603753.1|867680_868421_+|MBL-fold-metallo-hydrolase
MILRQFLHCDPVGISYLLGCGGKSTGVVVDAVAEPGTYLQAAADAGMKIDYVIDTHVHADHLSTGPALADAAGAAYVLSAKADVVLPFKGVEDGDEIRVGNVVIKVLETPGHTPEHISLLVTDRTRAEEPWLALTGHTLMIGDLGRTELAESAEAGARNLFRSVRTLKSLPDYLPLLPGAFAGSACGRGLSATPLSTIGFEKRHNAAFGIDDEAAFVRFMLSDMPPAPPEAARLRAANSGHNPDEI
>NZ_CP009473.1|WP_045604440.1|866933_867608_-|metalloregulator-ArsR/SmtB-family-transcription-factor
MSSAGPKQEIYESLAEVAQAVGHPNRLELLEHLAQRERSVEDLTALSGMSFANTSRHLQILRRARLVDTERRGKNVVYRLAGDSEVVGLMKALGRLGERNVAEVNRVLGDYFHARGSMEPVSRNELTARLADGLVTLLDVRPHDEFAQGHLPGALNIPLAALEARLSELPADTEIVAYCRGPYCVLAFEAVAALRARGFKAARLEDGFPEWKAAGFVVETEPAN
>NZ_CP009473.1|WP_004529341.1|866168_866474_-|hypothetical-protein
MITVITSFQLPAPLAREEARSLFLRAAPKHQGVVGLCANTMSCRKAEGRVYLWNARAQAETMYTDAWKASAYETFGAFPSITYFESPAVVDNATNAIFSDE
>NZ_CP009473.1|WP_045603752.1|864996_865938_+|LysR-family-transcriptional-regulator
MDIKLDTPLLGALRCFEAAGRLGSFTKAADALHLTQSAISQQIRQLEARLGYPLFVRHARGLALTPKGGALHEATVAAFASLGRTLRQLSAPDAPLQVSCLPSFALQWLMPRLTEFHRLHPQTPVRLRAEFHAIDRETMSADDIDIAIRWDPFSYGALHVEPLFDESLVAAAASAYLDRHPPRATAKWVSSVVPLHDASAWPEAPRYVEWRTWLDAVVPGYAGAPRGPEFNLASLAIAAAVAGQGVVVCRQALVDDEIARGRLVNVFARRVPAPAQYKAICARPEDARVKAFVGWLRAESDSYAARRQTQARP
>NZ_CP009473.1|WP_038725562.1|863562_864900_-|D-serine-ammonia-lyase
MPVGRSLSLDPNLLAQLQSHSPTLWLNPHQGMPLPDFAPTAADLADADARLRRCAGLLAELFAELRPSGGLIASPLQPAEPLKRAARAGHAQAGAWYVKRDDALPVAGSIKARGGFHEVLALAESIAERHGLAGADADRRALASGAARARFARHTVMVGSTGNLGLSIGMLASALGFRTVVHMSADAKAWKKARLRTRGVEVVEHAGDYAKAVDAGRRQAAGMPCCHFVDDEGSRMLFLGYATAAAELAAQLAQAGRPVDARHPLFVHLPCGVGGAPGGIVYGLKALYGEHVHAFVAEPTASPCVLVQLAGDAAHPRSVYDIGLDNRTEADGLAVAQASPLAAALLRAQAAGAFTVDDRQLFAHLLDARERLGIDLEPSAAAAFGGPAWIAGSDAGRAYLRGRGIDPDAATHVIWATGGSLVPAQEHRRFQAHARAQRQVGGAGA
>NZ_CP009473.1|WP_038769730.1|862462_863377_+|LysR-family-transcriptional-regulator
MPARKPGRLPPLNALRAFEVSARHLNFRAAADEIGVTQGAVAQQVRHLEDVLGVALFERLPRGLALTADGFAYFADVRRALNLIGDATDRLAKRRANVTISTTPSFASRWLIPRLASFGDEHPGVDLRVIADSQFATFQGDGVDLAIRYGKPPFGKGLVTRLLFPVDIYAVCSPALLAPPGALARARDLAGHALLHDAHDLWPEFLAALPERVAIDPAKGPRFNQSSLAIDAAIAGHGVALASDQLVARDIEAGRLRRLFDFALPLSVGYYIVRPSEPRRPGDIAQTEAWLIRQAQLDARRDGA
>NZ_CP009473.1|WP_004524799.1|861577_862282_-|SDR-family-oxidoreductase
MAVEKVALITAAGKGMGAAIARELASAGYRVALMSPSGSAVALAGELDGLGLRGSVTEEADLDRLVRETLARYGRIDAVVNNTGHPPKGELLSIADASWHDALDLILLNVARLMRRVTPVFQAQGGGAAVNISSFAAVAPEQPMPVSSVLRAALGAWTRLYAERYAAENIRMNAVLPGFVDSWPETPGIVARIPAGRFGRTREIAKTVAFLLSDGAGYVTGQSIRVDGGIVRAM
>NZ_CP009473.1|WP_004190485.1|874233_875157_+|LysR-family-transcriptional-regulator
MNPSDLRDLRLPSLDGLLAFVAAARHGTFERAAEELCVTGSAVAKRVAALEQLLGVQLLVRSGKALTLTAAGNEYLHQVHAPLHLLAAVPLHRRNAGKTERLRICAPPTFARQILVARLDAFTLAHPGVELEVMLASPFPDAPPTGADLWIRGGGPIVSGATVLMVDALTPLAAPSLVERFAPLRRPADLAALPLLCTPLEPWTPWFRVAGLDWPEPANGPKLLDLGLLLEAAVSGQGVALGSPALARPWLAAGALVPLFPRIVRPAAPYYLMPYAPRAAAGAFAAWLADVCERAVRDGAEFLSRHG
>NZ_CP009473.1|WP_004533130.1|875221_876364_+|alpha-hydroxy-acid-oxidizing-protein
MSVPITCIEDLRVLAKKRIPRMFYDYVDTGSYTESTYRANEADFRKIRLRQRVGVDISNRNLRTTMAGQDVAMPVALAPTGLVGMMRADGEILAARAARHFGVPFTLSTMSICSIEDIVAHVGGPFWFQLYMMRDRAFIERLIERASAAGCPALVLTMDLQIAGQRHKDVKNGLSAPPRITLPNLLDMMRKPGWCLGMARTRRRHFGNIVGHVKGVTDMWSLDSWTREQFDPTIGWRDAEWVRRRWNGKLIVKGVLDADDALRAADAGADAIVVSNHGGRQLDGAMSSVEALPAIVEAAGKRVEVWLDGGVRTGQDVLKAVALGARGTMIGRAFLYGVAALGEQGARRALELIARELDTTMALCGCTDIRSVNADVLARR
>NZ_CP009473.1|WP_004190287.1|876547_877396_-|fumarylacetoacetate-hydrolase-family-protein
MKLLRYGPVGQEKPGLLDADGRIRDLSSLIDDVAGGALSDASLARLAAADPASLPLVAGEPRIGACVGRIGKFVCIGLNYADHAAEAGLAVPAEPVVFGKWTSAVSGPHDGIEIPRGSVKTDWEVELGVVIGRACKNVDEADALSHVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEIADPQALDLWLDVDGRRYQSGNTRTMVFTVARLIAYLSRCMSLQPGDVISTGTPPGVGMGVKPSPVYLKPGQTVRCGVAGLGEQQQRTRAAA
>NZ_CP009473.1|WP_162186992.1|877535_877700_+|hypothetical-protein
MQQTLAMRGFTGGDRVPPARAAVASGLAGARAPARGHTVPRRLAGFFRPSRRIL
>NZ_CP009473.1|WP_004533359.1|877906_878731_+|IclR-family-transcriptional-regulator
MKPRKDAPAGAAQAPHDCEEIERYRAPALDKGLDILELLAEQKEGLTRTEITKELGRNASEIYRMLERLVARQYVIRSPGGDRYTLSLKLYSLAHRHPPLKRLIAEALPPMQRFADAAEQSCHLCVYDRGNLLVIAQVDGPGTWGISVRLGSRVGLVDTASGPVLLAFQTPEQRARMLVEHTKVEGEIALDMREFDALLHEIRASGRLRQKSRQAFGVTDIAYPVLGPSGHAIAALTCPYVRRIDTHAAPCAEDVDAQLRATARHLSMLKEAAA
>NZ_CP009473.1|WP_020850092.1|879030_880434_+|indoleacetamide-hydrolase
MTSHRDTYVRSASVRAIADAVNGGRVRALEQAEAALERLALVEPLAAMTHVAPEIARRAAANVDAQIASGRRLPLAGVPFVIKDNLFTADMPTRAASPALLGFDATRNATAVQQLLDAGAVPLGKANMHELAFGITSANGYFGAVRNPHDPARIAGGSSGGTACAVAAGIAFGLGTDTGGSVRIPAAFCGVAGLRPTPRRYSTEGVLALSPTRDTVGPIAHGIDDLLLLDAVLTGDAGEPAPVALAGLRVGVPDAPYFDGLDPAVAELTERALAALTDAGARLIPLAAHALHEADEACGFPIAGFEALAYWRRFSAERLDLPFAEFVARLGSDDVRHLFRMLIDAPPSSDAYAAAIDVLQSTVRWYDQAFHRTGVDCIALPTVQCDAPLVTDSGHDLPSDAAYALFTRVIRQTGPATLGGVPSVSIPAGLSKHTGVPVGLMLEGPAGNDRRLLAIAREVERLLARAP
>NZ_CP009473.1|WP_004266659.1|880619_881171_+|hypothetical-protein
MDVMAKLLTDLEFQRFSELQQKQASFTITPEEADELRDIVARAQKKRDDRASAMRAIEAYIAQFDITPDELFSPEQIGEAARTYGLIAAGKKERSLPPSLTFNGKPYQWTKTLPDEVRLPLFDAFKAGESIKRFIAMPKDAARCALTVARLERETGAVYADTLLDELAISRKHVEEAAAKLAA
>NZ_CP009473.1|WP_045604442.1|881725_884089_-|GNAT-family-N-acetyltransferase
MTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKVYPYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEARSGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMSAARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATSGGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGSAAGNPLLLGDDARPEYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAATRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARAALAQGRDGFEGDAALEWLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPPADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMSLVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRAVTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAKDSGFAVSSTEEPGVVAFRLKLQP
>NZ_CP009473.1|WP_162486907.1|884630_885524_+|hypothetical-protein
MLKRPSRNIGPAGSGIENGGPANSMHCPIAGNRRAGQKIAVQSSERRGPSLTRFEFNAQCHCAISVKYENNGDARRECRANLRSRPRTEAPLAIPLPPPLRQASKLREPAWQAVEERLFGENSGISFMPAPVRRDSIAARMRKLSRKCRLHGFAVHVRWLFPPPGWPIRTDKWRYHALSARRRFSGIAVEHALAARIECETARRTRRGDTRHAPPKVSVFGSQGEAIRDWVSSFGEIARLPRQNRKRRSEWMRRRETFGSIRQVRIDGRIARHPPERIGFIAESTHNPLRREIAGPP
>NZ_CP009473.1|WP_004190530.1|885630_885921_-|H-NS-histone-family-protein
MATYRQLTAQLEKLQQKIDKEREKAITDAIADIKAKIEEYDITPEELGFRSVKAAAKPKRALPPKYLNPKTGETWSGRGRAPAWLGKNRNRFLIKD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009473_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009473_3

1055020-1055105

Orphan

Consensus_repeat	Method
CGGAATGCCCGATCATCGGGATGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009473_3

>merge|NZ_CP009473|3|1055020-1055105|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGCCTGCTCGCCGAAGCACCCCACCGCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGC

>NZ_CP009473|3|3|1055020-1055105|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGC	CTGCTCGCCGAAGCACCCCACCGCAGAGGCGCCGCCGC
CGGAATACCCGATCATCGGGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009473.1\|WP_045603805.1\|1059079_1060891_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP009473.1\|WP_004523292.1\|1043042_1044275_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	unknown	unknown	gnl\|CDD\|223997
NZ_CP009473.1\|WP_004523282.1\|1057163_1059005_+\|ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|180772
NZ_CP009473.1\|WP_004530666.1\|1061409_1062441_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP009473.1\|WP_162486942.1\|1067191_1068331_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP009473.1\|WP_038733426.1\|1048666_1049257_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_045603810.1\|1066348_1066786_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP009473.1\|WP_004187216.1\|1051498_1053772_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP009473.1\|WP_045603808.1\|1064391_1064721_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_045603802.1\|1040534_1041992_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
NZ_CP009473.1\|WP_004557971.1\|1045524_1045965_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP009473.1\|WP_004552281.1\|1065627_1066281_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP009473.1\|WP_045603803.1\|1055682_1056948_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP009473.1\|WP_004523291.1\|1047715_1048651_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP009473.1\|WP_004530663.1\|1064724_1065174_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP009473.1\|WP_009969572.1\|1049316_1051215_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP009473.1\|WP_004200700.1\|1046302_1047418_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP009473.1\|WP_045603807.1\|1062437_1064270_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_CP009473.1\|WP_004532536.1\|1041993_1043037_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP009473.1\|WP_004187469.1\|1053904_1054300_-\|TraR/DksA-C4-type-zinc-finger-protein	unknown	unknown	gnl\|CDD\|224648

Protein	Function_ID	Function_description	E-value
NZ_CP009473.1\|WP_045603805.1\|1059079_1060891_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	4.37812e-75
NZ_CP009473.1\|WP_045603810.1\|1066348_1066786_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.05824e-33
NZ_CP009473.1\|WP_004523282.1\|1057163_1059005_+\|ribonucleotide-reductase	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0
NZ_CP009473.1\|WP_004530666.1\|1061409_1062441_+\|nitroreductase-family-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	7.9992e-31
NZ_CP009473.1\|WP_162486942.1\|1067191_1068331_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	6.60204e-55
NZ_CP009473.1\|WP_004523292.1\|1043042_1044275_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	gnl\|CDD\|223997	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion].	5.32689e-143
NZ_CP009473.1\|WP_004187216.1\|1051498_1053772_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	7.15563e-57
NZ_CP009473.1\|WP_045603802.1\|1040534_1041992_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	2.76758e-132
NZ_CP009473.1\|WP_004557971.1\|1045524_1045965_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	7.66567e-25
NZ_CP009473.1\|WP_004552281.1\|1065627_1066281_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	4.23582e-20
NZ_CP009473.1\|WP_045603803.1\|1055682_1056948_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	3.53029e-112
NZ_CP009473.1\|WP_004523291.1\|1047715_1048651_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.07132e-61
NZ_CP009473.1\|WP_004530663.1\|1064724_1065174_-\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.14402e-50
NZ_CP009473.1\|WP_009969572.1\|1049316_1051215_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	4.08722e-35
NZ_CP009473.1\|WP_004200700.1\|1046302_1047418_-\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.16274e-11
NZ_CP009473.1\|WP_045603807.1\|1062437_1064270_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.24145e-107
NZ_CP009473.1\|WP_004532536.1\|1041993_1043037_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
NZ_CP009473.1\|WP_004187469.1\|1053904_1054300_-\|TraR/DksA-C4-type-zinc-finger-protein	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14

