CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009707	Burkholderia mallei strain 2002734306 chromosome I, complete sequence	0 crisprs	cas3,WYL,DEDDh,csa3,DinG	0	0	7	0
NZ_CP009708	Burkholderia mallei strain 2002734306 chromosome II, complete sequence	1 crisprs	csa3,DinG,cas3	1	2	3	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

348102 : 399204

Streptococcus_phage(21.43%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004187628.1\|348102_349323_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	7.8e-239	99.5
WP_004194773.1\|349404_349773_-	c-type cytochrome	NA	NA	NA	NA
WP_004185759.1\|349813_350173_-	cytochrome c	NA	NA	NA	NA
WP_004186676.1\|350406_351249_+	MoxR family ATPase	NA	NA	NA	NA
WP_004186167.1\|351461_352637_+	VWA domain-containing protein	NA	NA	NA	NA
WP_004186095.1\|352720_353938_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_004186409.1\|354339_355293_+	transaldolase	A0A0E3F5V4	Synechococcus_phage	4.3e-11	29.6
WP_004522474.1\|355658_356093_+	VOC family protein	NA	NA	NA	NA
WP_024900823.1\|356218_357787_-	sodium:solute symporter	NA	NA	NA	NA
WP_004194775.1\|357783_358023_-	DUF3311 domain-containing protein	NA	NA	NA	NA
WP_004185796.1\|359394_359871_-	DNA-deoxyinosine glycosylase	NA	NA	NA	NA
WP_004194778.1\|359870_360473_-	chorismate lyase	NA	NA	NA	NA
WP_004185742.1\|360472_362371_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	3.0e-120	38.5
WP_004185957.1\|362506_363961_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_004186239.1\|364111_364795_+	VOC family protein	NA	NA	NA	NA
WP_004186089.1\|364895_365804_+	DMT family transporter	NA	NA	NA	NA
WP_004194779.1\|365864_367046_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_123809469.1\|367114_368234_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_071810810.1\|368368_368587_+	hypothetical protein	NA	NA	NA	NA
WP_004185496.1\|368784_369294_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_004197486.1\|369594_371709_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7
WP_045598180.1\|372881_374330_+	hypothetical protein	NA	NA	NA	NA
WP_004186341.1\|374874_375720_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.4e-23	29.9
WP_004185897.1\|375888_376635_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_004534266.1\|377350_378703_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004522619.1\|378675_379011_-	DUF2917 domain-containing protein	NA	NA	NA	NA
WP_004185818.1\|379307_380747_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_162473466.1\|381062_381350_-	hypothetical protein	NA	NA	NA	NA
WP_004200476.1\|381333_382608_+	EAL domain-containing protein	NA	NA	NA	NA
WP_004185918.1\|382739_383345_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004186428.1\|383868_384891_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_004185585.1\|384906_385434_-	DUF962 domain-containing protein	NA	NA	NA	NA
WP_004185910.1\|385518_386274_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_045598012.1\|386507_387713_+	chromate efflux transporter	NA	NA	NA	NA
WP_038802950.1\|387801_388922_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004191998.1\|389180_390644_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004185841.1\|390804_391383_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.1e-44	44.7
WP_004197496.1\|391579_392962_-	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	6.1e-30	27.5
WP_004200482.1\|392956_393187_+	hypothetical protein	NA	NA	NA	NA
WP_004555967.1\|393419_394448_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_004196455.1\|394428_394635_+	Trm112 family protein	NA	NA	NA	NA
WP_004185994.1\|394808_395600_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_004185840.1\|395808_396471_+	adenylate kinase	NA	NA	NA	NA
WP_004191998.1\|396586_398050_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004196460.1\|398153_398357_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_004194131.1\|398889_399204_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6

DBSCAN-SWA_2

726544 : 786238

Burkholderia_phage(13.33%)

tRNA,protease,portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189409.1\|726544_727402_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_004189288.1\|727511_728147_-	LysE family translocator	NA	NA	NA	NA
WP_004200737.1\|728267_729251_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.3e-07	38.0
WP_004201745.1\|729282_729786_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	2.7e-12	34.3
WP_004190020.1\|730014_731205_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.0e-21	39.2
WP_004190199.1\|731264_731636_+	thioredoxin family protein	NA	NA	NA	NA
WP_004200734.1\|731846_734456_+	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	7.7e-18	25.7
WP_004189230.1\|734677_735733_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004188904.1\|736182_737199_+	D-2-hydroxyacid dehydrogenase family protein	NA	NA	NA	NA
WP_004189208.1\|737319_738189_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_004200732.1\|738226_738631_-	PaaI family thioesterase	NA	NA	NA	NA
WP_004187628.1\|739021_740242_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	7.8e-239	99.5
WP_009918009.1\|740704_740959_+	hypothetical protein	NA	NA	NA	NA
WP_123809469.1\|741228_742348_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_004200731.1\|742400_742883_+	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_004188977.1\|742879_743164_+	hypothetical protein	NA	NA	NA	NA
WP_004200730.1\|743236_744328_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	2.0e-193	92.3
WP_004200729.1\|744726_745137_+	hypothetical protein	NA	NA	NA	NA
WP_004189258.1\|745273_746149_-	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	9.6e-74	47.3
WP_004190014.1\|746159_747272_-	histone deacetylase	A0A2K9KZC4	Tupanvirus	3.2e-37	30.8
WP_004201742.1\|747300_748395_-	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004189434.1\|748537_749506_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004189874.1\|749608_750178_+	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_004189689.1\|750770_751319_+	hypothetical protein	NA	NA	NA	NA
WP_004189592.1\|751582_753031_+	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	4.9e-30	33.5
WP_004200727.1\|753049_754663_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_004200726.1\|754822_755764_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004190110.1\|755760_756855_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	3.8e-19	37.4
WP_004197761.1\|757256_757673_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_004197759.1\|757850_758405_-	YaeQ family protein	NA	NA	NA	NA
WP_004524604.1\|758620_758968_-	hypothetical protein	NA	NA	NA	NA
WP_004524603.1\|759453_760014_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_004524586.1\|761434_762838_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_004198812.1\|763175_763595_+	transcriptional regulator	NA	NA	NA	NA
WP_004198813.1\|763751_765428_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_004198815.1\|765436_765706_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.1e-16	53.6
WP_038799830.1\|765785_766253_-	ribonuclease P protein component	NA	NA	NA	NA
WP_004198824.1\|766269_766404_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_076805040.1\|766696_768451_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_004196275.1\|768613_769717_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.7e-46	34.0
WP_004196276.1\|769905_772374_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.3e-114	34.4
WP_004185300.1\|772899_773163_+\|transposase	transposase	NA	NA	NA	NA
WP_024900530.1\|774066_774381_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_045598034.1\|774650_780170_-	hypothetical protein	NA	NA	NA	NA
WP_004526088.1\|780747_784014_-	hypothetical protein	NA	NA	NA	NA
WP_004526091.1\|784608_784935_+	hypothetical protein	NA	NA	NA	NA
WP_004187628.1\|785017_786238_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	7.8e-239	99.5

DBSCAN-SWA_3

1500255 : 1507714

Burkholderia_phage(33.33%)

terminase,plate,protease,portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199890.1\|1500255_1500777_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
WP_004199888.1\|1500998_1501496_+\|terminase	terminase	K4NXI4	Burkholderia_phage	2.6e-55	100.0
WP_004199886.1\|1501492_1502548_+\|portal	phage portal protein	K4NZV0	Burkholderia_phage	5.7e-206	99.4
WP_004202809.1\|1502591_1502948_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_004199884.1\|1502950_1503247_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	2.8e-49	98.0
WP_123809469.1\|1504054_1505174_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_004204912.1\|1505313_1505796_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004202808.1\|1505875_1507714_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_4