>NZ_CP009473.1|WP_004187469.1|1053904_1054300_-|TraR/DksA-C4-type-zinc-finger-protein
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP009473.1|WP_004187216.1|1051498_1053772_-|FAD-dependent-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKMKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
>NZ_CP009473.1|WP_009969572.1|1049316_1051215_+|GMC-family-oxidoreductase
MLGATRSTLWGSRERPRIAAARAPGAVASRMREEARECAGPRGAGRAPHRATAAGGKTGRRTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETLVAA
>NZ_CP009473.1|WP_038733426.1|1048666_1049257_+|hypothetical-protein
MCRARGIGRQARGNATAPSPIAAAAIGARPRSAPRGPRISDAGRLAAARSAFAMHQERRKRNADRHGTHPYDADSRAAPREAPRFEHEPKKQRNAAQHEVDRDRAAREIHERIEHKARPDVRRAERPISQDVAQTPIGAAGAISPSTAHSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP009473.1|WP_004523291.1|1047715_1048651_+|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVVLTHRAIIGCDEHAPA
>NZ_CP009473.1|WP_004200700.1|1046302_1047418_-|SRPBCC-family-protein
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRVERESAYSLTLLKRRLEAARDA
>NZ_CP009473.1|WP_004557971.1|1045524_1045965_+|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPARIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP009473.1|WP_004523292.1|1043042_1044275_-|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha
MSQYGPLRLHVPEPTGRPGCKTDFSYLRLSPAGKVRKPPIDVAPADTSDLAYGLVRVLDEHGRAVGPWAPDLDPDILRKGIRAMLKTRIFDARMQIAQRQKKISFYMQCLGEEAIAVAHTLALERGDMCFPTYRQQGILMVREYPLVDMMCQLMSNERDPLKGRQLPVMYSTRDAGFFSISGNLATQFIQAVGWAMASAIKGDTRIASAWIGDGATAEADFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGATFAGRGVGCGIASLRVDGNDFLAVYAASRWAAERARRNLGPTLIEWVTYRAGPHSTSDDPTKYRPGDDWTNFPLGDPLERLKRHMIGIGVWSEQDHEDTKAALEAEVLAAQKEAERYGTLADEHVPNVASIFEDVYKEMPAHLRRQRQQLGV
>NZ_CP009473.1|WP_004532536.1|1041993_1043037_-|alpha-ketoacid-dehydrogenase-subunit-beta
MTTASREGPAASPMTMIQALRSAMDVMLERDGNVVVFGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPINEGGIVGAAVGMGAYGLRPVCEIQFADYFYPASDQIVSEAARLRYRSAAEFIAPLTIRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLISAIENDDPVIFLEPKRLYNGPFDGHHERPVTPWSKHPASLVPDGYYTVPLDSAAIVRAGGDVTVLTYGTTVHVSLAAAEETGIDAEVIDLRSLWPLDLDTIVESVRRTGRCVVVHEATRTCGFGAELIALVQEHCFHWLEAPVERVTGWDTPYPHAQEWAYFPGPNRVGDALRRAMEN
>NZ_CP009473.1|WP_045603802.1|1040534_1041992_-|2-oxo-acid-dehydrogenase-subunit-E2
MGVHVIKMPDIGEGIAEVELGLWHVKVGDRVKEDQAIADVMTDKASVEIPSPVTGVVVALGGKEGDVLAVGSELVRLEVEGDGNHKAEPDGGARAAAAQPERVADTAHAHASAVAKSARGEHGAGHGRDDARAASSGTSSGASHAQHEHAEREARGHRESSECREDRSASRDASQTDVERGPASPPPARRPGERPLASPAVRKRAWDLGVELRYVHGTGEAGRILHEDLDAYLQGRGAAAQRARGGQAAYVERHDEEAVPVIGLRRKIAQRMQDAKRRIPHFSYVEEIDVTELEALRAELNRKYGDTRGRLTVLPLLARAMVIALREFPQINARYDDEAGVVTRHGAVHLGIATQSKAGLMVPVVRHAEARDPWSIAAEVARLADAARAGRAERDELSGSTITITSLGALGGIASTPVINSPEVGIVGVNRIVERPMFRGGAVVARKLMNLSSSFDHRVIDGMDAAEFIQAVRGLLEQPALLFVE
>NZ_CP009473.1|WP_045603803.1|1055682_1056948_+|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGARPAGWPTWGPMARAADAVPAPPPFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPLEAGAFGLDAYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRTAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPRRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGPRWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP009473.1|WP_004523282.1|1057163_1059005_+|ribonucleotide-reductase
MRTINKRTRTIAHADSFVRMIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDEARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHTAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPGLVFVDAIDAADPLRGRERIGATSPCGAQPLPPYGSAMLGAIDLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRAGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP009473.1|WP_045603805.1|1059079_1060891_+|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRQPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAVRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACEAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLERALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDHSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP009473.1|WP_004530666.1|1061409_1062441_+|nitroreductase-family-protein
METSPLKTTTPEAIPPFDPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGLAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAELIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDFATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP009473.1|WP_045603807.1|1062437_1064270_+|SulP-family-inorganic-anion-transporter
MTERERAARGRNDARRGGSDSGGDDEAWRRWLPGIATLRTYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLGTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVAYAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLVAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRMRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVEGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEAGAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARR
>NZ_CP009473.1|WP_045603808.1|1064391_1064721_-|hypothetical-protein
MLSSRLVSSRLAPCCVYIDIQGEGDVDVDAEGNGNGNIDVIDSKRCEPSGVEPVERAVRCPRYRAQSGCLSGIHRNGIVMPDPMPPTNRFDRLRASAVIVDRMKPRRSP
>NZ_CP009473.1|WP_004530663.1|1064724_1065174_-|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKDVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP009473.1|WP_004552281.1|1065627_1066281_+|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDVYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLAEALSLNEDELPILAQTVGKPAAHP
>NZ_CP009473.1|WP_045603810.1|1066348_1066786_-|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP009473.1|WP_162486942.1|1067191_1068331_-|porin
MGDVMNAKSIAAAALAVAQAGLAHAQSSVTLYGALDAGVLWQNTSAASFSPTAPNTGAVVRFKDGGVYSSLWGIKGTEDLGGGYRVNFRLQGAFDGGTGKFGLSDAPGAVAAFNQIATLGVSGPFGTFNAGRQIVPMIYAMADTDVRAARFFGSVLTAWLGLNTAAGWPGNSTNAPIGALYDSDALVYQSPAFGGASLALEYAPGGVPGGVQRGARASIVLKYASNALNLAAVYYNGHDTNPAPGASATGLDNNRFVYVGAQYKLKDVAVSASYGNGRNPARGDRVNLDMFAFGLGYRVSPFFRVSSGVYYLKDRNRSANRSTSIVLGADYELSKHTTLYARGGRVDNRGTMAQMLAYGQPVAPGLATTAAMLGMRHSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009473_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009473_4

2504173-2504337

Orphan

Consensus_repeat	Method
GCGAGCGCGGCGAGCGCGGCCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP009473_4

>merge|NZ_CP009473|4|2504173-2504337|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGACAGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCGGCGAGCGCGGCCGCGCGATGGGCGCCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCGGCGAGCGCGGCCGCG

>NZ_CP009473|4|1|2504173-2504337|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGAC	AGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCG
GCGAGCGCGGCCGCGCGATGGGCG	CCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCG
GCGAGCGCGGCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009473.1\|WP_004542798.1\|2498367_2498877_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP009473.1\|WP_158336197.1\|2507846_2508344_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_045604230.1\|2509519_2509771_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_045604231.1\|2509933_2511193_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173852
NZ_CP009473.1\|WP_082257029.1\|2497860_2498346_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_004202607.1\|2494919_2495063_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_038791047.1\|2514532_2515927_-\|heavy-metal-sensor-histidine-kinase-IrlS	unknown	unknown	gnl\|CDD\|273593
NZ_CP009473.1\|WP_004524130.1\|2514165_2514438_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP009473.1\|WP_004524117.1\|2498873_2499878_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP009473.1\|WP_045604225.1\|2496478_2497465_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NZ_CP009473.1\|WP_004206353.1\|2508502_2509195_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP009473.1\|WP_004542822.1\|2502916_2503897_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119321
NZ_CP009473.1\|WP_045604228.1\|2504971_2506777_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP009473.1\|WP_004549393.1\|2511396_2512866_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP009473.1\|WP_004539128.1\|2513270_2513519_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009473.1\|WP_045604226.1\|2500004_2502698_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP009473.1\|WP_004537359.1\|2495596_2496421_+\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP009473.1\|WP_004528277.1\|2497504_2497864_+\|lipoprotein	unknown	unknown	gnl\|CDD\|226765
NZ_CP009473.1\|WP_038749723.1\|2495078_2495600_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123
NZ_CP009473.1\|WP_024428521.1\|2506773_2507784_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528

Protein	Function_ID	Function_description	E-value
NZ_CP009473.1\|WP_004542798.1\|2498367_2498877_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	4.99978e-71
NZ_CP009473.1\|WP_045604231.1\|2509933_2511193_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173852	cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C. DszC is a flavin reductase dependent enzyme, which catalyzes the first two steps of DBT desulfurization in mesophilic bacteria. DszC converts DBT to DBT-sulfoxide, which is then converted to DBT-sulfone. Bacteria with this enzyme are candidates for the removal of organic sulfur compounds from fossil fuels, which pollute the environment. An equivalent enzyme tdsC, is found in thermophilic bacteria. This alignment also contains a closely related uncharacterized subgroup.	2.04551e-137
NZ_CP009473.1\|WP_038791047.1\|2514532_2515927_-\|heavy-metal-sensor-histidine-kinase-IrlS	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_CP009473.1\|WP_004524130.1\|2514165_2514438_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	9.38719e-09
NZ_CP009473.1\|WP_004524117.1\|2498873_2499878_+\|FecR-family-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	2.1512e-74
NZ_CP009473.1\|WP_045604225.1\|2496478_2497465_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	1.37517e-27
NZ_CP009473.1\|WP_004206353.1\|2508502_2509195_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	8.15398e-14
NZ_CP009473.1\|WP_004542822.1\|2502916_2503897_-\|ABC-transporter-permease	gnl\|CDD\|119321	cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to generate the transmembrane pore.	3.68045e-52
NZ_CP009473.1\|WP_045604228.1\|2504971_2506777_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	9.13179e-177
NZ_CP009473.1\|WP_004549393.1\|2511396_2512866_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.06027e-36
NZ_CP009473.1\|WP_045604226.1\|2500004_2502698_+\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.93669e-87
NZ_CP009473.1\|WP_004537359.1\|2495596_2496421_+\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	1.13852e-18
NZ_CP009473.1\|WP_004528277.1\|2497504_2497864_+\|lipoprotein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	2.7211e-31
NZ_CP009473.1\|WP_038749723.1\|2495078_2495600_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	6.75942e-41
NZ_CP009473.1\|WP_024428521.1\|2506773_2507784_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	1.08818e-121

>NZ_CP009473.1|WP_004542822.1|2502916_2503897_-|ABC-transporter-permease
MRDATDRLSRLAALGALAAVLAFFAVAAPGFATLANVERVLVNHFALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALGAANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWLGVAAPLWIVAALAGALHVALERSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASALVYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFVANGLLLIGWNFYWQQVASGALVFAVLALGSGVGRERRARDAGQSG
>NZ_CP009473.1|WP_045604226.1|2500004_2502698_+|TonB-dependent-receptor
MDSICNRRPRRAHAGVCADTAHAPAGLPEAAQPAARLGAGRPRDAAAPRCARQATSHTSHTSHTSHTSHTSHASHTLHAPCMPQFAPQFAPRRVVARVAAAALFSACAAPGVSGAAEPAAATRGYDIPAGPLDAALTRFGREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGTGLVALRQPSGGYTLARLPGPAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGLRSDAPLAEVPQAVAIVAQQVLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGDNRDGSVMRNGMPIVQGRSLNATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLAGRHAISALGSTYGGGRNGGELTFDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPSLAWYGRDTQVVLSYEYRRFLMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLAQLAIDHQLAPDWKVHVGYSYNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYGIAYVDGRVTLAGMRHDVQFGVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVSASDSDQSDTLHTASLFFQDSIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKWLPRAGIVYKWNDALSLYGSYTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDMPGGLAGTLAFFDIDKKHVLVSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIASYAYIDAKTTEDPLYAGNRLWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPGDSANSFTLPAYATADAFATYDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDARQVSLLTTLQF
>NZ_CP009473.1|WP_004524117.1|2498873_2499878_+|FecR-family-protein
MSGAKPAGGPPAVPERVARRAVQWWVELGAAPASDATRARLARWRAEHPAHDAAWRHIEAVNGRLGHVASALSARAARAALLPPRSRGRRAALKALAVLLFAGGGAWTGQAYLPWRAWGADVRTALGERRTITLADGTTVVLNTDTAIDIRFDDATRGVRLLRGEIMVTSGRDAARAVPRALVIATAHGDVRPVGTRFSVRERGDATRVDVFDGAVRIAPRRAVGRAPLITAGHGADFTRDALAGPPRVLGASAGAWVDGILVASNLRLADLLAEIDRYRPGRVRCDAAVANLRVSGTYPLDDTDRILDTLRETLPVDVEYLSRYWVTVVAARD
>NZ_CP009473.1|WP_004542798.1|2498367_2498877_+|sigma-70-family-RNA-polymerase-sigma-factor
MPANTLRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTFIRLLARDEPIDAAEPRAFLTTVAQRVLYNHWRRERLERAYLDALAQWPEAVAPSPETRAVLFETLVEIDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQCYFAIAA
>NZ_CP009473.1|WP_082257029.1|2497860_2498346_+|hypothetical-protein
MTGKGGAAANPRAATAIVVAASGSISPASRRTALSTMKTTANATARRRDGGTMKAPKEKEPIASGGAVLAGSVESPVWATSAGHLVHAADAAAVATFRLSAGSASRVPRVPAVPARRFGEAAGPRAPPKRRGAPRIVRTHSPSGYKYVYNNHSHLQNSIPA
>NZ_CP009473.1|WP_004528277.1|2497504_2497864_+|lipoprotein
MIRNVLIALVCAAPVAALAEPPKAAGGMIVDDDGMTLYTFDRDTMPGKSACTGGCTANWPAALADAYDKPGGDLGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQHTGDGFGGMWHVARP
>NZ_CP009473.1|WP_045604225.1|2496478_2497465_+|YceI-family-protein
MDAAGSFASFAATLACALSAWLAPSAGIARTAWPSDAPRVAGASGPPRTPGLARTPAAVTDAPGAATAGALAASPPAATRYRLDPRHSGVTFRVDNFWHAHLTMRFARMRAELSDVGDDRLASRVDVTVDAASLGANVPFVATLVKGSAMLDVARYPEIRFVGTRFERTGATTGVLTGELTIRAMTRPITLAVRFDAGRQLEPDTGARAEREGDESDESGESNPAERRAGQGRRAAELRDGRPRDAGPGVADSRDAMRRETDSGSAHRGAEPPERIARAAPDAARPLAFVADGHFSRTAFGLSRWLPAVGDDVRLRIRAEFVRARADP
>NZ_CP009473.1|WP_004537359.1|2495596_2496421_+|anti-sigma-factor
MSDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDPRAAGIAAHYRAQRAALRALFADPVAPRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGWLGGALAPRFAPSAALQWVAPAAAQRAFARDADLAYALYAPDARHPVEIAAGRDGAPLAWLSARVGRRIAAPSLREYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREAAVRPWRDGGRHTFYWVSERTAYALSGQLDEGRLRSIAADVCGELGGHPQRWR
>NZ_CP009473.1|WP_038749723.1|2495078_2495600_+|sigma-70-family-RNA-polymerase-sigma-factor
MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRAFRPDTNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRMLYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPPLSLTAARHHR
>NZ_CP009473.1|WP_004202607.1|2494919_2495063_+|hypothetical-protein
MLSAACALLALMLAAGCASPGDMSPSDHAAPMGGYGRGGGSGGGGGY
>NZ_CP009473.1|WP_045604228.1|2504971_2506777_-|sugar-ABC-transporter-ATP-binding-protein
MKAALTTAAASAAAAPDAAGAPLALDVRRVVKRFGGVAALRGASLAVTRGTVHGLIGQNGAGKSTLVKLLAGLHAPDEGEITVGGVPFASGGSGSRASAGAARRHSTGIGFIHQERLLPATFTVAEALFFPHPPTLGGRASRLARLLPLDVKRMRRDCRAVLHTQFGLDLAPDRLIGELSVAEQQIVQITRALLGRHEILVFDEPSAALVSSEVDRLLRTIERLRANGHTILYVSHYLDEIARVCDRVSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPAAAAPSAATARADARVSARADAWGDDAHRAPAGADPARRGARAAPGAIALEARDLALPGRFGPLSLAVRRGEIVGLTGGLGSGGKDVIRALFGLARGVRGSIAVDGRPARVRRPHDAVAHGIALVPENRAAHGVALTLPVRENVVLADLSSVSRFGLVHGRREADVARALIRRLDIRPARPDLPARFLSGGNQQKVALAKWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDALARAGAAVLLFSSDLTELLDVTDRVYVMARGEIVAQCASAETTTRDVLAWATLARDARPGGGAGAHDAAARTGTPGAAGAASSAAKVAT
>NZ_CP009473.1|WP_024428521.1|2506773_2507784_-|sugar-ABC-transporter-substrate-binding-protein
MLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITAAGTDHYWDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIAQIQTLIAQQPDAIIEQLGTASVLEPWLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLVFNGFYGVPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKGTISAIWAAWDIPQVGATQAVDAAGRREIRTYAVDGSPEAVALVRNPTSSAAAVVAQQPALIGRTAVRNVARYLAGDRSLPAYTFVPSVLVTKDDAGVARPALGQTPAAAGLARR
>NZ_CP009473.1|WP_158336197.1|2507846_2508344_+|hypothetical-protein
MEANERFCATTPAKGTIDSCFGYGMAANARAAQAKMRGGHRTRPARALAGPAASRASMPTPISVGTRDRRRVVSIGIGQSQINFSAMLNKPDDAPLNRKRLIASQSENAAARAASNETKSSRKRSARAKFRAGMLENPYEGPPRRMIRRGGGAARFDGDFANGCI
>NZ_CP009473.1|WP_004206353.1|2508502_2509195_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MATTRRHATATALAAAARPCAAPHADSFLGILIEVFARVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPLALFFSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRGIVSRGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSEDAAYRAYRRSVRYRVIPGLF
>NZ_CP009473.1|WP_045604230.1|2509519_2509771_-|hypothetical-protein
MFSTLSHVLPRVVLLGEPLANAPFVDGEITRPFRDGFWLLPYSTLCLPLAASDTVIVEPDRPGSAGALAGRQLDAGRHSPSPL
>NZ_CP009473.1|WP_045604231.1|2509933_2511193_-|acyl-CoA-dehydrogenase-family-protein
MSHAPADPTRSTGADYASLAARFRPIFARIAEGAIERDRTRALPHEPIRWLKEAGFGALRVPVHAGGAGASVPQLVQLLIELAAADSNLPQALRGHFAFVEDWLNAPPDAARRAWFDRFASGQLVGNAWTEVGDVALGEVRTKVAKRDGGWVVNGEKYYSTGAIFADWIDVYAQRTDDGGPVIAAVAARQDGVILGDDWDGFGQATTGSGTTRFVDAHVDEANVIDFARRFKYQTAFYQLFHLATLAGIGRAVERDASALVRGRRRVYSHGNAPRVSDDAQILQVVGEISAWAYAAEAIALRAAQPSQRAYEARGGGDAAAEHDANVAAEIESAQGQLVVSELVLRAATHLFDALGASATRATNALDRHWRNARTVASHNPLVYKARIVGDRAVNGTEPPYVWQIGAGPGGPREPEQAV
>NZ_CP009473.1|WP_004549393.1|2511396_2512866_-|MFS-transporter
MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGVFLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVFMADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKASRLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAVPALAIIAVRGRYMNESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLVASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYRLPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYPALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAAIRFEPTARDVDVDIDAGPRAQGDRARVRAAA
>NZ_CP009473.1|WP_004539128.1|2513270_2513519_-|hypothetical-protein
MKAPIIAIAFGIALAACAPLRQDSRSGEAGPPIAAPNRGGGNTPPSGARRAANEVVDYAGRPCVNQTLYVKTHPCIFPRLQR
>NZ_CP009473.1|WP_004524130.1|2514165_2514438_+|DUF4148-domain-containing-protein
MNTKTTIVWATAAALTALALSPAAFAQGKTRDEVRQELIRAQHEGVVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTVAR
>NZ_CP009473.1|WP_038791047.1|2514532_2515927_-|heavy-metal-sensor-histidine-kinase-IrlS
MIRRLLPRTLRARLTALIILSTAATLALSGVALYSALHNRLVGMSSYEMSATLAAMRTHLANVANVDDIPRKSDLWIDQLHGHQNLDLAIYDTDGRLRFATRGFVAPRPALGAPQTRVPASAAPAGATFSYLADDAPLRGGNPRAARIVVQYDGKNDHALLRAYAYTVVVIEVLAVVLTAALAYGIAMLGLSPLRRLVARAEQMSSSRLAQPLPELDTSGELKEMEHAFNAMLKRLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQVALSKPRTADEYRDVIESSIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLDAAAQAERVAGYYEPMAEDAEVSIVVRGKAEVRADALLYHRALSNLISNALNHAPRGSTITIECAQAADAATISVSDTGRGIEAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTCGVDSEPHVRTTFWLKFPAHAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009473.1	873909-873929	0	1.0
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009473.1	873917-873937	0	1.0
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009473.1	873925-873945	0	1.0
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009474.1	619148-619168	2	0.905
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009474.1	619156-619176	2	0.905
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009474.1	619164-619184	2	0.905
NZ_CP009473_2	2.2\|873877\|21\|NZ_CP009473\|CRISPRCasFinder	873877-873897	21	NZ_CP009474.1	619172-619192	2	0.905

1. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 873909-873929, mismatch: 0, identity: 1.0

gacagcacgacagcacgacag	CRISPR spacer
gacagcacgacagcacgacag	Protospacer
*********************

2. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 873917-873937, mismatch: 0, identity: 1.0

gacagcacgacagcacgacag	CRISPR spacer
gacagcacgacagcacgacag	Protospacer
*********************

3. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 873925-873945, mismatch: 0, identity: 1.0

gacagcacgacagcacgacag	CRISPR spacer
gacagcacgacagcacgacag	Protospacer
*********************

4. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 619148-619168, mismatch: 2, identity: 0.905

gacagcacgacagcacgacag	CRISPR spacer
gacagctcgacagctcgacag	Protospacer
****** ******* ******

5. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 619156-619176, mismatch: 2, identity: 0.905

gacagcacgacagcacgacag	CRISPR spacer
gacagctcgacagctcgacag	Protospacer
****** ******* ******

6. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 619164-619184, mismatch: 2, identity: 0.905

gacagcacgacagcacgacag	CRISPR spacer
gacagctcgacagctcgacag	Protospacer
****** ******* ******

7. spacer 2.2|873877|21|NZ_CP009473|CRISPRCasFinder matches to position: 619172-619192, mismatch: 2, identity: 0.905

gacagcacgacagcacgacag	CRISPR spacer
gacagctcgacagctcgacag	Protospacer
****** ******* ******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

767639 : 828810

Streptococcus_phage(16.67%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004539273.1\|767639_768368_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-22	31.2
WP_173426800.1\|768764_770021_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004552566.1\|770046_770700_+	glutathione S-transferase	NA	NA	NA	NA
WP_004539273.1\|770883_771612_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-22	31.2
WP_076823033.1\|771665_771968_-	hypothetical protein	NA	NA	NA	NA
WP_041189383.1\|772037_773798_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_076859438.1\|773869_774115_-	hypothetical protein	NA	NA	NA	NA
WP_004544755.1\|774223_774523_-	hypothetical protein	NA	NA	NA	NA
WP_045603737.1\|774534_783786_-	hemagglutinin repeat-containing protein	NA	NA	NA	NA
WP_071811406.1\|783937_784135_-	hypothetical protein	NA	NA	NA	NA
WP_004533385.1\|784135_784399_-	putative Immunity protein 75	NA	NA	NA	NA
WP_045603739.1\|784991_789650_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	8.3e-23	34.9
WP_004553667.1\|789636_790905_-	hypothetical protein	NA	NA	NA	NA
WP_051453673.1\|794577_795567_-	DUF1016 family protein	A0A0U2BZN7	Salmonella_phage	3.0e-23	43.4
WP_038736157.1\|796582_797050_+	decarboxylase	NA	NA	NA	NA
WP_009972369.1\|797205_798231_+	hypothetical protein	NA	NA	NA	NA
WP_004539266.1\|798794_799394_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_004524853.1\|799418_799829_-	RidA family protein	NA	NA	NA	NA
WP_004530174.1\|801258_801606_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.7e-40	72.0
WP_082256870.1\|801602_802010_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	1.9e-11	36.5
WP_045603742.1\|802442_804476_-	hypothetical protein	NA	NA	NA	NA
WP_038763312.1\|804716_806888_-	alpha-galactosidase	NA	NA	NA	NA
WP_004524829.1\|806892_807744_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_045603743.1\|807744_808668_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_045603745.1\|808730_809972_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004524825.1\|810007_811252_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_004557920.1\|811294_811933_-	hypothetical protein	NA	NA	NA	NA
WP_004536893.1\|813705_814860_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004524822.1\|816204_816945_+	hypothetical protein	NA	NA	NA	NA
WP_009960547.1\|817373_817529_+	recombinase family protein	A0A0C4UR34	Shigella_phage	2.0e-06	67.6
WP_004552183.1\|817494_818001_+	recombinase family protein	A0JC18	Ralstonia_phage	3.3e-18	52.8
WP_004557924.1\|820286_820853_-	suppressor of fused domain protein	NA	NA	NA	NA
WP_173444617.1\|820854_821337_-	hypothetical protein	NA	NA	NA	NA
WP_129558622.1\|821601_822737_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.4e-16	29.6
WP_102619315.1\|823991_825172_-\|transposase	IS3-like element ISBps1 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-60	42.9
WP_082256873.1\|825798_826950_+	hypothetical protein	NA	NA	NA	NA
WP_157801140.1\|826960_827212_-	hypothetical protein	NA	NA	NA	NA
WP_122885398.1\|828255_828810_-\|transposase	transposase	S5WIU1	Leptospira_phage	3.4e-32	51.2

DBSCAN-SWA_2

1794060 : 1865853

Vibrio_phage(25.0%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525541.1\|1794060_1794828_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_004206084.1\|1794866_1795868_-	HpnL family protein	NA	NA	NA	NA
WP_004542606.1\|1795864_1796638_-	hypothetical protein	NA	NA	NA	NA
WP_044358837.1\|1796634_1797324_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_004188420.1\|1797688_1799203_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_042969900.1\|1800923_1801850_+	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_004202234.1\|1801883_1802432_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190846.1\|1802434_1803940_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530039.1\|1804083_1804611_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_011852791.1\|1804690_1805122_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_038730710.1\|1805135_1806998_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190851.1\|1806994_1807984_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_045604023.1\|1807986_1810857_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	2.4e-60	27.2
WP_004538025.1\|1810847_1813139_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004190563.1\|1813304_1815593_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_045604025.1\|1815596_1817813_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_045604027.1\|1817812_1818883_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_011852795.1\|1818885_1819602_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004190606.1\|1819644_1820034_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004202226.1\|1820039_1820633_+	type VI secretion lipoprotein TssJ	NA	NA	NA	NA
WP_004525552.1\|1820629_1821991_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004525553.1\|1822073_1823732_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004525554.1\|1823728_1827232_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190863.1\|1827290_1827650_+	hypothetical protein	NA	NA	NA	NA
WP_017881465.1\|1827672_1828104_+	hypothetical protein	NA	NA	NA	NA
WP_045604029.1\|1828424_1828700_+	hypothetical protein	NA	NA	NA	NA
WP_004524288.1\|1829250_1830150_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_162486929.1\|1830191_1830494_-	hypothetical protein	NA	NA	NA	NA
WP_045604472.1\|1830383_1831703_+	glycosyltransferase	NA	NA	NA	NA
WP_004524286.1\|1831699_1833286_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004186828.1\|1833510_1834506_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_045604031.1\|1834631_1834829_+	hypothetical protein	NA	NA	NA	NA
WP_045604033.1\|1834825_1836409_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004547675.1\|1837147_1838401_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004549218.1\|1838964_1840617_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	5.3e-57	31.6
WP_024430155.1\|1840749_1842234_-	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_004523134.1\|1842503_1843520_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004523135.1\|1844006_1845206_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_004198247.1\|1845383_1846409_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_045604035.1\|1846843_1848118_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.2e-104	53.9
WP_038727365.1\|1848190_1849162_+	membrane dipeptidase	NA	NA	NA	NA
WP_004186987.1\|1849312_1849846_+	4-vinyl reductase	NA	NA	NA	NA
WP_045604036.1\|1849906_1851970_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_045604038.1\|1851972_1853898_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_045604040.1\|1853902_1855075_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004530055.1\|1855071_1855857_+	drug:proton antiporter	NA	NA	NA	NA
WP_004523139.1\|1855881_1857150_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_004530056.1\|1857170_1858316_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004186918.1\|1858425_1859289_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_045604042.1\|1859469_1861125_+	APC family permease	NA	NA	NA	NA
WP_004186920.1\|1861211_1862087_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_045604044.1\|1862230_1863103_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004186939.1\|1863265_1864819_+\|holin	choline-sulfatase	NA	NA	NA	NA
WP_045604047.1\|1864815_1865853_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_3