1875324 : 1884561

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194034.1\|1875324_1877277_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004194374.1\|1877543_1878674_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	2.9e-22	27.6
WP_004194350.1\|1878707_1880714_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	9.7e-53	35.0
WP_004194137.1\|1880889_1881705_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004194274.1\|1881769_1882453_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.6e-05	26.0
WP_004194373.1\|1882449_1882977_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_024900817.1\|1883013_1884561_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2

DBSCAN-SWA_5

2208380 : 2217228

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189214.1\|2208380_2209781_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.1e-78	38.3
WP_004200795.1\|2209749_2210736_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	8.8e-15	26.5
WP_004190173.1\|2210794_2211787_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004189725.1\|2211858_2212176_+	competence protein ComE	NA	NA	NA	NA
WP_004532363.1\|2212499_2213402_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.9e-53	39.9
WP_045598116.1\|2213627_2214941_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004188957.1\|2215119_2216043_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_004190087.1\|2216385_2217228_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	7.2e-18	27.2

DBSCAN-SWA_6

2452166 : 2519667

Leptospira_phage(16.67%)

tRNA,protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011203868.1\|2452166_2454344_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	1.2e-51	28.7
WP_004192130.1\|2454826_2455474_-	OmpA family protein	NA	NA	NA	NA
WP_004193796.1\|2455855_2456944_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_004191507.1\|2457076_2457616_+	superoxide dismutase family protein	NA	NA	NA	NA
WP_004192666.1\|2457719_2458289_+	dCTP deaminase	S5VM63	Pseudomonas_phage	1.3e-71	70.6
WP_024900677.1\|2458391_2460671_+	arginine/lysine/ornithine decarboxylase	NA	NA	NA	NA
WP_004205947.1\|2460673_2461396_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_004193337.1\|2461529_2462204_-	HAD family phosphatase	NA	NA	NA	NA
WP_004191886.1\|2462236_2463646_-	argininosuccinate lyase	NA	NA	NA	NA
WP_004543968.1\|2463814_2466115_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_004191842.1\|2466818_2467529_-	molecular chaperone	NA	NA	NA	NA
WP_045598130.1\|2467536_2468055_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_004193822.1\|2468428_2469439_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_004192784.1\|2469611_2470427_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004522539.1\|2470609_2471365_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_041283509.1\|2471782_2473246_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	6.8e-80	38.6
WP_004191560.1\|2473391_2476376_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_004199404.1\|2476488_2476668_+	hypothetical protein	NA	NA	NA	NA
WP_004193185.1\|2476702_2477692_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_004193146.1\|2477691_2479671_+	fused uroporphyrinogen-III synthase HemD/membrane protein HemX	NA	NA	NA	NA
WP_004193604.1\|2479675_2480866_+	heme biosynthesis protein HemY	NA	NA	NA	NA
WP_004192161.1\|2481046_2482354_-	MFS transporter	NA	NA	NA	NA
WP_004192728.1\|2482392_2483151_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_004193515.1\|2483239_2484679_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_004192356.1\|2484839_2485367_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.0e-51	53.8
WP_045598133.1\|2485425_2486295_-	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	2.0e-07	43.1
WP_011807749.1\|2486273_2486663_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024900822.1\|2487294_2488473_-	N-acetyltransferase	NA	NA	NA	NA
WP_004198600.1\|2488593_2490294_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	5.8e-91	36.8
WP_004193987.1\|2490354_2490693_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_004191758.1\|2491149_2492238_-	porin	NA	NA	NA	NA
WP_004553879.1\|2493132_2493912_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	40.0
WP_004193161.1\|2493934_2494648_-	ABC transporter permease	NA	NA	NA	NA
WP_004522525.1\|2494644_2495334_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_004198602.1\|2495544_2496321_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004192043.1\|2497748_2498294_-	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_024900821.1\|2498535_2499234_+	response regulator	W8CYM9	Bacillus_phage	6.4e-28	36.2
WP_004193003.1\|2499217_2500531_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_004198606.1\|2500604_2500871_-	hypothetical protein	NA	NA	NA	NA
WP_004192556.1\|2501367_2503125_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_004192968.1\|2503178_2504519_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-32	37.7
WP_123809469.1\|2504983_2506104_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_045598140.1\|2506003_2506534_-	hypothetical protein	NA	NA	NA	NA
WP_004200093.1\|2506822_2507020_+	hypothetical protein	NA	NA	NA	NA
WP_004192381.1\|2507154_2508573_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_004191763.1\|2508565_2509168_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	2.6e-25	62.8
WP_004191641.1\|2509340_2509952_-	membrane protein	NA	NA	NA	NA
WP_045598142.1\|2510691_2512065_-	MFS transporter	NA	NA	NA	NA
WP_004266384.1\|2512188_2512701_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_004192184.1\|2513275_2513656_-	DUF5594 family protein	NA	NA	NA	NA
WP_004193391.1\|2513813_2514083_+	hypothetical protein	NA	NA	NA	NA
WP_004192840.1\|2514689_2515070_-	lipoprotein	NA	NA	NA	NA
WP_004522511.1\|2515242_2515782_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_004193210.1\|2515879_2517016_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_004200110.1\|2517280_2517505_-	hypothetical protein	NA	NA	NA	NA
WP_045598144.1\|2517961_2518438_+	hypothetical protein	NA	NA	NA	NA
WP_144408684.1\|2518547_2519667_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.6e-47	38.7

DBSCAN-SWA_7

3469101 : 3546634

Klosneuvirus(20.0%)

tRNA,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191922.1\|3469101_3471969_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.8e-146	39.3
WP_004192544.1\|3472055_3472937_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.9e-69	47.9
WP_004526815.1\|3472997_3473615_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_004191850.1\|3473703_3476097_-	CHASE2 domain-containing protein	NA	NA	NA	NA
WP_004192128.1\|3476107_3477472_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_004193573.1\|3477468_3478173_-	response regulator transcription factor	NA	NA	NA	NA
WP_004192096.1\|3478500_3478887_-	hypothetical protein	NA	NA	NA	NA
WP_004193727.1\|3479162_3479393_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_004192573.1\|3479557_3480595_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_004193713.1\|3480607_3481627_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_004191536.1\|3481619_3482501_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_004192875.1\|3482745_3483795_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004192697.1\|3483895_3485041_+	ABC transporter permease	NA	NA	NA	NA
WP_024900516.1\|3485053_3485854_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-13	28.4
WP_004191266.1\|3485867_3487868_+	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_004196072.1\|3487878_3489864_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_004192432.1\|3489860_3490781_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_004196071.1\|3490780_3491584_+	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_004193939.1\|3491700_3492405_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_045596944.1\|3492401_3494687_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FFL6	Cedratvirus	2.4e-07	26.2
WP_004191272.1\|3494679_3495615_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_004193685.1\|3495619_3496069_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_004196068.1\|3495969_3496314_-	hypothetical protein	NA	NA	NA	NA
WP_024900518.1\|3496310_3497459_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_004193399.1\|3497674_3498010_+	YbjQ family protein	NA	NA	NA	NA
WP_004193543.1\|3498109_3498661_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_004196065.1\|3498952_3499630_+	hypothetical protein	NA	NA	NA	NA
WP_123809469.1\|3502335_3503456_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_011807697.1\|3503486_3504203_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_004192193.1\|3504349_3505315_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024900630.1\|3505835_3508460_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.5e-80	39.2
WP_004204969.1\|3509136_3510357_+	CoA transferase	NA	NA	NA	NA
WP_004534928.1\|3510680_3510890_-	hypothetical protein	NA	NA	NA	NA
WP_004193654.1\|3511169_3512879_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	8.8e-188	57.5
WP_004192426.1\|3513210_3513693_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	3.7e-19	41.3
WP_004193860.1\|3513711_3514098_-	hypothetical protein	NA	NA	NA	NA
WP_004196725.1\|3516399_3516579_+	hypothetical protein	NA	NA	NA	NA
WP_004192265.1\|3516575_3517436_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_004191662.1\|3517479_3518895_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_004193177.1\|3519128_3520712_+	acid phosphatase	NA	NA	NA	NA
WP_024900629.1\|3520909_3522103_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_024900628.1\|3522721_3523909_+	HlyD family secretion protein	NA	NA	NA	NA
WP_004192651.1\|3524081_3525701_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004192810.1\|3527690_3528323_-	response regulator transcription factor	NA	NA	NA	NA
WP_004552891.1\|3528323_3530405_-	response regulator	A0A1V0SGR3	Hokovirus	1.7e-12	26.8
WP_004196717.1\|3530815_3531781_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004526784.1\|3534253_3535093_-	molecular chaperone	NA	NA	NA	NA
WP_004526783.1\|3535110_3535635_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|3535711_3536272_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_024900625.1\|3536324_3536870_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004542449.1\|3536856_3537042_-	hypothetical protein	NA	NA	NA	NA
WP_004531175.1\|3537127_3537349_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|3537686_3538580_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004538381.1\|3538996_3540283_+	MFS transporter	NA	NA	NA	NA
WP_004192394.1\|3540327_3541320_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004193855.1\|3541787_3542069_+	H-NS histone family protein	NA	NA	NA	NA
WP_004191144.1\|3542321_3542591_-	hypothetical protein	NA	NA	NA	NA
WP_024900624.1\|3543485_3544799_-	divalent metal cation transporter	NA	NA	NA	NA
WP_038802950.1\|3545513_3546634_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009708