2491196 : 2596791

105

Burkholderia_virus(45.1%)

head,capsid,lysis,holin,tail,terminase,portal,plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199327.1\|2491196_2492069_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_004199325.1\|2492280_2492985_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_045604222.1\|2493160_2494192_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004202607.1\|2494919_2495063_+	hypothetical protein	NA	NA	NA	NA
WP_038749723.1\|2495078_2495600_+	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	1.8e-06	27.7
WP_004537359.1\|2495596_2496421_+	anti-sigma factor	NA	NA	NA	NA
WP_045604225.1\|2496478_2497465_+	YceI family protein	NA	NA	NA	NA
WP_004528277.1\|2497504_2497864_+	lipoprotein	NA	NA	NA	NA
WP_082257029.1\|2497860_2498346_+	hypothetical protein	NA	NA	NA	NA
WP_004542798.1\|2498367_2498877_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_004524117.1\|2498873_2499878_+	FecR family protein	NA	NA	NA	NA
WP_045604226.1\|2500004_2502698_+	TonB-dependent receptor	NA	NA	NA	NA
WP_004542822.1\|2502916_2503897_-	ABC transporter permease	NA	NA	NA	NA
WP_038733769.1\|2503889_2504975_-	ABC transporter permease	NA	NA	NA	NA
WP_045604228.1\|2504971_2506777_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-09	25.2
WP_024428521.1\|2506773_2507784_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158336197.1\|2507846_2508344_+	hypothetical protein	NA	NA	NA	NA
WP_004206353.1\|2508502_2509195_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_045604230.1\|2509519_2509771_-	hypothetical protein	NA	NA	NA	NA
WP_045604231.1\|2509933_2511193_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_004549393.1\|2511396_2512866_-	MFS transporter	NA	NA	NA	NA
WP_004539128.1\|2513270_2513519_-	hypothetical protein	NA	NA	NA	NA
WP_004524130.1\|2514165_2514438_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_038791047.1\|2514532_2515927_-	heavy metal sensor histidine kinase IrlS	W8CYF6	Bacillus_phage	1.2e-20	28.9
WP_038742293.1\|2515923_2516613_-	heavy metal response regulator transcription factor IrlR	W8CYM9	Bacillus_phage	2.2e-36	36.4
WP_045604233.1\|2516619_2519853_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_038730121.1\|2519898_2521368_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_038727088.1\|2521378_2522764_-	TolC family protein	NA	NA	NA	NA
WP_004197875.1\|2522998_2523283_-	hypothetical protein	NA	NA	NA	NA
WP_004524134.1\|2523680_2523821_-	bacteriophage protein	NA	NA	NA	NA
WP_004553374.1\|2524475_2524964_-	adenosine-specific kinase	NA	NA	NA	NA
WP_017882051.1\|2525290_2525776_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_045604236.1\|2525971_2526301_-	helix-turn-helix domain-containing protein	R4JEU7	Burkholderia_phage	1.0e-52	91.7
WP_038760824.1\|2526533_2526686_+	hypothetical protein	R4JMC2	Burkholderia_phage	3.1e-12	70.0
WP_045604238.1\|2526673_2527543_+	DUF550 domain-containing protein	R4JG80	Burkholderia_phage	1.5e-130	85.9
WP_128972238.1\|2527539_2528040_+	hypothetical protein	NA	NA	NA	NA
WP_024429164.1\|2528070_2528256_+	hypothetical protein	A4JWW7	Burkholderia_virus	5.4e-19	86.9
WP_009897093.1\|2528252_2528474_+	hypothetical protein	A4JWW6	Burkholderia_virus	1.6e-38	100.0
WP_038778445.1\|2528701_2528839_+	hypothetical protein	A4JWW4	Burkholderia_virus	2.3e-19	95.6
WP_045604240.1\|2529000_2529213_+	hypothetical protein	A4JWW3	Burkholderia_virus	3.1e-34	98.6
WP_045604242.1\|2530971_2532765_+	replication endonuclease	A4JWW0	Burkholderia_virus	0.0e+00	92.6
WP_004542802.1\|2532780_2533047_+	ogr/Delta-like zinc finger family protein	A4JWV9	Burkholderia_virus	3.5e-43	98.8
WP_045604244.1\|2533043_2533244_+	ogr/Delta-like zinc finger family protein	A4JWV8	Burkholderia_virus	6.2e-29	89.4
WP_051781513.1\|2533625_2534990_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.1e-21	38.0
WP_045604247.1\|2535100_2537350_+	glycosyltransferase	NA	NA	NA	NA
WP_080002914.1\|2537276_2537990_+	cellulose biosynthesis protein BcsS	NA	NA	NA	NA
WP_006027262.1\|2538620_2538917_+	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	5.6e-50	99.0
WP_004202809.1\|2538919_2539276_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_038738790.1\|2539319_2540375_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	2.6e-206	99.7
WP_045604249.1\|2540371_2542141_-\|terminase	terminase ATPase subunit family protein	A4JWU9	Burkholderia_virus	0.0e+00	98.8
WP_004552664.1\|2542284_2543094_+\|capsid	GPO family capsid scaffolding protein	K4PAW2	Burkholderia_phage	4.2e-148	100.0
WP_045604250.1\|2543127_2544141_+\|capsid	phage major capsid protein, P2 family	K4NZP8	Burkholderia_phage	1.0e-188	99.4
WP_045604251.1\|2544137_2544827_+\|terminase	terminase endonuclease subunit	K4NX86	Burkholderia_phage	1.4e-115	98.3
WP_045604252.1\|2544926_2545406_+\|head	head completion/stabilization protein	A4JWU5	Burkholderia_virus	7.6e-81	98.7
WP_004534234.1\|2545405_2545657_+	hypothetical protein	A4JWZ4	Burkholderia_virus	8.4e-39	98.8
WP_004524438.1\|2545653_2545860_+\|tail	tail protein X	K4PAW7	Burkholderia_phage	2.4e-31	100.0
WP_004524439.1\|2545874_2546219_+	membrane protein	K4NZQ3	Burkholderia_phage	2.9e-50	100.0
WP_004524440.1\|2546220_2546493_+\|holin	phage holin family protein	K4NX91	Burkholderia_phage	8.8e-42	100.0
WP_045604254.1\|2546489_2547302_+	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	1.5e-145	96.3
WP_038770534.1\|2547298_2547739_+\|lysis	LysB family phage lysis regulatory protein	A4JWT9	Burkholderia_virus	1.7e-66	97.8
WP_004531054.1\|2547843_2548260_+\|tail	phage tail protein	A4JWT7	Burkholderia_virus	3.3e-72	100.0
WP_038758943.1\|2548256_2548724_+	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	1.4e-76	97.4
WP_129558633.1\|2548889_2549261_+	hypothetical protein	NA	NA	NA	NA
WP_038737784.1\|2549309_2550059_-	site-specific DNA-methyltransferase	K4NZW3	Burkholderia_phage	1.0e-140	97.2
WP_045604257.1\|2550232_2550913_+\|plate	phage baseplate assembly protein V	A4JWY4	Burkholderia_virus	1.0e-123	99.1
WP_038732417.1\|2550909_2551272_+	GPW/gp25 family protein	K4PAX6	Burkholderia_phage	4.3e-60	98.3
WP_038765889.1\|2551268_2552174_+\|plate	baseplate assembly protein	K4NZR5	Burkholderia_phage	3.3e-162	99.0
WP_009897027.1\|2552166_2552721_+\|tail	phage tail protein I	A4JWT0	Burkholderia_virus	3.8e-100	100.0
WP_045604259.1\|2552731_2555095_+	phage Tail collar domain protein	K4NZW8	Burkholderia_phage	0.0e+00	99.4
WP_038738771.1\|2555111_2555783_+\|tail	tail assembly chaperone	A4JWS8	Burkholderia_virus	1.8e-112	96.4
WP_038773160.1\|2555838_2557011_+\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.3e-222	99.5
WP_014696837.1\|2557026_2557536_+\|tail	phage major tail tube protein	K4NZR9	Burkholderia_phage	3.2e-93	98.8
WP_045604260.1\|2557593_2557938_+\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	5.1e-55	99.1
WP_004552648.1\|2557946_2558060_+\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	5.4e-14	100.0
WP_045604262.1\|2558062_2561023_+	membrane protein	A4JWS3	Burkholderia_virus	0.0e+00	99.2
WP_045604264.1\|2561040_2561466_+\|tail	phage tail protein	A4JWS2	Burkholderia_virus	1.7e-71	98.6
WP_045604266.1\|2561465_2562566_+	phage late control D family protein	K4PAY4	Burkholderia_phage	8.4e-200	98.1
WP_173444614.1\|2562576_2563113_-\|transposase	IS21 family transposase	A4JWX0	Burkholderia_virus	6.9e-99	98.3
WP_004528294.1\|2563400_2564516_-	alanine dehydrogenase	NA	NA	NA	NA
WP_004524142.1\|2565240_2565570_-	H-NS histone family protein	NA	NA	NA	NA
WP_038733329.1\|2565583_2566123_-	ProQ/FinO family protein	NA	NA	NA	NA
WP_004542746.1\|2566641_2567406_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_024431543.1\|2567773_2568349_+	DUF2760 domain-containing protein	NA	NA	NA	NA
WP_004528300.1\|2568345_2570193_+	Hsp70 family protein	NA	NA	NA	NA
WP_045604267.1\|2570196_2573004_+	hsp70 family protein	A0A2H4UU19	Bodo_saltans_virus	3.5e-08	26.5
WP_004557566.1\|2573293_2574427_-	CapA family protein	S4VS02	Pandoravirus	9.5e-114	56.2
WP_004531797.1\|2575160_2575415_-	hypothetical protein	NA	NA	NA	NA
WP_004557569.1\|2576338_2576494_+	hypothetical protein	NA	NA	NA	NA
WP_004537634.1\|2576847_2577471_-	hypothetical protein	NA	NA	NA	NA
WP_038739464.1\|2577522_2580036_-	cation-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	1.1e-56	27.5
WP_004528311.1\|2580133_2580613_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_004531802.1\|2581701_2582448_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_009981568.1\|2582697_2584128_-	thiamine pyridinylase	NA	NA	NA	NA
WP_004542833.1\|2584217_2585018_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_004542786.1\|2585257_2585998_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004528318.1\|2586013_2587003_-	thymidylate synthase	NA	NA	NA	NA
WP_004528319.1\|2587004_2587460_-	hypothetical protein	NA	NA	NA	NA
WP_045604269.1\|2587456_2587933_-	NUDIX hydrolase	A0A0E3JJF3	Streptomyces_phage	8.0e-14	42.1
WP_004528321.1\|2587925_2588105_-	hypothetical protein	NA	NA	NA	NA
WP_045604271.1\|2588518_2589313_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_011853173.1\|2589369_2590518_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_004528326.1\|2590714_2591551_-	EamA family transporter	NA	NA	NA	NA
WP_004557579.1\|2592258_2593749_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_004531808.1\|2594057_2594666_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_038792464.1\|2594790_2596791_-\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	1.4e-104	46.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009474

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009474_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009474_1

1380566-1380833

Orphan

Consensus_repeat	Method
NAGCGCTGAAGCGCTGAC	CRT

5 spacers

The CRISPR arrays of NZ_CP009474_1

>merge|NZ_CP009474|1|1380566-1380833|CRT
GAGCGCTGAAGCGTTCGCTTCGGTCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCAACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGCTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACGCTGGCCAACCACGGCATGGGATCGGAGTAAGCGCTGAAGCGCTGACTCCGATCGACAGGAGTCGATATGGCAACCATCAAAGTAGACGTCGTCAGCGCCGAAGAGCAGAT

>NZ_CP009474|1|1|1380566-1380833|CRT
GAGCGCTGAAGCGTTCGC	TTCGGTCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGAC	TCTGGCCAACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGCTGAC	TCCGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGAC	GCTGGCCAACCACGGCATGGGATCGGAGT
AAGCGCTGAAGCGCTGAC	TCCGATCGACAGGAGTCGATATGGCAACCATCAAAGTAGACGTCGT
CAGCGCCGAAGAGCAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009474.1\|WP_011852373.1\|1372059_1373193_+\|anion-permease	unknown	unknown	gnl\|CDD\|238537
NZ_CP009474.1\|WP_004524507.1\|1376490_1378032_+\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NZ_CP009474.1\|WP_004195828.1\|1375034_1375304_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|180739
NZ_CP009474.1\|WP_004195829.1\|1375904_1376444_+\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NZ_CP009474.1\|WP_004185142.1\|1394855_1396403_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341286
NZ_CP009474.1\|WP_045604972.1\|1381447_1383178_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP009474.1\|WP_004185283.1\|1375431_1375902_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|180240
NZ_CP009474.1\|WP_004195831.1\|1378103_1378979_+\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535
NZ_CP009474.1\|WP_111993829.1\|1383637_1383772_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP009474.1\|WP_004195818.1\|1371164_1372052_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_CP009474.1\|WP_004538602.1\|1374106_1374958_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP009474.1\|WP_004185243.1\|1379058_1380453_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_CP009474.1\|WP_038796073.1\|1373463_1373994_+\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP009474.1\|WP_038764547.1\|1385203_1386298_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP009474.1\|WP_004202912.1\|1389016_1389187_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341251
NZ_CP009474.1\|WP_038743472.1\|1383737_1384079_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP009474.1\|WP_004524498.1\|1393484_1394624_+\|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380565
NZ_CP009474.1\|WP_041196993.1\|1389470_1393400_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|236989
NZ_CP009474.1\|WP_045604974.1\|1384278_1385064_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270231
NZ_CP009474.1\|WP_038738637.1\|1386738_1389006_+\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|235514

Protein	Function_ID	Function_description	E-value
NZ_CP009474.1\|WP_011852373.1\|1372059_1373193_+\|anion-permease	gnl\|CDD\|238537	cd01117, YbiR_permease, Putative anion permease YbiR. Based on sequence similarity, YbiR proteins are predicted to function as anion translocating permeases in eubacteria, archaea and plants. They belong to ArsB/NhaD superfamily of permeases that have been shown to translocate sodium, sulfate, arsenite and organic anions. A typical ArsB/NhaD permease is composed of 8-13 transmembrane domains.	3.17697e-60
NZ_CP009474.1\|WP_004524507.1\|1376490_1378032_+\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NZ_CP009474.1\|WP_004195828.1\|1375034_1375304_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|180739	PRK06876, PRK06876, F0F1 ATP synthase subunit C; Validated.	4.52385e-24
NZ_CP009474.1\|WP_004195829.1\|1375904_1376444_+\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	9.74398e-65
NZ_CP009474.1\|WP_004185142.1\|1394855_1396403_-\|AMP-binding-protein	gnl\|CDD\|341286	cd17631, FACL_FadD13-like, fatty acyl-CoA synthetase, including FadD13. This family contains fatty acyl-CoA synthetases, including Mycobacterium tuberculosis acid-induced operon MymA encoding the fatty acyl-CoA synthetase FadD13 which is essential for virulence and intracellular growth of the pathogen. The fatty acyl-CoA synthetase activates lipids before entering into the metabolic pathways and is also involved in transmembrane lipid transport. However, unlike soluble fatty acyl-CoA synthetases, but like the mammalian integral-membrane very-long-chain acyl-CoA synthetases, FadD13 accepts lipid substrates up to the maximum length of C26, and this is facilitated by an extensive hydrophobic tunnel from the active site to a positively charged patch. Also included is feruloyl-CoA synthetase (Fcs) in Rhodococcus strains where it is involved in biotechnological vanillin production from eugenol and ferulic acid via a non-beta-oxidative pathway.	4.67104e-160
NZ_CP009474.1\|WP_045604972.1\|1381447_1383178_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP009474.1\|WP_004185283.1\|1375431_1375902_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|180240	PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated.	5.5546e-56
NZ_CP009474.1\|WP_004195831.1\|1378103_1378979_+\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	1.65914e-157
NZ_CP009474.1\|WP_111993829.1\|1383637_1383772_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	7.42552e-11
NZ_CP009474.1\|WP_004195818.1\|1371164_1372052_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	6.61248e-79
NZ_CP009474.1\|WP_004538602.1\|1374106_1374958_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	4.13283e-72
NZ_CP009474.1\|WP_004185243.1\|1379058_1380453_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_CP009474.1\|WP_038796073.1\|1373463_1373994_+\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.2241e-11
NZ_CP009474.1\|WP_038764547.1\|1385203_1386298_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP009474.1\|WP_004202912.1\|1389016_1389187_-\|hypothetical-protein	gnl\|CDD\|341251	cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM). MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The acyl-CoA is a key intermediate in many important biosynthetic and catabolic processes. MACS enzymes are localized to mitochondria. Two murine MACS family proteins are found in liver and kidney. In rodents, a MACS member is detected particularly in the olfactory epithelium and is called O-MACS. O-MACS demonstrates substrate preference for the fatty acid lengths of C6-C12.	0.00325788
NZ_CP009474.1\|WP_038743472.1\|1383737_1384079_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	4.01961e-35
NZ_CP009474.1\|WP_004524498.1\|1393484_1394624_+\|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380565	cd06342, PBP1_ABC_LIVBP-like, type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup includes the type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup also includes a leucine-specific binding protein (or LivK), which is very similar in sequence and structure to leucine-isoleucine-valine binding protein (LIVBP). ABC-type active transport systems are transmembrane proteins that function in the transport of diverse sets of substrates across extra- and intracellular membranes, including carbohydrates, amino acids, inorganic ions, dipeptides and oligopeptides, metabolic products, lipids and sterols, and heme, to name a few.	7.44751e-142
NZ_CP009474.1\|WP_041196993.1\|1389470_1393400_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	gnl\|CDD\|236989	PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0
NZ_CP009474.1\|WP_045604974.1\|1384278_1385064_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270231	cd01069, PBP2_PheC, Cyclohexadienyl dehydratase, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes cyclohexadienyl dehydratase PheC. These proteins catalyze the decarboxylation of prephenate to phenylpyruvate in the alternative phenylalanine biosynthesis pathway in some proteobacteria and archaea. The PheC proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. Since they the PheC proteins are so similar to periplasmic binding proteins, (PBP), it is evolutionarily plausible that several pre-existing PBP proteins might have been recruited to perform the enzymatic function.	8.59096e-126
NZ_CP009474.1\|WP_038738637.1\|1386738_1389006_+\|primosomal-protein-N'	gnl\|CDD\|235514	PRK05580, PRK05580, primosome assembly protein PriA; Validated.	0

>NZ_CP009474.1|WP_004185243.1|1379058_1380453_+|F0F1-ATP-synthase-subunit-beta
MSTAALVEGKIVQCIGAVIDVEFPRESMPKIYDALILEGSELTLEVQQQLGDGVVRTICLGASDGLRRGVVVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGPIESENKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDPLDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFEKAKKIQ
>NZ_CP009474.1|WP_004195831.1|1378103_1378979_+|F0F1-ATP-synthase-subunit-gamma
MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYAEKVRAIAAHMSRANPEYRHPFMVANDGVKTAGMILVTTDKGLCGGLNTNVLRASLQKFKELEEQGQKVEATAIGGKGLGFLNRFGAKVISQVVHLGDTPHLDKLIGAVKTQLDLYSEGKLSAVYLAYTRFVNTMKQETVIEQLLPLSSEHFDANDGTPATSWDYIYEPDAQAVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKELSEIVGGAAAV
>NZ_CP009474.1|WP_004524507.1|1376490_1378032_+|F0F1-ATP-synthase-subunit-alpha
MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAIDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVAASASESAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHADLIKRIEDTKDLSKDDESALHAALKDFKKSGAY
>NZ_CP009474.1|WP_004195829.1|1375904_1376444_+|F0F1-ATP-synthase-subunit-delta
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
>NZ_CP009474.1|WP_004185283.1|1375431_1375902_+|F0F1-ATP-synthase-subunit-B
MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL
>NZ_CP009474.1|WP_004195828.1|1375034_1375304_+|F0F1-ATP-synthase-subunit-C
MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQPELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG
>NZ_CP009474.1|WP_004538602.1|1374106_1374958_+|F0F1-ATP-synthase-subunit-A
MAASEGTRAPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWSIVCGLITILLLRLAARKATSGVPGRFQCAVEMLVEMVEDQSKAIVHGNRAFIAPLALTVFVWVALMNSLDFLPVDLPGRVIGWLGLSGIISHHRIVPTADLNGTLGIALGVFVLMLYYSIKIKGAGGFAHELVSAPFGSHPLLWIPNLALNIVEFVAKTVSLGMRLFGNMYAGELVFLLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHDAH
>NZ_CP009474.1|WP_038796073.1|1373463_1373994_+|ATP-synthase-subunit-I
MADRAPDKRHEDRRAAQRTVSGAVGRRAAAADDWDAEQQEDDVVPLTRAEAQALFGPEVSRPSRVTPYRVVVAQMVLSLVATLAWWLFSKSPGAAAQSAFLGGAIGWVPSALFVARLRLSGAGTVMGWVAGEALKLGVTIAMFAAVAFGYPGVHWVPLLVTYLVVLKTYWIALAWR
>NZ_CP009474.1|WP_011852373.1|1372059_1373193_+|anion-permease
MSNSVVGRAPARIIAFVRHEPVLSILVAALIALQAVHSLSAIALVRLVDWQTVATLAGLLMLTKALELSGFLMWLAHRIVHRVRSERALAALLVVFAAALSVWLTNDVALFVVIPLVLSLRELTPLPFKRLVIYIALAVNAGAIATPLGNPQNLFLWQLSGVSFGRFVIALGPLALVLMALLLAMVVFAFDGRPLDLSRDSTERPVDRAQAFATVAMFAGFVLLADAHHALAGMLAVAAVFLIVRRDAVLKIDWLLLLIFVLMFIVLRSAASLPAVHQAIAGIGLDTPLRAYAAGALLSQIISNVPAAILLSEFTHDWRALAFGVSVGGFGIAFGSLANLIAIRLSRARGMWLPFHLVSIPFGIASAVLGALLLHYF
>NZ_CP009474.1|WP_004195818.1|1371164_1372052_+|ParB/RepB/Spo0J-family-partition-protein
MNAVAKKKGLGRGLEALLGGSADITEAVKIEGAPNVLALGKLQAGKYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLEEVPVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRSRSAVSNLLRLLNLAMPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRETEKLVAHTTKAEPAVKARAKDDGGRDTRRLEEELSDLLASNVKIKVGRRGRGQLTIDFGDLDALEGILARLRGNVAA
>NZ_CP009474.1|WP_045604972.1|1381447_1383178_+|AMP-binding-protein
MAADSGMGALIAPMLGLSYVCGPADVPLSDATIGQFLLDTVARFPDRVAVVFREQGVRWTWREFADEVDALAAALIELGIARGDRVGIWSPNRAEWLLTQFATARIGAVLVNVNPAYRLAELEYALNKVGCKLLIAAERFKTSAYAEMIAEIAPELATTRAGDVLCAARVPSLRTVVTMSDAAHAGMLSFADVLARGRAALASARLDAIGATLDCRDPINIQFTSGTTGSPKGATLTHRNVVNNARSIANVMRLTEADAMCIPVPLYHCFGMVLSVLACVSAGAKMVFPGAAFEPGATLAAVSDERCTALQGVPTMFIAELDHPDFDRFDLSTLRTGIMAGSPCPIETMKRVVAKMHMSEVTIAYGMTETSPVSFQSATTDSLEKRTTTVGRIQPHLEAKIVDATGAIVPVGETGELCTRGYSVMLGYWDDEARTREAVVDGWMRTGDLATLDEEGFCNIVGRLKDMLIRGGENVYPREIEEFLFRHPKIQSVQVFGVPDSKYGEEVCAWIVLRAGETMTDDELREFCSGQIAHYKVPRYVRFVDELPMTVTGKVQKFVMRERMIDELGLSVQQTA
>NZ_CP009474.1|WP_111993829.1|1383637_1383772_+|CoA-binding-protein
MTAISTDEVPRKILKRDRVIAVVGLSDKPYRPSYEVAAYLRQNG
>NZ_CP009474.1|WP_038743472.1|1383737_1384079_+|CoA-binding-protein
MKSLLTCDKMVNRIVPVNPLLAGAALLGERVHPSLADARAALAADGIEIDMVDVFRKPEEVPAVVDATLAIGARSLWLQPGVVHDEAAAKARTAGLDVVVDRCVKIEHRGRFG
>NZ_CP009474.1|WP_045604974.1|1384278_1385064_-|transporter-substrate-binding-domain-containing-protein
MKMNQTLLALACCAGLSHAQTAPQPGAPASRLDDVLARGTLRVCTTGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGGISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFAKQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK
>NZ_CP009474.1|WP_038764547.1|1385203_1386298_+|uroporphyrinogen-decarboxylase
MAQTLLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKQPDYATEVTLQPLERFPLDAAILFSDILTIPDAMGLGLDFAAGEGPKFAHPVRTEADVAKLAVPDIGATLGYVTDAVREIRRALTDGEGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYARPDLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRFSLDYVRRVLVQLKREHDGARVPAIAFTKGGGLWLEELAATGVDAVGLDWTVNLGRARERVAGRVALQGNLDPTILFAPPEAIRAEARAVLDSYGNHPGHVFNLGHGISQFTPPEHVAELVDEVHRHSRAIRSGAGS
>NZ_CP009474.1|WP_038738637.1|1386738_1389006_+|primosomal-protein-N'
MADAFVRVALDHPLPTLFDYRYRGDMPAAPGMLVQVPFGRRSVVGLVCEVTAHTDVPAAKLKAVDAVCTELPPLSRHWLELAAFAADYYQRGLGEVALPALPQALRDVPRWGRLLAPELRYRLLDAGRAALPNALPARGAALRRLAQALADAPALSLAEVRALHPKAVAVLDEWQAQGWAACDEIAITHADAQLVDNPAPASARRPTALPPQLTDQQAEALDAIAAADGFAPFLLHGVTGSGKTEVYLRALAALLERRPEAQALVLVPEINLTPQFEAAFRARFAATLPADAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPALAMIVVDEEHEPAYKQQEGLRYSARDLAVWRAKQLAIPVVLGSATPSLETWWQAEQGRYRRLTLTKRAVADAALPTVRLVDLEEERRRGRGSMGGLSGPLVAALKARLERGEQSLVFLNRRGYAPALACDACGWVAGCPRCSAYVVMHKPEHAVRCHHCGWEARIPRACPECGNVDIAPLGRGTQRVEETLALAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQRVSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLIQTRYPRHALYHALARQDYVGFAGATLGERRDAHLPPFVYQALLRAEGRTLDAALAFLQQAADAFSELPGAERVTVYDAVPMTIVKVANVHRAQLLIESASRAALQHTLRAWQPLLRELKGVLRWSVEVDPLDI
>NZ_CP009474.1|WP_004202912.1|1389016_1389187_-|hypothetical-protein
MDGWVVIGIVLAAWIAGAIVFVHRASAVFFQALGCAQRVKKDERRARLSGLREAHE
>NZ_CP009474.1|WP_041196993.1|1389470_1393400_+|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGVTDLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASLASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEDALKVVPLGAPHTKIALPRELYGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAAPRDVRNPADLRDVVGTVSEATPDEVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRAVMFTGSTEVARLINKTLSSRLDPDGRPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDTHIAAMKDKGHAVTQLEMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLDKLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPRSLEAALVADAPQEGETRDNPSAALTALRDWLIEQREPALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAALATGNRALFAGAAGEALVAALPAQLKAHAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPGPIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
>NZ_CP009474.1|WP_004524498.1|1393484_1394624_+|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein
MQHTMKKLAGATFVAVMSLAGTAHADDVKIGFAAPMTGAQAHYGKDMQNGIVLAIEDINATKPTIGGKPVKFVLDTQDDQADPRTGTTVAQKLVDDGIKGMLGHFNSGTTIPASRIYANAGIPQIAMATAPEYTTQGYKTTFRMMTSDTQQGSVAGTFAVKDLGMKKIAIVDDRTAYGQGLADQFEKAAKAAGATIVDREFTNDKAVDFKAILTKLKATKPDLVYYGGADSQAAPMAKQMKSLGVTAPLMGGEMVHTPTFLKIAGDAAEGSIASLAGLPLAEMPGGKAYADKYKKRFGEDVQTYSPYAYDGAMAMFSAMKKANSTDPAKYLPLLAKTDMAGVTSTHIAYDAKGDLRNGGITMYKVEKGEWKPLKSIGGK
>NZ_CP009474.1|WP_004185142.1|1394855_1396403_-|AMP-binding-protein
MNLIAALERAARATPDKPFLRDDGATLTYRQMQQRSRRAAEVLASLGVAPGERVAAMCLNTPAFFDLLLGAWRIGAVVVPVNHKLQAPEVDHILRHSASRAVLFDAALAPVLANVEHDALRLATEGEAAGAAPFDRLVADAAGIAPATPDDAALAEILYTSGTTGRPKGCMHSHRTVALAAATSALALSMTERERTLMAMPVWHASPLNNWFGGTLYVGGTVVLMREYQPLRFLQTVEAEQVTLYFGAPVSYTLPLDTIADFASFDLTSVRAWLYGGGPIGATLARRLMRAYRSEAFYQVYGMTETGPAGTVLHPFEQAMKPGSIGCQGTPGVDVRVVTAAGGLARPGEIGEIRLRADSMMLGYLDDPGATRAAFDDDGWYRSGDVARVDDDGYLFVVDRIKDMIVTGGENVYSKEVEDVLNAHPAVAEAAVVGRAHPEWGETVIAHVVLREAAGAARAGQAESAAGVDADALRAFCATRLAAYKIPREYVFAERLPRTPTGKLQKYLLRARGGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	306425-306452	6	0.786
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	73536-73563	6	0.786
NZ_CP009474_1	1.3\|1380677\|28\|NZ_CP009474\|CRT	1380677-1380704	28	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79157-79184	6	0.786
NZ_CP009474_1	1.3\|1380677\|28\|NZ_CP009474\|CRT	1380677-1380704	28	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89072-89099	6	0.786
NZ_CP009474_1	1.3\|1380677\|28\|NZ_CP009474\|CRT	1380677-1380704	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216474	6	0.786
NZ_CP009474_1	1.3\|1380677\|28\|NZ_CP009474\|CRT	1380677-1380704	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459228	6	0.786
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279887	Mycobacterium phage Timmi, complete genome	40471-40499	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH651175	Mycobacterium phage Gophee, complete genome	40756-40784	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	GQ303264	Mycobacterium phage Puhltonio, complete genome	40765-40793	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	GU247134	Mycobacterium phage Scoot17C, complete genome	40898-40926	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX683293	Mycobacterium phage Daffy, complete genome	40480-40508	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279888	Mycobacterium phage TomBombadil, complete genome	40756-40784	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF957056	Mycobacterium phage Thora, complete genome	40771-40799	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT316463	Mycobacterium phage Slatt, complete genome	40775-40803	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX576645	Mycobacterium phage Derpp, complete genome	40325-40353	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH651184	Mycobacterium phage Phareon, complete genome	40464-40492	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN006063	Mycobacterium phage Serendipity, complete genome	40779-40807	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH779500	Mycobacterium phage Crownjwl, complete genome	40543-40571	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH230875	Mycobacterium phage CheetO, complete genome	40766-40794	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG962365	Mycobacterium phage DoesntMatter, complete genome	40752-40780	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279882	Mycobacterium phage Sophia, complete genome	40470-40498	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX670813	Mycobacterium phage MitKao, complete genome	40468-40496	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH576970	Mycobacterium phage DonSanchon, complete genome	40462-40490	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279866	Mycobacterium phage MRabcd, complete genome	40461-40489	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH513973	Mycobacterium phage Kwksand96, complete genome	40330-40358	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN945899	Mycobacterium phage Skippy, complete genome	40749-40777	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279908	Mycobacterium phage Roliet, complete genome	40764-40792	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_023727	Mycobacterium phage Vista, complete genome	40769-40797	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT897909	Mycobacterium phage Maru, complete genome	40413-40441	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH727555	Mycobacterium phage Mulan, complete genome	40624-40652	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_027985	Mycobacterium phage UncleHowie, complete genome	40468-40496	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN698990	Mycobacterium phage IsaacEli, complete genome	40907-40935	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KY965066	Mycobacterium phage BlackStallion, complete genome	40902-40930	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN703415	Mycobacterium phage Mcshane, complete genome	40462-40490	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX592589	Mycobacterium phage Iridoclysis, complete genome	40748-40776	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH051251	Mycobacterium phage DuchessDung, complete genome	39751-39779	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX576646	Mycobacterium phage TyrionL, complete genome	40325-40353	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279871	Mycobacterium phage Plmatters, complete genome	40764-40792	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279883	Mycobacterium phage Struggle, complete genome	40317-40345	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	40771-40799	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH371107	Mycobacterium phage Doddsville, complete genome	40479-40507	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_028942	Mycobacterium phage Phipps, complete sequence	40744-40772	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KJ567044	Mycobacterium phage EmpTee, complete genome	40765-40793	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279881	Mycobacterium phage Solosis, complete genome	40476-40504	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG944223	Mycobacterium phage Trypo, complete genome	40900-40928	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT897902	Mycobacterium phage Boehler, complete genome	40772-40800	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279855	Mycobacterium phage Haleema, complete genome	40476-40504	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JX649096	Mycobacterium phage Serpentine, complete genome	40766-40794	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK494104	Mycobacterium phage HenryJackson, complete genome	40476-40504	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG944225	Mycobacterium phage Xavier, complete genome	40473-40501	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JX649099	Mycobacterium phage Gyarad, complete genome	40764-40792	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH450116	Mycobacterium phage Buckeye, complete genome	40786-40814	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN638753	Mycobacterium phage Morgushi, complete genome	40469-40497	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG757158	Mycobacterium phage HighStump, complete genome	40603-40631	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112539	Mycobacterium phage Dione, complete genome	40459-40487	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279873	Mycobacterium phage QueenBeane, complete genome	40755-40783	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF668276	Mycobacterium phage Lulumae, complete genome	40455-40483	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT897903	Mycobacterium phage DirtJuice, complete genome	40749-40777	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH513980	Mycobacterium phage Roy17, complete genome	40455-40483	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT316460	Mycobacterium phage Kimbrough, complete genome	40480-40508	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF937097	Mycobacterium phage Hertubise, complete genome	40776-40804	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH230874	Mycobacterium phage Banjo, complete genome	40448-40476	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH651186	Mycobacterium phage Podrick, complete genome	40755-40783	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG962362	Mycobacterium phage AltPhacts, complete genome	40744-40772	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF704103	Mycobacterium phage Vortex, complete sequence	40466-40494	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	FJ174694	Mycobacterium phage Chah, complete genome	40916-40944	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH051264	Mycobacterium phage Cobra, complete genome	40767-40795	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112536	Mycobacterium phage Cannibal, complete genome	40738-40766	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX578071	Mycobacterium phage Mana, complete genome	40470-40498	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919539	Mycobacterium phage Virapocalypse, complete genome	40759-40787	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KC661274	Mycobacterium phage SDcharge11, complete genome	40742-40770	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KJ194579	Mycobacterium phage Swish, complete genome	40890-40918	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH371114	Mycobacterium phage Childish, complete genome	40486-40514	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279852	Mycobacterium phage Fringe, complete genome	40886-40914	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KY385382	Mycobacterium phage ImtiyazSitla, complete genome	40451-40479	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN699010	Mycobacterium phage TallGrassMM, complete genome	40385-40413	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG757159	Mycobacterium phage JangoPhett, complete genome	40759-40787	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279891	Mycobacterium phage Wallhey, complete genome	40329-40357	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919503	Mycobacterium phage Dingo, complete genome	40750-40778	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KY676783	Mycobacterium phage Chorkpop, complete genome	40482-40510	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112527	Mycobacterium phage Altwerkus, complete genome	40450-40478	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JX649100	Mycobacterium phage Alex, complete genome	40792-40820	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_028691	Mycobacterium phage Apizium, complete genome	40650-40678	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH371125	Mycobacterium phage Morty, complete genome	40907-40935	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF937109	Mycobacterium phage Yoshand, complete genome	40903-40931	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279878	Mycobacterium phage Samaymay, complete genome	40755-40783	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	40892-40920	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112551	Mycobacterium phage Riggan, complete genome	40751-40779	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN945903	Mycobacterium phage Jiminy, complete genome	40319-40347	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KM363597	Mycobacteriophage Zonia, complete genome	40780-40808	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KF713485	Mycobacterium phage Suffolk, complete genome	40766-40794	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG770212	Mycobacterium phage Haimas, complete genome	40762-40790	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279861	Mycobacterium phage Legolas, complete genome	40500-40528	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279843	Mycobacterium phage CamL, complete genome	40755-40783	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279846	Mycobacterium phage Cosmolli16, complete genome	40474-40502	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KM408320	Mycobacterium phage Lasso, complete genome	40730-40758	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KR029086	Mycobacterium phage PDRPv, complete genome	40479-40507	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KY385380	Mycobacterium phage Ashraf, complete genome	40451-40479	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH825705	Mycobacterium phage Mesh1, complete genome	40777-40805	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT952849	Mycobacterium phage Windsor, complete genome	40465-40493	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH576954	Mycobacterium phage HSavage, complete genome	40768-40796	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112555	Mycobacterium phage Zelda, complete genome	40810-40838	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_028803	Mycobacterium phage OSmaximus, complete genome	40940-40968	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279904	Mycobacterium phage RedMaple, complete genome	40906-40934	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KR029087	Mycobacterium phage PDRPxv, complete genome	40540-40568	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	40904-40932	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_005259	Mycobacterium phage PG1, complete genome	40909-40937	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112552	Mycobacterium phage Spartan300, complete genome	40761-40789	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX702319	Mycobacterium phage Pinkman, complete genome	40323-40351	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919523	Mycobacterium phage Mikota, complete genome	40748-40776	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KU867907	Mycobacterium phage Potter, complete genome	40479-40507	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH590588	Mycobacterium phage Vaticameos, complete genome	38450-38478	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279885	Mycobacterium phage Surely, complete genome	40772-40800	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279870	Mycobacterium phage Omniscient, complete genome	40775-40803	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN638752	Mycobacterium phage Murdoc, complete genome	40755-40783	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG962375	Mycobacterium phage ProfessorX, complete genome	40756-40784	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG925348	Mycobacterium phage Megatron, complete genome	40898-40926	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH077582	Mycobacterium phage Olive, complete genome	40756-40784	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF155947	Mycobacterium phage LemonSlice, complete genome	40467-40495	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KP027209	Mycobacterium phage Sigman, complete genome	40889-40917	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH450122	Mycobacterium phage KingTut, complete genome	36143-36171	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279859	Mycobacterium phage Kwadwo, complete genome	40455-40483	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112546	Mycobacterium phage LuckyMarjie, complete genome	40470-40498	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX620786	Mycobacterium phage Lego3393, complete genome	40910-40938	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112544	Mycobacterium phage Keitherie, complete genome	40819-40847	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KP027197	Mycobacterium phage FluffyNinja, complete genome	40903-40931	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH651177	Mycobacterium phage KlimbOn, complete genome	40757-40785	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279877	Mycobacterium phage Roscoe, complete genome	41001-41029	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN698989	Mycobacterium phage JacAttac, complete genome	40889-40917	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH479918	Mycobacterium phage Labeouficaum, complete genome	40325-40353	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112553	Mycobacterium Phage Squiggle, complete genome	40485-40513	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_028907	Mycobacterium phage Kikipoo, complete genome	40907-40935	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279850	Mycobacterium phage Durga, complete genome	40917-40945	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279897	Mycobacterium phage Bishoperium, complete genome	40463-40491	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN585965	Mycobacterium phage Duggie, complete genome	40481-40509	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT310868	Mycobacterium phage Telesworld, complete genome	40464-40492	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279865	Mycobacterium phage Mecca, complete genome	40468-40496	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KC576784	Mycobacterium phage ShiVal, complete genome	40765-40793	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH479916	Mycobacterium phage GeneCoco, complete genome	40773-40801	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN444868	Mycobacterium phage Prickles, complete genome	40755-40783	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KY385383	Mycobacterium phage Maskar, complete genome	40451-40479	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH371117	Mycobacterium phage Kahve, complete genome	40473-40501	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH399773	Mycobacterium phage Craff, complete genome	40902-40930	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	GU247133	Mycobacterium phage Fang, complete genome	40910-40938	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_008197	Mycobacterium phage Orion, complete genome	40896-40924	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH479921	Mycobacterium phage Placalicious, complete genome	40461-40489	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT897901	Mycobacterium phage Adriana, complete genome	40892-40920	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN369744	Mycobacterium phage Beaglebox, complete genome	40469-40497	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919530	Mycobacterium phage Sheila, complete genome	40804-40832	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG925356	Mycobacterium phage OliverWalter, complete genome	40778-40806	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JX649098	Mycobacterium phage Nacho, complete genome	40901-40929	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT889369	Mycobacterium phage Inchworm, complete genome	40889-40917	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KP027208	Mycobacterium phage Pipsqueak, complete genome	40768-40796	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919519	Mycobacterium phage Longacauda, complete genome	40463-40491	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF704109	Mycobacterium phage Oosterbaan, complete sequence	40763-40791	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX369585	Mycobacterium phage PhatCats2014, complete genome	40913-40941	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK310139	Mycobacterium phage Emiris, complete genome	40885-40913	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KJ194580	Mycobacterium phage Badfish, complete genome	40917-40945	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KX576647	Mycobacterium phage CharlieGBrown, complete genome	40336-40364	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN369738	Mycobacterium phage Hocus, complete genome	40465-40493	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279889	Mycobacterium phage Valjean, complete genome	40764-40792	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH399775	Mycobacterium phage Gareth, complete genome	40458-40486	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	40763-40791	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279895	Mycobacterium phage Zaider, complete genome	40993-41021	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MN585967	Mycobacterium phage Kloppinator, complete genome	41182-41210	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK279858	Mycobacterium phage JakeO, complete genome	40484-40512	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_028681	Mycobacterium phage Pops, complete genome	40779-40807	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH744417	Mycobacterium phage Grand2040, complete genome	40476-40504	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JX649097	Mycobacterium phage Piglet, complete genome	40874-40902	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MG925350	Mycobacterium phage Mosaic, complete genome	40462-40490	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH479914	Mycobacterium phage FugateOSU, complete genome	40464-40492	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH825702	Mycobacterium phage Hamish, complete genome	40754-40782	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF704091	Mycobacterium phage ABU, complete sequence	40894-40922	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919528	Mycobacterium phage Phunky, complete genome	40761-40789	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_028690	Mycobacterium phage Eremos, complete genome	40758-40786	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	40751-40779	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JN192463	Mycobacterium phage Oline, complete genome	40329-40357	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NC_021310	Mycobacterium phage Newman, complete genome	40760-40788	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MK112542	Mycobacterium phage Jillium, complete genome	40478-40506	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MT310867	Mycobacterium phage Chaelin, complete genome	40461-40489	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KJ194583	Mycobacterium phage Numberten, complete genome	40767-40795	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH590594	Mycobacterium phage PinheadLarry, complete genome	40474-40502	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	KJ174157	Mycobacterium phage Soto, complete genome	40776-40804	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH399780	Mycobacterium phage Mutante, complete genome	40474-40502	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	JF704099	Mycobacterium phage KLucky39, complete sequence	40763-40791	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MH779516	Mycobacterium phage Waterdiva, complete genome	40761-40789	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	MF919507	Mycobacterium phage Horchata, complete genome	40756-40784	6	0.793