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009708_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009708_1

180755-180940

Orphan

Consensus_repeat	Method
TTCGGTTCGGCGTTCGGT	CRT

4 spacers

The CRISPR arrays of NZ_CP009708_1

>merge|NZ_CP009708|1|180755-180940|CRT
TTCGGTTCGGTGTTCGGTTCGGTGTTCGGTCCAGCGTTCGGTCCGGCGTTCGGTTCGGCGTTCGGTCCGGCGTTCGGTTCGGCGTTCGGTTCGGCGTTCGGTCCGGCGTTCGGTCCGGCGTTCGGTCCGGCGTTCGGTTCGGCGTTCGGTTCGGTGTTCGGTTCGGCGTTCGGTTCGGCGTTCGCG

>NZ_CP009708|1|1|180755-180940|CRT
TTCGGTTCGGTGTTCGGT	TCGGTGTTCGGTCCAGCGTTCGGTCCGGCG
TTCGGTTCGGCGTTCGGT	CCGGCGTTCGGTTCGGCG
TTCGGTTCGGCGTTCGGT	CCGGCGTTCGGTCCGGCGTTCGGTCCGGCG
TTCGGTTCGGCGTTCGGT	TCGGTGTTCGGTTCGGCG
TTCGGTTCGGCGTTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009708.1\|WP_011832036.1\|186619_187117_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009708.1\|WP_004200917.1\|167785_168694_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378680
NZ_CP009708.1\|WP_004266332.1\|189012_189663_+\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|379309
NZ_CP009708.1\|WP_004200909.1\|186278_186626_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367272
NZ_CP009708.1\|WP_004200921.1\|164618_165326_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|149273
NZ_CP009708.1\|WP_004200916.1\|171806_172277_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|372719
NZ_CP009708.1\|WP_004266688.1\|174474_180642_+\|alpha-2-macroglobulin	unknown	unknown	gnl\|CDD\|225248
NZ_CP009708.1\|WP_004523925.1\|183494_184106_-\|chemotaxis-protein-CheC	unknown	unknown	gnl\|CDD\|381738
NZ_CP009708.1\|WP_004548368.1\|184477_185893_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|236901
NZ_CP009708.1\|WP_004200918.1\|166175_167789_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009708.1\|WP_004200901.1\|191585_191975_-\|DUF488-family-protein	unknown	unknown	gnl\|CDD\|225730
NZ_CP009708.1\|WP_004200913.1\|173966_174212_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009708.1\|WP_009968084.1\|187518_188901_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009708.1\|WP_024900650.1\|189827_190442_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP009708.1\|WP_004266338.1\|165289_166183_-\|TauD/TfdA-family-dioxygenase	unknown	unknown	gnl\|CDD\|367137
NZ_CP009708.1\|WP_004205282.1\|184098_184467_-\|response-regulator	unknown	unknown	gnl\|CDD\|381124
NZ_CP009708.1\|WP_004266331.1\|190501_190780_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009708.1\|WP_004206548.1\|163449_164607_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223594
NZ_CP009708.1\|WP_004206552.1\|168690_169611_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226607
NZ_CP009708.1\|WP_004200915.1\|172416_172992_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009708.1\|WP_004200917.1\|167785_168694_-\|hypothetical-protein	gnl\|CDD\|378680	pfam11583, AurF, P-aminobenzoate N-oxygenase AurF. This family is a metalloenzyme which is involved in the biosynthesis of antibiotic aureothin by catalyzing the formation of p-nitrobenzoic acid from p-aminobenzoic acid. AurF is a non-heme di-iron monooxygenase which creates nitroarenes via the sequential oxidation of aminoarenes.	2.36308e-20
NZ_CP009708.1\|WP_004200909.1\|186278_186626_+\|hypothetical-protein	gnl\|CDD\|367272	pfam02956, TT_ORF1, TT viral orf 1. TT virus (TTV), isolated initially from a Japanese patient with hepatitis of unknown aetiology, has since been found to infect both healthy and diseased individuals and numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF1 is a large 750 residue protein. The N-terminal half of this protein corresponds to the capsid protein.	0.000148666
NZ_CP009708.1\|WP_004200921.1\|164618_165326_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|149273	pfam08123, DOT1, Histone methylation protein DOT1. The DOT1 domain regulates gene expression by methylating histone H3. H3 methylation by DOT1 has been shown to be required for the DNA damage checkpoint in yeast.	0.000157593
NZ_CP009708.1\|WP_004200916.1\|171806_172277_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|372719	pfam13772, AIG2_2, AIG2-like family. This family is found in bacteria and metazoa.	6.52138e-20
NZ_CP009708.1\|WP_004266688.1\|174474_180642_+\|alpha-2-macroglobulin	gnl\|CDD\|225248	COG2373, COG2373, Large extracellular alpha-helical protein [General function prediction only].	9.72351e-90
NZ_CP009708.1\|WP_004523925.1\|183494_184106_-\|chemotaxis-protein-CheC	gnl\|CDD\|381738	cd17910, CheC_ClassII, chemotaxis protein CheC, Class II. This family contains class II CheC proteins found in proteobacteria, which diverge from class I CheCs in sequence conservation and lack critical well-conserved residues for CheD binding. These proteins are likely to be dedicated phosphatases. The class II cheC genes are not found in chemotaxis operons, but in operons containing more archetypical two-component signaling components, non-signaling operons, or as orphans. Thus, class II CheCs appear to be involved in non-chemotactic two component systems. Class II CheCs lack the first of the two phosphatase active sites of class I CheCs, and retain the second active site of class I CheCs.	1.01722e-51
NZ_CP009708.1\|WP_004548368.1\|184477_185893_-\|PAS-domain-containing-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	1.43034e-51
NZ_CP009708.1\|WP_004206548.1\|163449_164607_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223594	COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones].	5.02425e-59
NZ_CP009708.1\|WP_004200901.1\|191585_191975_-\|DUF488-family-protein	gnl\|CDD\|225730	COG3189, COG3189, Uncharacterized conserved protein [Function unknown].	1.5364e-34
NZ_CP009708.1\|WP_004266332.1\|189012_189663_+\|2OG-Fe(II)-oxygenase	gnl\|CDD\|379309	pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.	3.78342e-12
NZ_CP009708.1\|WP_024900650.1\|189827_190442_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	6.26335e-22
NZ_CP009708.1\|WP_004266338.1\|165289_166183_-\|TauD/TfdA-family-dioxygenase	gnl\|CDD\|367137	pfam02668, TauD, Taurine catabolism dioxygenase TauD, TfdA family. This family consists of taurine catabolism dioxygenases of the TauD, TfdA family. TauD from E. coli is a alpha-ketoglutarate-dependent taurine dioxygenase. This enzyme catalyzes the oxygenolytic release of sulfite from taurine. TfdA from Burkholderia sp. is a 2,4-dichlorophenoxyacetic acid/alpha-ketoglutarate dioxygenase. TfdA from Alcaligenes eutrophus JMP134 is a 2,4-dichlorophenoxyacetate monooxygenase. Also included are gamma-Butyrobetaine hydroxylase enzymes EC:1.14.11.1.	2.23041e-70
NZ_CP009708.1\|WP_004205282.1\|184098_184467_-\|response-regulator	gnl\|CDD\|381124	cd17593, REC_CheC-like, phosphoacceptor receiver (REC) domain of uncharacterized response regulators containing a CheC domain. This subfamily is composed of uncharacterized proteins containing an N-terminal REC domain and a C-terminal CheC domain that may function as the output/effector domain of a response regulator. CheC is a CheY-P phosphatase, affecting the level of phosphorylated CheY which controls the sense of flagella rotation and determine swimming behavior of chemotactic bacteria. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.70523e-55
NZ_CP009708.1\|WP_004206552.1\|168690_169611_-\|hypothetical-protein	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	9.46306e-13

>NZ_CP009708.1|WP_004266688.1|174474_180642_+|alpha-2-macroglobulin
MKHDDKHNKPGHPNPSILRLLARIGAAAALGAAAALSLHADAARTVNVSPQGTVAEVRQAVVKFDEAMVAFGSASAPAPARLACADPAAARGHGRWLDEKTWAYDFENDLPPGVRCTVALNDTLRSAAGHAVTGPRRFAFQTGGPFPVAVRPGAREIEERQVFVVKLNGPADERSALASIWCEAAGIGNRIPVAPADAPTRAALLDHFHWKKDAARVLTLACAQALPAGAKMQLVYGRGVASPSGIANDTERRYDFTVRAPFAASFSCERENAKAPCTPLRPLTLSFNAPVARRAAGEIRLRGPHGAVEPFFKPDDRAEEVTSVQFAAPLPAQAALTIELPPALRDVTGRTLSNADLFPLATRTAPMPPLAKFSSGTFGIVERFAEPDSPALVPVTLRNVEADLRIAGLNAGGAQFSNLKVENDSEIRRWMQLVERFDGRAMSVESIDKLRPGLLARGQHPVYVPLAAGERAPKPQHRQIDIRSLSLLAGEPGVRTLTLPKADPKALRPFEIVGLPIDKPGFHVLELASPALGRSLLAKPAKMYVRTAVLVTNLGVHLKLGRENSVVWVTTLDKGKPVPNAQVRVSDCNGDEIAAGRTNAQGLVTIDAPLEPKRACDSSNGDGDYFVSARVDDPKTGPDMAFVRSSWNRGIESWRFNVPTDMSDTPTVRAHTVFDRTLVRAGETVSMKHFVREETLRGLAFPPRYPSRATIRHLGSGQTYRVPLAWAADHTADTRFALPAAAKLGEYSVELEDGPEDAPSASYYGGSFRVEAFRLPVFKGSIGVRDAKASPLVSAKDAPLAVQIDYVSGGGASNLPVQVSALVKRAEPPFAERYPDFGFEPYRPQTQDATADDEDTQDGENASRDTDPDATKLIADKIALTLDRTGSGALTLKGLPAVDAPKRVALEATFADPNGEVQTIRGDAMLWPAAVVAGIQAGHWVSVGQRVPVQALVVDLQGRPRASAAVEIKGVARVTTSSRKRMVGGFYAYDNQSDTRELGVLCSGKTDAQGRLACDATLSQAGNVQLIAVAKDGDGRASNASTSVWVTREDDLWFGGENTDRIDVIPEKASYEPGDTARFQVRMPFRHATALVAVERGGVMQTRVVELNGKNPTVDLKVGDTWGPNVYVSVLALRGRLRDVPWYSFFTWGWKAPLEWARAFWREGRRYEAPSALVDLSKPAFRYGLGEIKVGTGAHRLGVAVTTDAARYPVRGTAHARVKVTLPDGKPAPAGTQIALAAVDEALLELMPNRSWDLLDAMLQRRAYGVETATAQMEIVGRRHFGRKAVPAGGGGGMAPTRELFDTLLLWNPRVTLDANGSASVDVPLNDALTRFRIVAIAATGAERFGTGSATIRSTQDLQLISGLPPLVREGDAFRAQVTVRNTTERKMDVVVTPRVPGIDAAPRKISLAPDSAQEIAWDVTVPETALDAAGALDWRIEAAEQGGKRAADALALAQKVVPALPVTVQQATLAQVDGTLSVPVAPPAGAMPNARGAPRGGIAVSLQSTLADGLPGVRRWFERYPYRCLEQQASRAIGLRDAAQWQALAARMPVYLDRDGLASYFPPSSDDAHSGSPPLSAYLLVLADEASRADARFALPEDVRTQLEAGLARFVEGRIERDAWAPRQDRDLRKLAAIEALSRYGAAQGRMLGSIEIAPNQWPTSAVLDYHAILTRVKDIARRDEKRAQAEQILRARLTYQGTQLVFSTARGDDLWWLMTSNETNAARLALAFAGEAGWKDEMPRVAAGLLALQKNGAWQTTTANALGLLALERFSRTYERAPVAGATKIALGGDTRSIAWSQPAGAGGATVATGATGAAATAGAALASGASASASAAAKPAATQSRTPPPSSGTPPPSAATRAAAAHSVTLPWPRGARTPGTLSIVHEGSGRPWATIESLAAVPVRAPFAAGYRIAKTVTPVSPAVSGALTRGDVLRVRLDIDAQSDMTWVVVNDPIPAGATILGSGLGRDSEAATQGEKSPDGAWPAFVERDFDGYRAYYDYLPKGKLTVEYTVRVNNVGTFGLPPTRVEALYAPSVYGLWPNPPMTVRPAVASKP
>NZ_CP009708.1|WP_004200913.1|173966_174212_-|hypothetical-protein
MPNDAHGTRALARNRRAGIATRNAKHFYTGAYAACRPLCIASTISANGHPVNGTVFSACHFQVKIKAGDRQNQLAAIAEFV
>NZ_CP009708.1|WP_004200915.1|172416_172992_-|hypothetical-protein
MDTTTQDGNRPPFDAPRGGRGDGDKNDDTRLPDCNERARRRAGVAAKRTRRALNGAASRTGLDAECRVRPKNARRRTSVSKATRAVHWRARRRAIVPIHAAQPKGGRGGARASAHPPMRPMRTRAQIPRADREPGLSGLSGSSGASGASGASGVANFDPIFFFYHRLRSHGSPQQASPTQARRTKRDRAAA
>NZ_CP009708.1|WP_004200916.1|171806_172277_-|gamma-glutamylcyclotransferase
MSQVCYFAYGSNMSAARLSERLSRFGEALIERWPGIVDGYRLTFNKVSSRQDWVGFANIEAAADCRVEGTLNAMSARALDALDSIELVPLHYRRAGVLVRDGATGRLTLAVTYVANPAMVRPNLRPTRDYLDHLLAAADVLPRAYLDHVRAVECWT
>NZ_CP009708.1|WP_004206552.1|168690_169611_-|hypothetical-protein
MTTVTFSGPIFDLVDGVLRDAPEYRGFRAGAQSRAEFAAFLERVRTQLVGRGVPANDVHFAKRFPVSIDAAVEHAFAELAPMGLAWPAGFPAVCARAAARIGRGFDHQGLGTYIYPEEGRLLLAIALAFRPRNAVFLGSYYGYWAAWALPAIVAGGARAVLVDPDPRVAEVARRSLARLYPGARVEIVCDTGEHYLARGGGPFDLVVLDAELPRDHVDPTRRGKGVYAHLLRAALPRLAERSLLVCHNILFRDHSGCAFFDDVIARNREELAPFLALVAREYDCFVECPTTEGVGVGMRTAPRGRA
>NZ_CP009708.1|WP_004200917.1|167785_168694_-|hypothetical-protein
MIMDAYRSPFDDWHQAASVRSMPADAWLAGGAGAWIAPQAGGVLAGLPARDARRERAAGGLLIAHLSFTVALENTLISPVARDIAARALHADYDDGVVADALRVQCDEAYHALLAQELMTRVRAATGADKPRRTPGFLRHVERLAATLPGVDAPLLRFCAAVVAETLITHTLRDDWRDEGLQPDVRTFLRRHYLDEARHSAYFSRLLTLLWPQWPAGVRDALRPLWSGLIDAFLFADARIAAEALAAAGLTACEIDRAMSACGAPDAMQRRRAQSARQTLHALRAAGALEAGESAAIALGNA
>NZ_CP009708.1|WP_004200918.1|166175_167789_-|hypothetical-protein
MSAAGIRAFPGFAFGGGDRALAFVGGGLILDSGEAENTFAFRCQDRFLVYTGLLGLPSVLLVLDDAHSRHYARLLATLDERLQGLAAVHRVAAPRLPPPVDVRCDLRTLSLSASASFDRAAHALARDGARIGFVANQVAPSTARMLGELADLLRGRGVEVDFDRAACERVAALAHAWHNKARFLAFMREAAIRGGPPLAPSAVLAPEAFLRMREWAELAARFAAECDRRAPSSGLFLKSSQDSSGNVSAILSSANFAERAPAFAAEVRRWLLADGFDDPAHVRELRKECEQPPSMEPVPLSDATLAELRRRQARRRTGLPLIVQPALQPPADACGSPASVGASFCIEDDGRHRVVAVAAQLYRDAQRRRFLGLHVDDGLLDDRRVREWVARCGALVDALAARGYRGPVNFDGCMGADGRYWFVGDCNPRLTAVYVPLAVRTWLRAAGIDVRSVSSFGYRGEFATPAIRACVDTWSRAGLIFSRERPRGFVVLPNLACRDGHDVLAINLGVAQATAGLARMRELVAGAVPAHLGAIHV
>NZ_CP009708.1|WP_004266338.1|165289_166183_-|TauD/TfdA-family-dioxygenase
MSDGPALGIRPLSAALGARIDGIDARAELDADTVRAIRAAWLRFGLLVFRGQALDPPRLVAFTRRFGEPVVYTRACNACDGQPEVLVLSNVVKDGKPIGAALSGRYWHTDGHYLACPPAGTLLFGAEIPAVGGDTHFVNMTAAYRALPAWVRTQIDGRTFVMDRVQTLPFHYPQRPAPPPDQKQAWPDMPQPVVRTHPETGENALYIGGVVPWRIVGMEQRLSDALMAHLHAIAFDEARFGYRHRWRAGDLLMWDNRCLAHRATDYDMVRHRRTMYRTTIAGDRPRYVRGAAQPGVS
>NZ_CP009708.1|WP_004200921.1|164618_165326_+|class-I-SAM-dependent-methyltransferase
MLENPVGNLAAEARRLASAWRRGGPGLAARVALDRLCDAALEWRLRIRSGGLVPIESLVAEWHGCHDYYPSSIRAFSRVLRDLHVTPDDVFVDYGSGMGRAIVIAARFPFRALIGVETSDRLHRAAQANVGRALPDADRRRIRLLHCDARRFRLPGSASVLYFYNPFHGDILRAVFADIERSLRQHPRRLRIVFNNPAHFRAIERDYGWLRRSREYAFEYPIAVYETPGCAAPRT
>NZ_CP009708.1|WP_004206548.1|163449_164607_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MTAPLKSLFLLDPSVTYLNHGAYGATPRPVFERHVQWQYELEREPVDFLSRRFAERMAQARAILAEYVDTERDNLVYVSNGTTGVNIVARSLPLGPGDELLTTDHEHGGIERLWRFTAQKRGFEIVRHKVSLPVTTHARFVEDFWRDVTPRTRAILISQLTSPTALVFPVAAICARARARGILTIVDGSHVPGQLPLSLREMDPDFYVGILHKWVCAPKGSAFLYARPDVQPLVEPLVVSWGWEPKNPGPSKFVEYHEWQGSRDISAFLSVPSAIAFQREHDWDGVRKRCIALASDAQREVAALTREPLYHPPGAHEWHGQMVCAQLPPQTDDIALLARLRNECGIDVSVDRFGGRPRIRVSIQGYNGPDDVDRLLGSLKQLLRL
>NZ_CP009708.1|WP_004523925.1|183494_184106_-|chemotaxis-protein-CheC
MNDIALTEEHRDALQEISNIGMGRAGAALAKLLGAFVTLSVPDIKLVSARELLDELQRCERRADMPRPVRQSFQSDICGEALVLFGSDGRRELKELMGYDDATDDIEDEALSDIASLLVGACVHSVFEQLDRRLTFLRPTFVPPGSLASALGDERLGRWDVALLLEVHFTLEHGGFVAKLVMLLPDAAIHKMKAALEQFLDAL
>NZ_CP009708.1|WP_004205282.1|184098_184467_-|response-regulator
MALPVLVVDDSTLARKLLIKSLPSDWDVEITQASNGAEALSHYRAGKGAVIFLDLTMPVMDGFQVLEHIREEGLDAFVIVVSADIQEGAVDRVKASGAIGFVAKPVSTERIVPILKGYGLYE
>NZ_CP009708.1|WP_004548368.1|184477_185893_-|PAS-domain-containing-protein
MSESTVMQMSAAIVEQLNCGVFSVDHDMRILAWNGFMQYHTGRSRDDAIGQDLFALFPELPARWLRKKLESVFVLGVAMYTSWEHRPYLFRFDHSRPITGTIDAMRQNCSFVPLDDGRGGVAAVGVTIVDATDICIAHEVLGNREKRLTDALAELTARHAELSDLNRQLAHAHQQLLQSEKLAAIGQLAAGIAHEINNPVGFVLSNVNTLGGYLGALIAHAHAVERLVAERQPQLAPALAELARGADLDYLCEDAPALVDESKEGLARVRKIVVDLRDFSRVDSVHQWEWVDIHHCIESTLNIVRNEVKYAADLVREYASLPMVRCIPSQVNQVVLNLVVNAAQSYSSMRADGGHGDVPRGTITIRTGVDAGDCPRIWFEVIDAGCGIAPENLKRIFDPFFTTKPVGKGTGLGLSVAYGIVSAHGGEIAVSSAFGAGTTFRVTLPVERTGEPQPEAAAVSHSTPVASGIAS
>NZ_CP009708.1|WP_004200909.1|186278_186626_+|hypothetical-protein
MPIASGAPFHPCGIGAIAAPAVTVLNEYERPFRPASRLTRPGPAPRRACRRARRAAERRAARRRALRRRAAADAAAPAAPFHYSRIEAAAVRRATATTESHGDGANPPGIAAARY
>NZ_CP009708.1|WP_011832036.1|186619_187117_-|hypothetical-protein
MQKGINMKRSRSRFRASFAVAVALGVPSGFAHAQSLPGIPDPAAVGLTPGTGQNGAPTVSACFYNYRTKVIAGFPTQIASGWIVTNQRNDPACIPPGGLPGPNWQEMTYFRDMPVGASMSACWSFSWPSNWQPIGYTSDPSKCGYYPGGQIPGAQPNVVFLKRVQ
>NZ_CP009708.1|WP_009968084.1|187518_188901_+|hypothetical-protein
MAIHHRPSISGDISKQHSIDQATMFESFNKDVVDAFARNKRRLTKNAASRQVRALLDEVGASAFKLLPHPFLFPADEFEMLARRARALLRAQNKIVRHLCRHRPRADLLAQCSLNPALARYVDWDELEAGRRRVARVDILPLPDGYAVCELNFSAAVGGAELFDCHRRFMQASGWPAFERGGSPYANLRALYEDTLRSMEIDRIVLLDWSSHAARGYATPELARRYLAGIANGMPVDVHTELTYPSKWLGNGRGKGILIHRNFVYDDVTVNADRFDAIHRSGATFSNGLEAELLMSKAWLALLCDARFHPLLDEDEIAAIRNHVPHTFRLDEGTFAEALAHKDEWVFKLNVSYGGVDVLIGKDHPADALADRLRRQGIANWICQAFRAVQTIRHPFDDTFVAAEHKPVLGMYLHRDDASGMALRSNRFSSVVNAGSGAGVHWAAVVTEAEKAALLAAMDG
>NZ_CP009708.1|WP_004266332.1|189012_189663_+|2OG-Fe(II)-oxygenase
METAELHFRCNESGMADYAAQLREVGTVMLPAYVAFDAHELARIDALQARLPEEPVTAGDAGDTHDIYVRRIMVDRAGERPQLVNLPHSKTILNLLGDARRTRFFGDMFGTRAEYFIRRCQINRMLKDSFIGMHLDAASNPDYEFSVVIQLGRAFDGGEFVVHPQGRPPNVFAPAYGTVIVTSCAHRHEVRTVRANERTSLVYFYSRHNGANRRAA
>NZ_CP009708.1|WP_024900650.1|189827_190442_-|GNAT-family-N-acetyltransferase
MQQQVDGGADSLAPVIETARLILSGPRLEDFDGSRALWADPDVTRLIRDEPFTSEECWLRLLRYVGHWRLLGFGYWMAREKDTGRFIGEVGFADAKRDIVPPLDDAPELGGALAPAAWGQGIAREALHAVLEWADANLTARRTVCLIGPKNRFSMRLAAEFGYREVAVAEYKGEPIRVFERPAAGPRAGEARPPADAAERGGRA
>NZ_CP009708.1|WP_004266331.1|190501_190780_-|hypothetical-protein
MRGACALAASDVSAAYAVPAFASRFLSAWHGLQRREGAFQSLHIASRRFIPRCIAIAGARGRSFPAVRRDRPPPCATPGRALAGSRGIAVES
>NZ_CP009708.1|WP_004200901.1|191585_191975_-|DUF488-family-protein
MSISIVRLGTPRADDEGVRIGTVRRPPRGVPKDEFASRDFYDVWLPTLSPSPELVAEAQAAQSDADWKAFARKFRAEMKHGDASRMLDVLAALSATSNFAIGCYCENEAHCHRSVLRELLEERGASIRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009708_1	1.2\|180821\|18\|NZ_CP009708\|CRT	180821-180838	18	NZ_CP009708.1	1583860-1583877	0	1.0

1. spacer 1.2|180821|18|NZ_CP009708|CRT matches to position: 1583860-1583877, mismatch: 0, identity: 1.0

ccggcgttcggttcggcg	CRISPR spacer
ccggcgttcggttcggcg	Protospacer
******************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MT498057	Microbacterium phage Cicada, complete genome	30806-30835	5	0.833
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MK016497	Microbacterium phage Johann, complete genome	30576-30605	5	0.833
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MN369765	Microbacterium phage Zanella, complete genome	30488-30517	5	0.833
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MK016495	Microbacterium phage Goodman, complete genome	30576-30605	5	0.833
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	238389-238418	6	0.8
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NZ_CP015205	Rhodococcus sp. 008 plasmid pR8C2, complete sequence	23031-23060	6	0.8
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NZ_CP025960	Rhodococcus qingshengii strain djl-6-2 plasmid pDJL1, complete sequence	64951-64980	6	0.8
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	373514-373543	6	0.8
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NC_007491	Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence	105088-105117	6	0.8
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	308613-308642	6	0.8
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	290721-290750	7	0.767
NZ_CP009708_1	1.1\|180773\|30\|NZ_CP009708\|CRT	180773-180802	30	NZ_CP012899	Burkholderia sp. CCGE1001 plasmid pCCGE1001a, complete sequence	62154-62183	7	0.767
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	101384-101413	7	0.767
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MK433264	Gordonia phage Tiamoceli, complete genome	55721-55750	7	0.767
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MT952843	Gordonia phage Twonlo, complete genome	56422-56451	7	0.767
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	MK977704	Gordonia Terrae phage RoadKill, complete genome	55831-55860	7	0.767
NZ_CP009708_1	1.3\|180857\|30\|NZ_CP009708\|CRT	180857-180886	30	KR053200	Gordonia phage GTE6, complete genome	56938-56967	7	0.767

1. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MT498057 (Microbacterium phage Cicada, complete genome) position: , mismatch: 5, identity: 0.833

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
gtggcgtacggtccggcggtcggtccggcc	Protospacer
 .***** ********** **********

2. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MK016497 (Microbacterium phage Johann, complete genome) position: , mismatch: 5, identity: 0.833

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
gtggcgtacggtccggcggtcggtccggcc	Protospacer
 .***** ********** **********

3. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MN369765 (Microbacterium phage Zanella, complete genome) position: , mismatch: 5, identity: 0.833

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
gtggcgtacggtccggcggtcggtccggcc	Protospacer
 .***** ********** **********

4. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MK016495 (Microbacterium phage Goodman, complete genome) position: , mismatch: 5, identity: 0.833

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
gtggcgtacggtccggcggtcggtccggcc	Protospacer
 .***** ********** **********

5. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 6, identity: 0.8

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
ggggtgatcgggccagcgttcggtccagtg	Protospacer
  **** **** **************.*.*

6. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NZ_CP015205 (Rhodococcus sp. 008 plasmid pR8C2, complete sequence) position: , mismatch: 6, identity: 0.8

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
ggggtgatcgggccagcgttcggtccagtg	Protospacer
  **** **** **************.*.*

7. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NZ_CP025960 (Rhodococcus qingshengii strain djl-6-2 plasmid pDJL1, complete sequence) position: , mismatch: 6, identity: 0.8

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
ggggtgatcgggccagcgttcggtccagtg	Protospacer
  **** **** **************.*.*

8. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 6, identity: 0.8

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
ggggtgatcgggccagcgttcggtccagtg	Protospacer
  **** **** **************.*.*

9. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NC_007491 (Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence) position: , mismatch: 6, identity: 0.8

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
ggggtgatcgggccagcgttcggtccagtg	Protospacer
  **** **** **************.*.*

10. spacer 1.3|180857|30|NZ_CP009708|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.8

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
gaagcgttcgatccggcgttcggcccggtg	Protospacer
  .*******.************.****.*

11. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 7, identity: 0.767

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
ggggtggtcgggccagcgttcggtccaatg	Protospacer
  **** **** **************...*

12. spacer 1.1|180773|30|NZ_CP009708|CRT matches to NZ_CP012899 (Burkholderia sp. CCGE1001 plasmid pCCGE1001a, complete sequence) position: , mismatch: 7, identity: 0.767

tcggtgttcggtccagcgttcggtccggcg	CRISPR spacer
acaccggtcggtccagcgttcggtacgtcg	Protospacer
 *. .* ***************** ** **

13. spacer 1.3|180857|30|NZ_CP009708|CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
gcgaggcgcggtccggcgtgcggtccggca	Protospacer
 **. *. *********** *********.

14. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MK433264 (Gordonia phage Tiamoceli, complete genome) position: , mismatch: 7, identity: 0.767

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
ccggcgttcggttcggccttcggcatcggg	Protospacer
************.**** *****. . * *

15. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MT952843 (Gordonia phage Twonlo, complete genome) position: , mismatch: 7, identity: 0.767

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
ccggcgttcggttcggccttcggcatcggg	Protospacer
************.**** *****. . * *

16. spacer 1.3|180857|30|NZ_CP009708|CRT matches to MK977704 (Gordonia Terrae phage RoadKill, complete genome) position: , mismatch: 7, identity: 0.767

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
ccggcgttcggttcggccttcggcatcggg	Protospacer
************.**** *****. . * *

17. spacer 1.3|180857|30|NZ_CP009708|CRT matches to KR053200 (Gordonia phage GTE6, complete genome) position: , mismatch: 7, identity: 0.767

ccggcgttcggtccggcgttcggtccggcg	CRISPR spacer
ccggcgttcggttcggccttcggcatcggg	Protospacer
************.**** *****. . * *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

324302 : 398419

Moumouvirus(20.0%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004187303.1\|324302_325388_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004187986.1\|325387_327277_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004187068.1\|327307_327889_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004187921.1\|327875_328841_-	ImpE/SciE family protein	NA	NA	NA	NA
WP_004188539.1\|328837_329584_-	TagK domain-containing protein	NA	NA	NA	NA
WP_024900492.1\|333048_333624_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004188012.1\|333658_335158_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004188308.1\|335274_335760_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004187276.1\|335866_336370_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004188743.1\|336391_337738_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004188530.1\|337826_339092_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_004188288.1\|343215_343446_+	hypothetical protein	NA	NA	NA	NA
WP_038799466.1\|344031_345378_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004187006.1\|345620_346547_-	catecholic dioxygenase	NA	NA	NA	NA
WP_004187502.1\|346601_347573_-	quinone oxidoreductase	A0A2P1ELD9	Moumouvirus	6.6e-07	25.2
WP_024900490.1\|347601_349470_-	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SHV8	Klosneuvirus	4.2e-18	22.9
WP_004187705.1\|349515_351000_-	Pyoverdin chromophore biosynthetic protein pvcC	NA	NA	NA	NA
WP_004188574.1\|351025_351925_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_004554725.1\|351921_352980_-	L-tyrosine/L-tryptophan isonitrile synthase family protein	NA	NA	NA	NA
WP_157047211.1\|352978_353356_+	hypothetical protein	NA	NA	NA	NA
WP_024900489.1\|353581_356542_-	glycoside hydrolase family 92 protein	NA	NA	NA	NA
WP_004196252.1\|356753_358670_-	hypothetical protein	NA	NA	NA	NA
WP_014919714.1\|359111_359477_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_004202300.1\|359616_359901_-	hypothetical protein	NA	NA	NA	NA
WP_004188660.1\|359920_360661_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_004188170.1\|361205_362138_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004196258.1\|362290_363538_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_004554722.1\|363701_364601_+	glutamate/aspartate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004196262.1\|365206_365647_-	hypothetical protein	NA	NA	NA	NA
WP_004188358.1\|365795_366092_-	hypothetical protein	NA	NA	NA	NA
WP_004201242.1\|366148_367189_-	fatty acid desaturase	NA	NA	NA	NA
WP_004188790.1\|367482_368319_+	PhnD/SsuA/transferrin family substrate-binding protein	NA	NA	NA	NA
WP_004187366.1\|368660_369563_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004187422.1\|369742_370933_+	amidohydrolase	NA	NA	NA	NA
WP_024900487.1\|372320_372950_+	porin	NA	NA	NA	NA
WP_004203996.1\|373143_374541_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.1e-50	31.4
WP_038802950.1\|375632_376753_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_162473622.1\|376818_377622_-	hypothetical protein	NA	NA	NA	NA
WP_004188578.1\|379008_379758_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_004188783.1\|380001_380907_+	CoA ester lyase	NA	NA	NA	NA
WP_004187664.1\|381222_382302_+	porin	NA	NA	NA	NA
WP_004187771.1\|382343_383822_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_004188039.1\|383899_385027_-	OpgC domain-containing protein	NA	NA	NA	NA
WP_004188619.1\|385426_386320_-	EamA family transporter RarD	NA	NA	NA	NA
WP_004187760.1\|386316_386613_-	acylphosphatase	NA	NA	NA	NA
WP_004202312.1\|386773_387781_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_004188344.1\|388035_389490_+	hypothetical protein	NA	NA	NA	NA
WP_004188250.1\|389715_390900_-	glycosyltransferase	NA	NA	NA	NA
WP_004187484.1\|391293_392235_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_004187762.1\|392247_393408_+	adenosyl-hopene transferase HpnH	NA	NA	NA	NA
WP_004187860.1\|393752_394106_+	DOPA 4,5-dioxygenase family protein	NA	NA	NA	NA
WP_004200694.1\|394654_396013_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_004191998.1\|396955_398419_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6

DBSCAN-SWA_2

738482 : 803222

Leptospira_phage(18.18%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123809469.1\|738482_739603_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_004190252.1\|739819_740560_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_004537687.1\|740632_741307_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_004536572.1\|741766_742072_+	hypothetical protein	NA	NA	NA	NA
WP_004190962.1\|742287_743229_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004190523.1\|744799_745714_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004190791.1\|745895_746600_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_004205458.1\|747286_747604_-	chorismate lyase	NA	NA	NA	NA
WP_073699052.1\|747540_747786_-	chorismate lyase	NA	NA	NA	NA
WP_038796415.1\|747913_749149_-	flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_004190842.1\|749422_749608_-	hypothetical protein	NA	NA	NA	NA
WP_004203280.1\|749626_751525_+	DUF3857 and transglutaminase domain-containing protein	NA	NA	NA	NA
WP_024900788.1\|751567_753004_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_004190377.1\|753058_753460_-	TssQ family T6SS-associated lipoprotein	NA	NA	NA	NA
WP_004190712.1\|754099_754618_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004190585.1\|754614_756018_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004190689.1\|756033_757350_+	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_004190681.1\|757352_760982_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190273.1\|761888_762116_-	hypothetical protein	NA	NA	NA	NA
WP_004190797.1\|762114_764712_+	protein kinase	A7IVH4	Paramecium_bursaria_Chlorella_virus	1.0e-14	25.1
WP_004190988.1\|764764_765844_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004190671.1\|765906_766485_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190849.1\|766477_767986_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004190698.1\|768045_768537_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004196148.1\|768555_769116_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004190509.1\|769120_770992_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_024900789.1\|770988_772479_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004203276.1\|772457_775112_+	type VI secretion system ATPase TssH	A0A1S6UBG5	Serratia_phage	2.7e-79	30.9
WP_004203275.1\|775108_777313_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-46	29.9
WP_004196151.1\|777387_778041_+	hypothetical protein	NA	NA	NA	NA
WP_162473620.1\|777970_779047_+	RHS repeat protein	NA	NA	NA	NA
WP_011204340.1\|780853_781834_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004190776.1\|782350_783775_+	cytosine permease	NA	NA	NA	NA
WP_004190245.1\|783771_784710_+	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	1.4e-14	25.3
WP_004190461.1\|784672_785350_+	DUF938 domain-containing protein	NA	NA	NA	NA
WP_004190588.1\|785664_785808_-	hypothetical protein	NA	NA	NA	NA
WP_004190614.1\|785796_787212_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	2.1e-41	30.2
WP_011204342.1\|787410_787743_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_004190911.1\|788187_788499_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011204344.1\|788777_789542_+	peptidoglycan DD-metalloendopeptidase family protein	I2E8W3	Clostridium_phage	4.7e-08	38.7
WP_004190805.1\|789672_790308_-	hypothetical protein	NA	NA	NA	NA
WP_004190603.1\|790576_791113_+	cytochrome b	NA	NA	NA	NA
WP_004190837.1\|791273_791669_+	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_004190808.1\|791756_793994_+	TonB-dependent copper receptor	NA	NA	NA	NA
WP_004553588.1\|794317_795412_+	triacylglycerol lipase	NA	NA	NA	NA
WP_004190433.1\|795415_796450_+	lipase secretion chaperone	NA	NA	NA	NA
WP_004200631.1\|796551_798081_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.2e-12	25.9
WP_004190757.1\|798189_799290_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	6.3e-22	51.0
WP_004190781.1\|799364_800411_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004196172.1\|800511_801771_+	ABC transporter permease	Q6GZ02	Mycoplasma_phage	2.1e-05	22.6
WP_038802950.1\|802101_803222_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_3

1576572 : 1661821

Leptospira_phage(38.46%)

protease,transposase,integrase

attL 1625607:1625666|attR 1660595:1661147

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123809469.1\|1576572_1577692_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.1
WP_024900511.1\|1577895_1582707_-	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_004551771.1\|1583231_1583750_-	hypothetical protein	NA	NA	NA	NA
WP_004184606.1\|1584079_1584598_-	membrane protein	NA	NA	NA	NA
WP_004184536.1\|1585443_1587165_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_004201091.1\|1587361_1588678_-	TolC family protein	NA	NA	NA	NA
WP_004184640.1\|1589490_1589676_+	hypothetical protein	NA	NA	NA	NA
WP_004184575.1\|1589812_1591936_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.5e-27	24.9
WP_004184588.1\|1591932_1592955_+	hypothetical protein	NA	NA	NA	NA
WP_004528592.1\|1592967_1594263_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004202541.1\|1594276_1595773_+	OmpW family protein	NA	NA	NA	NA
WP_004524222.1\|1596173_1597100_+	polyphosphate kinase 2	NA	NA	NA	NA
WP_004537006.1\|1597186_1597444_-	hypothetical protein	NA	NA	NA	NA
WP_080747472.1\|1597854_1599462_+	threonine ammonia-lyase, biosynthetic	NA	NA	NA	NA
WP_004184552.1\|1599440_1600157_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004184355.1\|1600235_1601534_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_076841794.1\|1601709_1602153_+	metal transporter	NA	NA	NA	NA
WP_004528582.1\|1602256_1603327_-	DMT family transporter	NA	NA	NA	NA
WP_004536930.1\|1603462_1604053_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	5.8e-22	39.4
WP_160447106.1\|1604073_1604382_-	hypothetical protein	NA	NA	NA	NA
WP_004184214.1\|1604829_1605354_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_004197859.1\|1605383_1605614_-	hypothetical protein	NA	NA	NA	NA
WP_004197860.1\|1606021_1607782_+	fatty acyl-AMP ligase	A0A2K9KZV5	Tupanvirus	4.6e-06	21.9
WP_004184602.1\|1607778_1609539_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_004184547.1\|1609535_1611329_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_004184201.1\|1611339_1611630_+	acyl carrier protein	NA	NA	NA	NA
WP_024900541.1\|1612089_1612893_+	2OG-Fe dioxygenase family protein	NA	NA	NA	NA
WP_038802950.1\|1624990_1626110_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
1625607:1625666	attL	NA	NA	NA	NA
WP_004197866.1\|1626499_1626772_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_004184766.1\|1626920_1628315_-	heavy metal sensor histidine kinase IrlS	W8CYF6	Bacillus_phage	1.2e-20	28.9
WP_004197868.1\|1628311_1629001_-	heavy metal response regulator transcription factor IrlR	W8CYM9	Bacillus_phage	1.7e-36	36.8
WP_024900560.1\|1629007_1632241_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	5.2e-72	24.1
WP_004197872.1\|1632286_1633756_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004197873.1\|1633766_1635152_-	TolC family protein	NA	NA	NA	NA
WP_004197875.1\|1635387_1635672_-	hypothetical protein	NA	NA	NA	NA
WP_004524134.1\|1636069_1636210_-	bacteriophage protein	NA	NA	NA	NA
WP_038709382.1\|1636880_1637366_-	membrane protein	NA	NA	NA	NA
WP_004197880.1\|1637695_1638181_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_024900559.1\|1638448_1639939_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_004197883.1\|1640238_1640847_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_004199606.1\|1640978_1642979_-\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	1.1e-104	46.2
WP_004537230.1\|1643032_1643545_-	hypothetical protein	NA	NA	NA	NA
WP_011204480.1\|1644359_1646126_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004199157.1\|1646256_1646928_-	transcriptional regulator	NA	NA	NA	NA
WP_004184876.1\|1647078_1648176_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004199160.1\|1648172_1651274_+	MMPL family transporter	S5VTK5	Leptospira_phage	3.6e-46	22.0
WP_045598381.1\|1651408_1652947_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004202576.1\|1652961_1653258_+	hypothetical protein	NA	NA	NA	NA
WP_004199609.1\|1653303_1653921_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.9e-34	44.6
WP_004197695.1\|1653917_1655615_+	WD40 repeat domain-containing protein	NA	NA	NA	NA
WP_004197696.1\|1655611_1656292_+	1,6-didemethyltoxoflavin N1-methyltransferase	NA	NA	NA	NA
WP_024900397.1\|1656365_1658057_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	1.5e-06	24.7
WP_004197698.1\|1658153_1658600_-	hypothetical protein	NA	NA	NA	NA
WP_004199610.1\|1658970_1660128_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_038802950.1\|1660700_1661821_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
1660595:1661147	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP009708.1|WP_004202533.1|1573733_1574303_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP009708.1|WP_004197859.1|1605383_1605614_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP009708.1|WP_004202533.1|1573733_1574303_-|hypothetical-protein

1573733_1574303_-

189 aa aa

NZ_CP009708.1|WP_004197859.1|1605383_1605614_-|hypothetical-protein

1605383_1605614_-

76 aa aa

1576572-1661821

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP009708_1	Orphan	1.2\|180821\|18\|NZ_CP009708\|CRT	180821-180838	18	1583860-1583877	0

1. spacer 1.2|180821|18|NZ_CP009708|CRT matches to NZ_CP009708 position: 1583860-1583877, mismatch: 0

ccggcgttcggttcggcg	CRISPR spacer
ccggcgttcggttcggcg	Protospacer
******************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009707

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009708

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information