NZ_CP009474_1	1.4\|1380723\|29\|NZ_CP009474\|CRT	1380723-1380751	29	NZ_CP045374	Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence	161362-161390	6	0.793
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216474	7	0.75
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459228	7	0.75
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	1003771-1003798	7	0.75
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79157-79184	7	0.75
NZ_CP009474_1	1.1\|1380584\|28\|NZ_CP009474\|CRT	1380584-1380611	28	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89072-89099	7	0.75
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NZ_CP045374	Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence	161362-161390	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279887	Mycobacterium phage Timmi, complete genome	40471-40499	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH651175	Mycobacterium phage Gophee, complete genome	40756-40784	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	GQ303264	Mycobacterium phage Puhltonio, complete genome	40765-40793	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	GU247134	Mycobacterium phage Scoot17C, complete genome	40898-40926	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX683293	Mycobacterium phage Daffy, complete genome	40480-40508	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279888	Mycobacterium phage TomBombadil, complete genome	40756-40784	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF957056	Mycobacterium phage Thora, complete genome	40771-40799	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT316463	Mycobacterium phage Slatt, complete genome	40775-40803	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX576645	Mycobacterium phage Derpp, complete genome	40325-40353	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH651184	Mycobacterium phage Phareon, complete genome	40464-40492	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN006063	Mycobacterium phage Serendipity, complete genome	40779-40807	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH779500	Mycobacterium phage Crownjwl, complete genome	40543-40571	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH230875	Mycobacterium phage CheetO, complete genome	40766-40794	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG962365	Mycobacterium phage DoesntMatter, complete genome	40752-40780	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279882	Mycobacterium phage Sophia, complete genome	40470-40498	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX670813	Mycobacterium phage MitKao, complete genome	40468-40496	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH576970	Mycobacterium phage DonSanchon, complete genome	40462-40490	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279866	Mycobacterium phage MRabcd, complete genome	40461-40489	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH513973	Mycobacterium phage Kwksand96, complete genome	40330-40358	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN945899	Mycobacterium phage Skippy, complete genome	40749-40777	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279908	Mycobacterium phage Roliet, complete genome	40764-40792	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_023727	Mycobacterium phage Vista, complete genome	40769-40797	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT897909	Mycobacterium phage Maru, complete genome	40413-40441	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH727555	Mycobacterium phage Mulan, complete genome	40624-40652	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_027985	Mycobacterium phage UncleHowie, complete genome	40468-40496	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN698990	Mycobacterium phage IsaacEli, complete genome	40907-40935	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KY965066	Mycobacterium phage BlackStallion, complete genome	40902-40930	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN703415	Mycobacterium phage Mcshane, complete genome	40462-40490	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX592589	Mycobacterium phage Iridoclysis, complete genome	40748-40776	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH051251	Mycobacterium phage DuchessDung, complete genome	39751-39779	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX576646	Mycobacterium phage TyrionL, complete genome	40325-40353	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279871	Mycobacterium phage Plmatters, complete genome	40764-40792	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279883	Mycobacterium phage Struggle, complete genome	40317-40345	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	40771-40799	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH371107	Mycobacterium phage Doddsville, complete genome	40479-40507	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_028942	Mycobacterium phage Phipps, complete sequence	40744-40772	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KJ567044	Mycobacterium phage EmpTee, complete genome	40765-40793	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279881	Mycobacterium phage Solosis, complete genome	40476-40504	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG944223	Mycobacterium phage Trypo, complete genome	40900-40928	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT897902	Mycobacterium phage Boehler, complete genome	40772-40800	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279855	Mycobacterium phage Haleema, complete genome	40476-40504	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JX649096	Mycobacterium phage Serpentine, complete genome	40766-40794	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK494104	Mycobacterium phage HenryJackson, complete genome	40476-40504	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG944225	Mycobacterium phage Xavier, complete genome	40473-40501	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JX649099	Mycobacterium phage Gyarad, complete genome	40764-40792	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH450116	Mycobacterium phage Buckeye, complete genome	40786-40814	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN638753	Mycobacterium phage Morgushi, complete genome	40469-40497	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG757158	Mycobacterium phage HighStump, complete genome	40603-40631	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112539	Mycobacterium phage Dione, complete genome	40459-40487	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279873	Mycobacterium phage QueenBeane, complete genome	40755-40783	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF668276	Mycobacterium phage Lulumae, complete genome	40455-40483	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT897903	Mycobacterium phage DirtJuice, complete genome	40749-40777	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH513980	Mycobacterium phage Roy17, complete genome	40455-40483	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT316460	Mycobacterium phage Kimbrough, complete genome	40480-40508	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF937097	Mycobacterium phage Hertubise, complete genome	40776-40804	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH230874	Mycobacterium phage Banjo, complete genome	40448-40476	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH651186	Mycobacterium phage Podrick, complete genome	40755-40783	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG962362	Mycobacterium phage AltPhacts, complete genome	40744-40772	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF704103	Mycobacterium phage Vortex, complete sequence	40466-40494	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	FJ174694	Mycobacterium phage Chah, complete genome	40916-40944	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH051264	Mycobacterium phage Cobra, complete genome	40767-40795	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112536	Mycobacterium phage Cannibal, complete genome	40738-40766	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX578071	Mycobacterium phage Mana, complete genome	40470-40498	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919539	Mycobacterium phage Virapocalypse, complete genome	40759-40787	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KC661274	Mycobacterium phage SDcharge11, complete genome	40742-40770	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KJ194579	Mycobacterium phage Swish, complete genome	40890-40918	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH371114	Mycobacterium phage Childish, complete genome	40486-40514	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279852	Mycobacterium phage Fringe, complete genome	40886-40914	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KY385382	Mycobacterium phage ImtiyazSitla, complete genome	40451-40479	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN699010	Mycobacterium phage TallGrassMM, complete genome	40385-40413	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG757159	Mycobacterium phage JangoPhett, complete genome	40759-40787	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279891	Mycobacterium phage Wallhey, complete genome	40329-40357	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919503	Mycobacterium phage Dingo, complete genome	40750-40778	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KY676783	Mycobacterium phage Chorkpop, complete genome	40482-40510	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112527	Mycobacterium phage Altwerkus, complete genome	40450-40478	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JX649100	Mycobacterium phage Alex, complete genome	40792-40820	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_028691	Mycobacterium phage Apizium, complete genome	40650-40678	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH371125	Mycobacterium phage Morty, complete genome	40907-40935	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF937109	Mycobacterium phage Yoshand, complete genome	40903-40931	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279878	Mycobacterium phage Samaymay, complete genome	40755-40783	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	40892-40920	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112551	Mycobacterium phage Riggan, complete genome	40751-40779	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN945903	Mycobacterium phage Jiminy, complete genome	40319-40347	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KM363597	Mycobacteriophage Zonia, complete genome	40780-40808	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KF713485	Mycobacterium phage Suffolk, complete genome	40766-40794	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG770212	Mycobacterium phage Haimas, complete genome	40762-40790	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279861	Mycobacterium phage Legolas, complete genome	40500-40528	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279843	Mycobacterium phage CamL, complete genome	40755-40783	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279846	Mycobacterium phage Cosmolli16, complete genome	40474-40502	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KM408320	Mycobacterium phage Lasso, complete genome	40730-40758	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KR029086	Mycobacterium phage PDRPv, complete genome	40479-40507	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KY385380	Mycobacterium phage Ashraf, complete genome	40451-40479	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH825705	Mycobacterium phage Mesh1, complete genome	40777-40805	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT952849	Mycobacterium phage Windsor, complete genome	40465-40493	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH576954	Mycobacterium phage HSavage, complete genome	40768-40796	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112555	Mycobacterium phage Zelda, complete genome	40810-40838	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_028803	Mycobacterium phage OSmaximus, complete genome	40940-40968	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279904	Mycobacterium phage RedMaple, complete genome	40906-40934	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KR029087	Mycobacterium phage PDRPxv, complete genome	40540-40568	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	40904-40932	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_005259	Mycobacterium phage PG1, complete genome	40909-40937	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112552	Mycobacterium phage Spartan300, complete genome	40761-40789	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX702319	Mycobacterium phage Pinkman, complete genome	40323-40351	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919523	Mycobacterium phage Mikota, complete genome	40748-40776	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KU867907	Mycobacterium phage Potter, complete genome	40479-40507	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH590588	Mycobacterium phage Vaticameos, complete genome	38450-38478	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279885	Mycobacterium phage Surely, complete genome	40772-40800	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279870	Mycobacterium phage Omniscient, complete genome	40775-40803	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN638752	Mycobacterium phage Murdoc, complete genome	40755-40783	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG962375	Mycobacterium phage ProfessorX, complete genome	40756-40784	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG925348	Mycobacterium phage Megatron, complete genome	40898-40926	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH077582	Mycobacterium phage Olive, complete genome	40756-40784	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF155947	Mycobacterium phage LemonSlice, complete genome	40467-40495	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KP027209	Mycobacterium phage Sigman, complete genome	40889-40917	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH450122	Mycobacterium phage KingTut, complete genome	36143-36171	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279859	Mycobacterium phage Kwadwo, complete genome	40455-40483	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112546	Mycobacterium phage LuckyMarjie, complete genome	40470-40498	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX620786	Mycobacterium phage Lego3393, complete genome	40910-40938	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112544	Mycobacterium phage Keitherie, complete genome	40819-40847	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KP027197	Mycobacterium phage FluffyNinja, complete genome	40903-40931	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH651177	Mycobacterium phage KlimbOn, complete genome	40757-40785	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279877	Mycobacterium phage Roscoe, complete genome	41001-41029	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN698989	Mycobacterium phage JacAttac, complete genome	40889-40917	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH479918	Mycobacterium phage Labeouficaum, complete genome	40325-40353	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112553	Mycobacterium Phage Squiggle, complete genome	40485-40513	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_028907	Mycobacterium phage Kikipoo, complete genome	40907-40935	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279850	Mycobacterium phage Durga, complete genome	40917-40945	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279897	Mycobacterium phage Bishoperium, complete genome	40463-40491	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN585965	Mycobacterium phage Duggie, complete genome	40481-40509	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT310868	Mycobacterium phage Telesworld, complete genome	40464-40492	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279865	Mycobacterium phage Mecca, complete genome	40468-40496	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KC576784	Mycobacterium phage ShiVal, complete genome	40765-40793	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH479916	Mycobacterium phage GeneCoco, complete genome	40773-40801	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN444868	Mycobacterium phage Prickles, complete genome	40755-40783	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KY385383	Mycobacterium phage Maskar, complete genome	40451-40479	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH371117	Mycobacterium phage Kahve, complete genome	40473-40501	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH399773	Mycobacterium phage Craff, complete genome	40902-40930	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	GU247133	Mycobacterium phage Fang, complete genome	40910-40938	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_008197	Mycobacterium phage Orion, complete genome	40896-40924	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH479921	Mycobacterium phage Placalicious, complete genome	40461-40489	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT897901	Mycobacterium phage Adriana, complete genome	40892-40920	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN369744	Mycobacterium phage Beaglebox, complete genome	40469-40497	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919530	Mycobacterium phage Sheila, complete genome	40804-40832	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG925356	Mycobacterium phage OliverWalter, complete genome	40778-40806	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JX649098	Mycobacterium phage Nacho, complete genome	40901-40929	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT889369	Mycobacterium phage Inchworm, complete genome	40889-40917	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KP027208	Mycobacterium phage Pipsqueak, complete genome	40768-40796	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919519	Mycobacterium phage Longacauda, complete genome	40463-40491	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF704109	Mycobacterium phage Oosterbaan, complete sequence	40763-40791	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX369585	Mycobacterium phage PhatCats2014, complete genome	40913-40941	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK310139	Mycobacterium phage Emiris, complete genome	40885-40913	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KJ194580	Mycobacterium phage Badfish, complete genome	40917-40945	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KX576647	Mycobacterium phage CharlieGBrown, complete genome	40336-40364	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN369738	Mycobacterium phage Hocus, complete genome	40465-40493	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279889	Mycobacterium phage Valjean, complete genome	40764-40792	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH399775	Mycobacterium phage Gareth, complete genome	40458-40486	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	40763-40791	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279895	Mycobacterium phage Zaider, complete genome	40993-41021	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MN585967	Mycobacterium phage Kloppinator, complete genome	41182-41210	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK279858	Mycobacterium phage JakeO, complete genome	40484-40512	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_028681	Mycobacterium phage Pops, complete genome	40779-40807	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH744417	Mycobacterium phage Grand2040, complete genome	40476-40504	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JX649097	Mycobacterium phage Piglet, complete genome	40874-40902	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MG925350	Mycobacterium phage Mosaic, complete genome	40462-40490	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH479914	Mycobacterium phage FugateOSU, complete genome	40464-40492	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH825702	Mycobacterium phage Hamish, complete genome	40754-40782	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF704091	Mycobacterium phage ABU, complete sequence	40894-40922	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919528	Mycobacterium phage Phunky, complete genome	40761-40789	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_028690	Mycobacterium phage Eremos, complete genome	40758-40786	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	40751-40779	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JN192463	Mycobacterium phage Oline, complete genome	40329-40357	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	NC_021310	Mycobacterium phage Newman, complete genome	40760-40788	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MK112542	Mycobacterium phage Jillium, complete genome	40478-40506	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MT310867	Mycobacterium phage Chaelin, complete genome	40461-40489	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KJ194583	Mycobacterium phage Numberten, complete genome	40767-40795	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH590594	Mycobacterium phage PinheadLarry, complete genome	40474-40502	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	KJ174157	Mycobacterium phage Soto, complete genome	40776-40804	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH399780	Mycobacterium phage Mutante, complete genome	40474-40502	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	JF704099	Mycobacterium phage KLucky39, complete sequence	40763-40791	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MH779516	Mycobacterium phage Waterdiva, complete genome	40761-40789	7	0.759
NZ_CP009474_1	1.2\|1380630\|29\|NZ_CP009474\|CRT	1380630-1380658	29	MF919507	Mycobacterium phage Horchata, complete genome	40756-40784	7	0.759
NZ_CP009474_1	1.3\|1380677\|28\|NZ_CP009474\|CRT	1380677-1380704	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977346	8	0.714

1. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.786

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
ggcggtcgaccgcatcggggccagaaca	Protospacer
  ***********  **********..*

2. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.786

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
ggcggtcgaccgcatcggggccagaaca	Protospacer
  ***********  **********..*

3. spacer 1.3|1380677|28|NZ_CP009474|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 6, identity: 0.786

tccgatcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
.**  *** ***************** .

4. spacer 1.3|1380677|28|NZ_CP009474|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.786

tccgatcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
.**  *** ***************** .

5. spacer 1.3|1380677|28|NZ_CP009474|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tccgatcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
.**  *** ***************** .

6. spacer 1.3|1380677|28|NZ_CP009474|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 6, identity: 0.786

tccgatcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
.**  *** ***************** .

7. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

8. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

9. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

10. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

11. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

12. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

13. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

14. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

15. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

16. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

17. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

18. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

19. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

20. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

21. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

22. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

23. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

24. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

25. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH513973 (Mycobacterium phage Kwksand96, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

26. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

27. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

28. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

29. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

30. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

31. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

32. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

33. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

34. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

35. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

36. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

37. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

38. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

39. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

40. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

41. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH371107 (Mycobacterium phage Doddsville, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

42. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

43. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

44. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

45. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

46. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

47. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

48. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

49. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

50. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

51. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

52. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

53. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

54. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

55. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

56. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

57. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

58. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

59. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

60. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

61. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

62. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

63. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

64. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

65. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

66. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

67. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH051264 (Mycobacterium phage Cobra, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

68. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

69. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

70. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

71. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

72. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

73. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

74. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

75. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KY385382 (Mycobacterium phage ImtiyazSitla, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

76. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

77. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

78. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279891 (Mycobacterium phage Wallhey, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

79. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

80. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

81. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

82. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

83. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgattt	Protospacer
*.******.******* ********.  *

84. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

85. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

86. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

87. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcgtgggatcgatct	Protospacer
*.******.*******.********.  *

88. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

89. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN945903 (Mycobacterium phage Jiminy, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

90. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KM363597 (Mycobacteriophage Zonia, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

91. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

92. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

93. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

94. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

95. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

96. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

97. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KR029086 (Mycobacterium phage PDRPv, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

98. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KY385380 (Mycobacterium phage Ashraf, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

99. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

100. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

101. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

102. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

103. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

104. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

105. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KR029087 (Mycobacterium phage PDRPxv, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

106. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

107. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

108. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

109. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX702319 (Mycobacterium phage Pinkman, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

110. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

111. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

112. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

113. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

114. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

115. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

116. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

117. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

118. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

119. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

120. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

121. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

122. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

123. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

124. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

125. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

126. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

127. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

128. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

129. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

130. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH479918 (Mycobacterium phage Labeouficaum, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

131. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

132. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

133. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279850 (Mycobacterium phage Durga, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

134. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

135. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN585965 (Mycobacterium phage Duggie, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

136. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

137. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

138. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

139. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH479916 (Mycobacterium phage GeneCoco, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

140. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

141. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KY385383 (Mycobacterium phage Maskar, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

142. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

143. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

144. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

145. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

146. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

147. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

148. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN369744 (Mycobacterium phage Beaglebox, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

149. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

150. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

151. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

152. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT889369 (Mycobacterium phage Inchworm, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcgtgggatcgatct	Protospacer
*.******.*******.********.  *

153. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

154. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919519 (Mycobacterium phage Longacauda, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

155. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

156. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

157. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

158. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

159. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KX576647 (Mycobacterium phage CharlieGBrown, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

160. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN369738 (Mycobacterium phage Hocus, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

161. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

162. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

163. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

164. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

165. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

166. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK279858 (Mycobacterium phage JakeO, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

167. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

168. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

169. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

170. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

171. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

172. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

173. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

174. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

175. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

176. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

177. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JN192463 (Mycobacterium phage Oline, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

178. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

179. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

180. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

181. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

182. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

183. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

184. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

185. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

186. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

187. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
*.******.******* ********.  *

188. spacer 1.4|1380723|29|NZ_CP009474|CRT matches to NZ_CP045374 (Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence) position: , mismatch: 6, identity: 0.793

gctggccaaccacggcatgggatcggagt	CRISPR spacer
ggcggccatccacggcatgggagcggcgc	Protospacer
* .***** ************* *** *.

189. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
..*  *** ***************** .

190. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 7, identity: 0.75

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
..*  *** ***************** .

191. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 7, identity: 0.75

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
cgttgtcgaccgtcgcggtgccagagtt	Protospacer
. . ********.***** ********

192. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 7, identity: 0.75

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
..*  *** ***************** .

193. spacer 1.1|1380584|28|NZ_CP009474|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.75

ttcggtcgaccgccgcggggccagagta	CRISPR spacer
ccctttcgcccgccgcggggccagaggg	Protospacer
..*  *** ***************** .

194. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NZ_CP045374 (Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
ggcggccatccacggcatgggagcggcgc	Protospacer
  .***** ************* *** *.

195. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

196. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

197. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

198. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

199. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

200. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

201. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

202. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

203. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

204. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

205. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

206. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

207. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

208. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

209. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

210. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

211. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

212. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

213. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH513973 (Mycobacterium phage Kwksand96, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

214. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

215. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

216. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

217. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

218. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

219. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

220. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

221. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

222. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

223. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

224. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

225. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

226. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

227. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

228. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

229. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH371107 (Mycobacterium phage Doddsville, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

230. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

231. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

232. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

233. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

234. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

235. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

236. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

237. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

238. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

239. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

240. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

241. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

242. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

243. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

244. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

245. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

246. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

247. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

248. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

249. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

250. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

251. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

252. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

253. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

254. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

255. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH051264 (Mycobacterium phage Cobra, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

256. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

257. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

258. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

259. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

260. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

261. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

262. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

263. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KY385382 (Mycobacterium phage ImtiyazSitla, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

264. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

265. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

266. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279891 (Mycobacterium phage Wallhey, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

267. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

268. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

269. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

270. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

271. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgattt	Protospacer
 .******.******* ********.  *

272. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

273. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

274. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

275. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcgtgggatcgatct	Protospacer
 .******.*******.********.  *

276. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

277. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN945903 (Mycobacterium phage Jiminy, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

278. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KM363597 (Mycobacteriophage Zonia, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

279. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

280. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

281. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

282. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

283. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

284. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

285. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KR029086 (Mycobacterium phage PDRPv, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

286. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KY385380 (Mycobacterium phage Ashraf, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

287. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

288. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

289. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

290. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

291. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

292. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

293. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KR029087 (Mycobacterium phage PDRPxv, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

294. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

295. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

296. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

297. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX702319 (Mycobacterium phage Pinkman, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

298. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

299. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

300. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

301. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

302. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

303. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

304. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

305. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

306. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

307. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

308. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

309. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

310. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

311. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

312. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

313. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

314. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

315. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

316. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

317. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

318. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH479918 (Mycobacterium phage Labeouficaum, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

319. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

320. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

321. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279850 (Mycobacterium phage Durga, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

322. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

323. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN585965 (Mycobacterium phage Duggie, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

324. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

325. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

326. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

327. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH479916 (Mycobacterium phage GeneCoco, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

328. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

329. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KY385383 (Mycobacterium phage Maskar, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

330. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

331. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

332. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

333. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

334. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

335. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

336. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN369744 (Mycobacterium phage Beaglebox, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

337. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

338. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

339. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

340. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT889369 (Mycobacterium phage Inchworm, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcgtgggatcgatct	Protospacer
 .******.*******.********.  *

341. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

342. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919519 (Mycobacterium phage Longacauda, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

343. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

344. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

345. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

346. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

347. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KX576647 (Mycobacterium phage CharlieGBrown, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

348. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN369738 (Mycobacterium phage Hocus, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

349. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

350. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

351. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

352. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

353. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

354. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK279858 (Mycobacterium phage JakeO, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

355. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

356. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

357. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

358. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

359. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

360. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

361. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

362. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

363. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

364. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

365. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JN192463 (Mycobacterium phage Oline, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

366. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

367. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

368. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

369. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

370. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

371. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

372. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

373. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

374. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

375. spacer 1.2|1380630|29|NZ_CP009474|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 7, identity: 0.759

tctggccaaccacggcatgggatcggagt	CRISPR spacer
gttggccagccacggcttgggatcgatct	Protospacer
 .******.******* ********.  *

376. spacer 1.3|1380677|28|NZ_CP009474|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.714

tccgatcgaccgccgcggggccagagta	CRISPR spacer
gatgatcgaccgcagcggggccagtccg	Protospacer
  .********** **********  ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

371524 : 382482

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196461.1\|371524_373825_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1
WP_004194131.1\|373821_374136_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|374668_374872_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_038726952.1\|375001_376612_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_009929279.1\|376624_376807_+	hypothetical protein	NA	NA	NA	NA
WP_004189552.1\|376779_378039_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189780.1\|378306_378885_+	pseudouridine synthase	NA	NA	NA	NA
WP_071810810.1\|379147_379366_+	hypothetical protein	NA	NA	NA	NA
WP_004185496.1\|379557_380067_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_004197486.1\|380367_382482_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7

DBSCAN-SWA_2

978059 : 1012486

uncultured_virus(28.57%)

holin,transposase,integrase

attL 999395:999412|attR 1003948:1003965

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045603987.1\|978059_979310_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.0e-40	41.2
WP_038745120.1\|980260_981784_-	hypothetical protein	NA	NA	NA	NA
WP_111994465.1\|982388_982661_+\|transposase	transposase	NA	NA	NA	NA
WP_004548470.1\|982774_983371_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	6.0e-27	38.1
WP_045604881.1\|983411_984974_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.1e-147	52.9
WP_004543818.1\|985003_985351_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.6e-40	72.9
WP_045604882.1\|986068_987184_-	5-methylcytosine-specific restriction endonuclease system specificity protein McrC	NA	NA	NA	NA
WP_100086167.1\|987186_989022_-	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	5.8e-28	33.8
WP_045605745.1\|989092_989809_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_045603987.1\|992808_994059_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.0e-40	41.2
WP_129558650.1\|994025_994256_-	hypothetical protein	NA	NA	NA	NA
WP_129558651.1\|994265_995519_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_038761640.1\|995509_997912_-	N-6 DNA methylase	A0A2H4PQP4	Staphylococcus_phage	9.4e-71	37.2
WP_129558652.1\|997983_998235_+	hypothetical protein	NA	NA	NA	NA
WP_038761641.1\|998895_999090_-	hypothetical protein	NA	NA	NA	NA
WP_038753789.1\|999290_1000109_-	hypothetical protein	NA	NA	NA	NA
999395:999412	attL	NA	NA	NA	NA
WP_038731794.1\|1000105_1001389_-\|integrase	integrase family protein	NA	NA	NA	NA
WP_012730490.1\|1001668_1002565_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_045604887.1\|1003519_1006363_+	DUF1929 domain-containing protein	NA	NA	NA	NA
1003948:1003965	attR	NA	NA	NA	NA
WP_004550328.1\|1006375_1006984_+	SCO family protein	NA	NA	NA	NA
WP_038796116.1\|1007347_1008181_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_004522986.1\|1008177_1008480_-	AzlD family protein	NA	NA	NA	NA
WP_004522987.1\|1008476_1009205_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_004522988.1\|1009329_1009788_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_038735715.1\|1010025_1010322_+	hypothetical protein	NA	NA	NA	NA
WP_004522990.1\|1010368_1012486_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA

DBSCAN-SWA_3

1435704 : 1446925

Burkholderia_virus(22.22%)

integrase

attL 1433117:1433134|attR 1449710:1449727

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1433117:1433134	attL	NA	NA	NA	NA
WP_004524472.1\|1435704_1437792_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	1.9e-99	35.8
WP_004202928.1\|1438104_1439004_-	c-type cytochrome	NA	NA	NA	NA
WP_076804979.1\|1439835_1440015_-	hypothetical protein	NA	NA	NA	NA
WP_004538613.1\|1440186_1440774_+\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	1.4e-44	50.6
WP_009922658.1\|1441153_1441471_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.2e-15	57.0
WP_004530410.1\|1441470_1442388_+	DUF4935 domain-containing protein	A4PE40	Ralstonia_virus	4.0e-46	40.6
WP_076982045.1\|1442641_1443184_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.3e-49	56.9
WP_045605758.1\|1443441_1443894_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.3e-31	58.8
WP_004525722.1\|1443893_1444973_+	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	2.2e-160	99.0
WP_011852337.1\|1445129_1445402_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	2.4e-47	98.9
WP_038776406.1\|1446280_1446925_+	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	4.4e-07	30.4
1449710:1449727	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1631342 : 1689449

uncultured_Mediterranean_phage(22.22%)

transposase,plate,protease,integrase

attL 1671800:1671838|attR 1679404:1679442

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196743.1\|1631342_1632056_+\|transposase	transposase	NA	NA	NA	NA
WP_004196742.1\|1632345_1637049_+	glutamate synthase subunit alpha	NA	NA	NA	NA
WP_045605033.1\|1637142_1638609_+	glutamate synthase subunit beta	NA	NA	NA	NA
WP_045605035.1\|1638889_1640401_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_004201288.1\|1640397_1640958_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_017881315.1\|1641184_1642951_-	ABC transporter ATP-binding protein/permease	NA	NA	NA	NA
WP_004521927.1\|1643553_1644687_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004199938.1\|1644735_1644933_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_004199935.1\|1644985_1645801_+	thiazole synthase	NA	NA	NA	NA
WP_080295143.1\|1645797_1646901_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_004199931.1\|1647000_1647819_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-20	29.4
WP_004199929.1\|1647815_1648583_+	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
WP_015878475.1\|1648595_1649147_+	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_038729332.1\|1649194_1650154_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_004199924.1\|1650268_1650901_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004199923.1\|1650897_1651167_+	STAS domain-containing protein	NA	NA	NA	NA
WP_004521934.1\|1651462_1652389_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-21	29.7
WP_004199919.1\|1652385_1653141_+	ABC transporter permease	NA	NA	NA	NA
WP_004199917.1\|1653226_1653466_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_004527889.1\|1653479_1654829_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_004199915.1\|1654825_1655482_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_004185201.1\|1655523_1656861_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_004521936.1\|1657016_1658087_+	histidinol-phosphate transaminase	A0A1X7BZP2	Faustovirus	5.6e-15	26.9
WP_004199911.1\|1658150_1658738_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_004199909.1\|1658793_1659414_+	YchE family NAAT transporter	NA	NA	NA	NA
WP_004199907.1\|1659410_1660052_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_004199906.1\|1660219_1660975_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_004550994.1\|1661057_1661831_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_004201279.1\|1661830_1662244_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_004202813.1\|1662240_1662609_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
WP_004202812.1\|1662661_1663051_+	hypothetical protein	NA	NA	NA	NA
WP_004185206.1\|1663079_1663445_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_004199902.1\|1663533_1663767_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_004531855.1\|1663793_1664321_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_004199900.1\|1664359_1665142_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	8.7e-26	29.7
WP_004521939.1\|1665471_1666680_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	8.5e-12	31.9
WP_045605037.1\|1666701_1667448_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_004204996.1\|1667668_1668289_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_004199894.1\|1668289_1669672_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_045605039.1\|1669694_1670453_+	cytochrome c1	NA	NA	NA	NA
WP_004185176.1\|1670545_1671157_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_004554066.1\|1671226_1671748_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
1671800:1671838	attL	NA	NA	NA	NA
WP_042269630.1\|1672413_1673418_+	AAA family ATPase	Q677Q6	Lymphocystis_disease_virus	2.6e-14	31.7
WP_082257097.1\|1673474_1675772_+	S8 family peptidase	NA	NA	NA	NA
WP_082257098.1\|1675701_1676079_-\|integrase	tyrosine-type recombinase/integrase	A5X9F3	Aeromonas_virus	4.8e-22	71.0
WP_004535005.1\|1677319_1678390_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_045605051.1\|1678396_1679197_-	hypothetical protein	NA	NA	NA	NA
WP_004539222.1\|1679632_1679971_+	DUF4102 domain-containing protein	Q8W6M6	Sinorhizobium_phage	2.4e-17	49.0
1679404:1679442	attR	NA	NA	NA	NA
WP_038776434.1\|1680455_1681241_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004555444.1\|1681237_1682584_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004521950.1\|1682692_1683307_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004531875.1\|1683681_1684353_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004521952.1\|1684389_1684908_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004521953.1\|1684924_1686415_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004527837.1\|1686487_1686991_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004204912.1\|1687048_1687531_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004527836.1\|1687610_1689449_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_5

2016351 : 2025596

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194034.1\|2016351_2018304_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004522147.1\|2018570_2019701_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.6
WP_004538732.1\|2019734_2021741_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	8.2e-52	34.5
WP_004194137.1\|2021924_2022740_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004532195.1\|2022804_2023488_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_004194373.1\|2023484_2024012_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_014917872.1\|2024048_2025596_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2

DBSCAN-SWA_6

2402735 : 2411598

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522358.1\|2402735_2404136_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-79	38.5
WP_009921652.1\|2404167_2405091_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.1
WP_045605222.1\|2405149_2406142_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.5e-27	30.6
WP_004189725.1\|2406213_2406531_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_004550116.1\|2406889_2407792_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.3e-53	39.9
WP_038740565.1\|2408018_2409314_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004188957.1\|2409492_2410416_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_004522363.1\|2410755_2411598_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	1.0e-16	26.6

DBSCAN-SWA_7

2960832 : 2968953

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004535518.1\|2960832_2961096_+	hypothetical protein	Q8W6S4	Burkholderia_virus	5.0e-26	85.5
WP_071897863.1\|2961079_2961265_+	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2
WP_038725515.1\|2961285_2962011_-	immunity 52 family protein	A4PE26	Ralstonia_virus	1.3e-31	43.5
WP_082257142.1\|2962017_2962620_-	hypothetical protein	NA	NA	NA	NA
WP_045605357.1\|2962961_2963468_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	8.7e-19	39.4
WP_038754499.1\|2963464_2963890_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.8e-15	49.4
WP_004557051.1\|2964170_2964566_-	hypothetical protein	NA	NA	NA	NA
WP_082257143.1\|2964816_2965044_+	hypothetical protein	Q8W6S4	Burkholderia_virus	2.7e-20	75.4
WP_011851785.1\|2965085_2965319_-	immunity 52 family protein	A4PE26	Ralstonia_virus	2.1e-12	59.1
WP_011851784.1\|2965394_2965856_-	avidin	NA	NA	NA	NA
WP_004193710.1\|2966722_2966905_+	hypothetical protein	NA	NA	NA	NA
WP_009980362.1\|2967031_2967655_-	phospholipase D family protein	NA	NA	NA	NA
WP_045605358.1\|2967849_2968953_-	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	7.0e-37	31.6

DBSCAN-SWA_8

3712604 : 3780221

Klosneuvirus(12.5%)

coat,transposase,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045605573.1\|3712604_3715229_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-80	39.2
WP_004204969.1\|3715834_3717055_+	CoA transferase	NA	NA	NA	NA
WP_004196731.1\|3717382_3717622_-	hypothetical protein	NA	NA	NA	NA
WP_045605576.1\|3717871_3719581_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	5.1e-188	57.5
WP_004545254.1\|3719966_3720449_-	NUDIX hydrolase	A0A0G2SS60	Proteus_phage	1.5e-20	42.0
WP_004193860.1\|3720467_3720854_-	hypothetical protein	NA	NA	NA	NA
WP_045605579.1\|3721141_3723241_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_004545120.1\|3723342_3724203_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_004546013.1\|3724246_3725662_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_004193177.1\|3725895_3727479_+	acid phosphatase	NA	NA	NA	NA
WP_038753017.1\|3727676_3728870_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_045605863.1\|3729493_3730681_+	HlyD family secretion protein	NA	NA	NA	NA
WP_004521735.1\|3730862_3732482_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_045605582.1\|3732483_3734190_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004192810.1\|3734493_3735126_-	response regulator transcription factor	NA	NA	NA	NA
WP_045605585.1\|3735126_3737208_-	response regulator	A0A1V0SGR3	Hokovirus	2.3e-12	26.3
WP_045605588.1\|3737618_3738584_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_045605591.1\|3738599_3741011_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_038734572.1\|3741055_3741895_-	molecular chaperone	NA	NA	NA	NA
WP_038738223.1\|3741912_3742437_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|3742513_3743074_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004526781.1\|3743126_3743672_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004531175.1\|3743932_3744154_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|3744491_3745385_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045605594.1\|3745828_3747088_+	MFS transporter	NA	NA	NA	NA
WP_009966447.1\|3747132_3748116_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004193855.1\|3748583_3748865_+	H-NS histone family protein	NA	NA	NA	NA
WP_004538232.1\|3749027_3750248_-\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	4.6e-239	99.5
WP_038724310.1\|3750431_3750704_-	hypothetical protein	NA	NA	NA	NA
WP_004556892.1\|3751336_3751630_-	hypothetical protein	NA	NA	NA	NA
WP_024430190.1\|3753124_3753391_-	DUF1153 domain-containing protein	NA	NA	NA	NA
WP_080301094.1\|3753673_3754120_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_038769106.1\|3754401_3754662_-	hypothetical protein	NA	NA	NA	NA
WP_045605597.1\|3754876_3755044_+	hypothetical protein	A0A0P0ZBS5	Stx2-converting_phage	1.2e-06	63.4
WP_080295868.1\|3755614_3756307_-	hypothetical protein	NA	NA	NA	NA
WP_045605600.1\|3756336_3759360_-	hypothetical protein	NA	NA	NA	NA
WP_045605602.1\|3759362_3760379_-	hypothetical protein	NA	NA	NA	NA
WP_045605605.1\|3760382_3763217_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.4e-20	25.7
WP_004552903.1\|3763229_3763535_-	hypothetical protein	NA	NA	NA	NA
WP_045605608.1\|3763552_3763795_-	hypothetical protein	NA	NA	NA	NA
WP_076856888.1\|3764027_3764567_-	hypothetical protein	NA	NA	NA	NA
WP_004521767.1\|3764883_3765375_-	lipoprotein	NA	NA	NA	NA
WP_045605613.1\|3765352_3768688_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_045605615.1\|3768796_3771205_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_009930792.1\|3771201_3771795_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_038723414.1\|3771791_3772349_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_004535790.1\|3772485_3773319_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_045605618.1\|3773321_3776120_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.3e-27	24.7
WP_076848326.1\|3776153_3776381_+	hypothetical protein	NA	NA	NA	NA
WP_004193592.1\|3776640_3776907_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_045605621.1\|3776930_3778346_+	hypothetical protein	NA	NA	NA	NA
WP_045605623.1\|3778370_3780221_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009473

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009474

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection