CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009794	Burkholderia dolosa AU0158 chromosome 3, complete sequence	1 crisprs	RT	0	0	1	0
NZ_CP009795	Burkholderia dolosa AU0158 chromosome 1, complete sequence	1 crisprs	DinG,DEDDh,csa3,cas3,WYL	2	2	223	1
NZ_CP009793	Burkholderia dolosa AU0158 chromosome 2, complete sequence	2 crisprs	csa3,DinG,cas3	3	6	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009794_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009794_1

598429-598526

Orphan

Consensus_repeat	Method
GAATCGAGATTGCTGTTCGTGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009794_1

>merge|NZ_CP009794|1|598429-598526|CRISPRCasFinder
GAATCGAGATTGCTGTTCGTGGTGGAAAGGCCGGTGCTCAGGCTCGATGCCGTCGTGCTCGTGGACGTGCTGAGCGAATCGAGGTTGCTGTTCGTGGT

>NZ_CP009794|1|1|598429-598526|CRISPRCasFinder
GAATCGAGATTGCTGTTCGTGGT	GGAAAGGCCGGTGCTCAGGCTCGATGCCGTCGTGCTCGTGGACGTGCTGAGC
GAATCGAGGTTGCTGTTCGTGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009794.1\|WP_123806781.1\|603191_603593_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009794.1\|WP_081293523.1\|609421_610534_-\|HoxN/HupN/NixA-family-nickel/cobalt-transporter	unknown	unknown	gnl\|CDD\|225911
NZ_CP009794.1\|WP_105773888.1\|586427_587291_-\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|379040
NZ_CP009794.1\|WP_123806782.1\|601845_602247_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009794.1\|WP_081293700.1\|591692_591878_-\|YadA-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377158
NZ_CP009794.1\|WP_006767198.1\|607586_608327_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187620
NZ_CP009794.1\|WP_174484782.1\|610606_611638_-\|DUF4331-family-protein	unknown	unknown	gnl\|CDD\|379511
NZ_CP009794.1\|WP_006767192.1\|588502_589606_-\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP009794.1\|WP_035975603.1\|602394_602661_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009794.1\|WP_006767199.1\|608470_609376_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187632
NZ_CP009794.1\|WP_035975607.1\|611903_613220_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340926
NZ_CP009794.1\|WP_052688637.1\|581300_582812_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173838
NZ_CP009794.1\|WP_035975605.1\|604653_607362_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|368333
NZ_CP009794.1\|WP_006767189.1\|584607_586431_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP009794.1\|WP_006767194.1\|590909_591608_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP009794.1\|WP_035975608.1\|613216_614536_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP009794.1\|WP_052688638.1\|582826_583150_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|315619
NZ_CP009794.1\|WP_045552351.1\|589602_590745_-\|DUF2827-family-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP009794.1\|WP_006767191.1\|587321_588467_-\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP009794.1\|WP_035975599.1\|583624_584611_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009794.1\|WP_081293523.1\|609421_610534_-\|HoxN/HupN/NixA-family-nickel/cobalt-transporter	gnl\|CDD\|225911	COG3376, HoxN, High-affinity nickel permease [Inorganic ion transport and metabolism].	2.36191e-118
NZ_CP009794.1\|WP_105773888.1\|586427_587291_-\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|379040	pfam13145, Rotamase_2, PPIC-type PPIASE domain.	8.3265e-11
NZ_CP009794.1\|WP_081293700.1\|591692_591878_-\|YadA-C-terminal-domain-containing-protein	gnl\|CDD\|377158	pfam03895, YadA_anchor, YadA-like membrane anchor domain. This region represents the C-terminal 120 amino acids of a family of surface-exposed bacterial proteins. YadA, an adhesin from Yersinia, was the first member of this family to be characterized. UspA2 from Moraxella was second. The Eib immunoglobulin-binding proteins from E. coli were third, followed by the DsrA proteins of Haemophilus ducreyi and others. These proteins are homologous at their C-terminal and have predicted signal sequences, but they diverge elsewhere. The C-terminal 9 amino acids, consisting of alternating hydrophobic amino acids ending in F or W, comprise a targeting motif for the outer membrane of the Gram negative cell envelope. This region is important for oligomerization.	8.57986e-08
NZ_CP009794.1\|WP_006767198.1\|607586_608327_-\|SDR-family-oxidoreductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.4684e-110
NZ_CP009794.1\|WP_174484782.1\|610606_611638_-\|DUF4331-family-protein	gnl\|CDD\|379511	pfam14224, DUF4331, Domain of unknown function (DUF4331). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 223 and 526 amino acids in length. There is a conserved FPY sequence motif.	1.1151e-18
NZ_CP009794.1\|WP_006767192.1\|588502_589606_-\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	0
NZ_CP009794.1\|WP_035975607.1\|611903_613220_-\|MFS-transporter	gnl\|CDD\|340926	cd17368, MFS_CitA, Citrate-proton symporter of the Major Facilitator Superfamily of transporters. Citrate-proton symporter, also called citrate carrier protein or citrate transporter or citrate utilization protein A (CitA), is a proton symporter that functions in the uptake of citrate across the boundary membrane. It allows the utilization of citrate as a sole source of carbon and energy. In Klebsiella pneumoniae, the gene encoding this protein is called citH, instead of citA, which is the case for Escherichia coli and other organisms. CitA belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.02578e-86
NZ_CP009794.1\|WP_006767199.1\|608470_609376_-\|SDR-family-oxidoreductase	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.38387e-83
NZ_CP009794.1\|WP_052688637.1\|581300_582812_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173838	cd00567, ACAD, Acyl-CoA dehydrogenase. Both mitochondrial acyl-CoA dehydrogenases (ACAD) and peroxisomal acyl-CoA oxidases (AXO) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. In contrast, AXO catalyzes a different oxidative half-reaction, in which the reduced FAD is reoxidized by molecular oxygen. The ACAD family includes the eukaryotic beta-oxidation enzymes, short (SCAD), medium (MCAD), long (LCAD) and very-long (VLCAD) chain acyl-CoA dehydrogenases. These enzymes all share high sequence similarity, but differ in their substrate specificities. The ACAD family also includes amino acid catabolism enzymes such as Isovaleryl-CoA dehydrogenase (IVD), short/branched chain acyl-CoA dehydrogenases(SBCAD), Isobutyryl-CoA dehydrogenase (IBDH), glutaryl-CoA deydrogenase (GCD) and Crotonobetainyl-CoA dehydrogenase. The mitochondrial ACAD's are generally homotetramers, except for VLCAD, which is a homodimer. Related enzymes include the SOS adaptive reponse proten aidB, Naphthocyclinone hydroxylase (NcnH), and and Dibenzothiophene (DBT) desulfurization enzyme C (DszC).	3.92145e-59
NZ_CP009794.1\|WP_035975605.1\|604653_607362_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|368333	pfam05199, GMC_oxred_C, GMC oxidoreductase. This domain found associated with pfam00732.	1.78612e-25
NZ_CP009794.1\|WP_006767189.1\|584607_586431_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	9.05733e-19
NZ_CP009794.1\|WP_006767194.1\|590909_591608_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	1.98722e-43
NZ_CP009794.1\|WP_035975608.1\|613216_614536_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.65493e-37
NZ_CP009794.1\|WP_052688638.1\|582826_583150_-\|cupin-domain-containing-protein	gnl\|CDD\|315619	pfam12973, Cupin_7, ChrR Cupin-like domain. Members of this family are part of the cupin superfamily. This family includes the transcriptional activator ChrR.	2.84526e-17
NZ_CP009794.1\|WP_045552351.1\|589602_590745_-\|DUF2827-family-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	2.96009e-146
NZ_CP009794.1\|WP_006767191.1\|587321_588467_-\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	3.50252e-172

>NZ_CP009794.1|WP_081293700.1|591692_591878_-|YadA-C-terminal-domain-containing-protein
MIPDVDQGKTLALGIGGASFQGYGATAIGFTARITNNLKVRAGVGISSGGQSYGVGASYQW
>NZ_CP009794.1|WP_006767194.1|590909_591608_-|OmpA-family-protein
MSAKSLFILWATALLAACSSSQGPTWNAYRVGLPNGQQAYRVDCHGLFEGQQTCFSQAAEICGKKQVQPLEQVAPLGDEQNPRDVRILTFQCAAPPQSAPAVVAKPAPAPAAAVAAPAPAKRITLDSDANFDTDRATLKPDARDRLDVLIDAARGTTFQTVAIAGYTDSTGTAEHNQRLSERRAQAVAQYLREHGLRAQKFDVRGYGESNPVATNTTAAGRAKNRRVDITLE
>NZ_CP009794.1|WP_045552351.1|589602_590745_-|DUF2827-family-protein
MKIGISVLTHTGQSIWENGLGQNIFYFLQLLRELPFVTDIVLLNCGDQRSLPPEAEALAGDVPLVAPRELAELPDVIFEMGGGLDVEWLDYARARGKKVVFFCCGQPYVGLIEPSVFQRDGYFSRATRCDEIWILGKDRALMPMLRTLHRCPVFEVPFLWDSTFIEQRIQAVEQAGLRFGYEPRSARGETGPRGLRFAVFEPNISVVKCCVIPMVVGEAAFRADTNAVRSLHVLNSAHMRDHPSFSFMLGSMDLNRHERVRIDGRHDFAGFMSQNADAVIAHQWQNDQNILYLDALYGGYPLIHNSPWLSNLGYYYADSDIEAGAVQLLRAVQHHDTDHKYYTQRARSFLMSLAPRANANCSVYARRLLALTAENAGVPA
>NZ_CP009794.1|WP_006767192.1|588502_589606_-|DUF2827-domain-containing-protein
MSKLKVGVTIYLRNGQQSIWENGIFQNCYFLTMLLKHAPNVEAAYLVNGGDGDPAAAAQFLEFAPVPVIDLDTARQTLDVVIELSAQLNPDWARAFCDKGGRVIGMRVANDYVIDIERMMFALPHGMLVSGTPYSAIWTLPAFEKTCAGYYETALRAPVTAMQHLWSPALVERAANGAFGYRPGRPRWRVAVLEPNICMVKTSHIPMLVADLAHRQQPDLIEYLRVFNTMQLKGDAQFVGFARSLDLVVQGRATFEPRLPVHEILTQQADAIVSHTWENAQNYVYYEALHGGYPLVHNSDLLGGCGYRYADFDCEDGALALREAFAVHDACVDDYRASARAFLATLDPLARANVEQYSAAIAAVVNG
>NZ_CP009794.1|WP_006767191.1|587321_588467_-|DUF2827-domain-containing-protein
MKFPCGLRIGITIGLRHADESLWVNGIKQNALYLAMLFQSSPLCHDVVLVNTTDVPVTFALPWDLERFPTCTFEDAKDTLDVLIELGGQISNEQTAYLKACDTKIVSYCCGPEYVQMTEAMIFGRRLTDHVFINQNYDQVWVIPQVMETTAGFLGVLRRQKVVPVPFVWHPMCVEMRTKHLPFAGEYRPGKTAARVSIMEPNIDVLKFCLNPLLIAESAYRQVGDKLGFVHVTNAEHLARDCPEFIGIAHYLDLVRDNKVSFVGRHDTPQFLAEHTDIVVSHQWGLALNYFYFDVAWNGYALVHNAHLCKDIGYYYAESDIEAGARQLVRAIEHHNDDWEAYRERQRAAIRPFLATHEPLVARYDELLGELLAARDVPVAA
>NZ_CP009794.1|WP_105773888.1|586427_587291_-|peptidyl-prolyl-cis-trans-isomerase
MQAVRTPRIMRGALLALAAAALHAPIALAAKPSIESADAGDVVATVNGVAVHRAELDEAMIGRQESMRPQVLQGLVARELLRQAAERDGLGNTEPVRAAMRKARIDTENRLYIARHVSTEPVTDTDVRRRYDEIAGQFGPYQYQVSRMTFTDEPTARFALALLGSGESFANVAARTHATDVQTDWISFKTPPAEGRTQGLPLPLAQTIAAMNAGDITHTPVRAGDRFIVARLDDRRDAVVPSFAQASGAMRNALERKRADDAFAALIAQLAQKAAIRPAQLMKDGSK
>NZ_CP009794.1|WP_006767189.1|584607_586431_-|tetratricopeptide-repeat-protein
MKWLADVETRITRSDLIGASRLLDTGRAIKSGKPRALVACGRLMTLRGRLGEAQDLFDRALDIEPDNVDALIERARLSIRVGDDADACTWFHRIGFRETHGDSWLIDWFDASLRCGRIEDAIAIATGLCRHFAADAGNWFRLGLAQQAARRHAQALDAYRHAASMNPRLPMLRNNWGAAYLELGRHDEARQLLEATLAEDPDHAFAWTNLASVLLKTGKIDDGLVAAERACALAPNYVTALQTYSYVLREHRQFDAALEVAQRALGIEPHNPSIVWTVAMLQLLLGDYENGWRNHEARWAGSPELRDVSPNLPAPRWNGEPLAGKTLFVWGEQGNGDALQFVRFVPAIADYVTRQGGKLVYCCFSSLHALFVRSLGTAVETIVAHDRRPLPAFDFHLPVGSLPLVLGVRLDELPSAPYLAADPAKVAASRAALADGRKLRVGITWSGSKTHQRNPLRSVDPMDYVRAFAGVGDMTFVNLQMDAERDVLRLQTAGLPLVDPTPELSSFDDTAALVGSLDLVITVCTSIAHLAGGLGIPTWVLLDANPHWIWMSERNDSPWYPNTRLYRQPAYGEWAPVFEALARDLAVLAFNRETQDQMTTNATGSLH
>NZ_CP009794.1|WP_035975599.1|583624_584611_-|hypothetical-protein
MKRINLPTALGACVDDVVREKIAHKVGLPASAIEQVFSRAGSIVVAALAVRASEGRDETIAVFGALMSRDINPRIRDECTTLVDSTGKLKELEHAGFTLVAHATGNDATELSDYVASEVGVPAQATCALTCICAAIVGGIVKHHVLIEQGDVSELPGLFAAQLPSISGHLNDGAIDVLGYLHADVNGFLDNVAVRLTSVAGEFEPPRPRVSERAEPAQRQPPQPQIPAHNRYEIGKVFVNDIRFTSAMQPSTFGPMKREQPRSRRTWKVFALTTTAVLIAVLASTKVYRWPDVRSALAQMTTSTTAQSRSDTLVSGVISPGAATTAGK
>NZ_CP009794.1|WP_052688638.1|582826_583150_-|cupin-domain-containing-protein
MVTPEMFDRAHIDDIEEFEAAPGIFVKMVHHTDEGVMVRVIRFAPGAVLPVEDIHDLGLEIVYVLDGTLTDNAGSYPAGSILYGKKGSSHIPASPEGCTVFSINFVD
>NZ_CP009794.1|WP_052688637.1|581300_582812_-|acyl-CoA-dehydrogenase-family-protein
MSADNIIQFLRWYAGERLNSRLIDEHRRPPASLPADLASGGLLGLRVGVDHGGQGLSARDTARVLEQLGAIDGNVSLLTTVHNAVGIDPILAFADQDTKDKVLPVLASTGALAGVAATEPEVGTNFQAMTSRAVRDGSGYVINGTKSMISLGAWAKYINLTVRLDDSLTTFLVPTGTPGWVPVSEALTVGMRAVPQNHIEMRNMRLDADAVLGGVGNGAAVATHAFQAGRWMLAAGIVGTMKRCLQLATRYVSRRTVATGPLLSNGRIEQILSDCVASVEAVDAVTRLIYDGLDEGRVVDPTYYTVCKIVSGELSWSVIDTCVQLMGWRGFLDSNPVTQNFRDYRVLRVFEGSTDGISGYLGRSVLKNPGKLHTLLTEDFPAADFLAPLWSALDEASASFPSLSPQRQHRLAAGTANAVAWAVTAAALRNEGGEVRAHTFEWAARSFSDAVHAMRRSHHENASVVASAKLSEHIGSYEDQIGDIEQTYGGEIHTLDPLLQRAL
>NZ_CP009794.1|WP_123806782.1|601845_602247_-|hypothetical-protein
MNRRRNDPAADLRSASRSFLSADGFVIGPASRRAGQFEEVTACRADGGDSMAPTGVVQRPTDIGGSIGTCQGQWNCSGVAAIREPPCDRSLASVGHAGIDLFSSEMLGKLSGDPGFCNAAVCSAYQNNHRIPG
>NZ_CP009794.1|WP_035975603.1|602394_602661_+|hypothetical-protein
MNKFQLKPRLSADESTPGNPMDFMVGAALVQSQAAKARPEKPIRLNLDITPSVHRLLKLYALENGMSVSEVVRTLIDQLVRPEHRQQR
>NZ_CP009794.1|WP_123806781.1|603191_603593_+|hypothetical-protein
MSTAKTQKLRNATAPAKRAKGSTSKASTANRDLFGHDGNTGSESAPATKRGRAEPATKRTTASRASTAQKPAKSAPRSVANTGSVRINFDLERVVHKRLKMLAVEADMTIADWMRQLIQKALEHIDKTERRGR
>NZ_CP009794.1|WP_035975605.1|604653_607362_+|NAD-dependent-epimerase/dehydratase-family-protein
MTHFIDFEADELSGDEWSASFDLIVVGGGAAGLTIIRELSGIGLKILLLESGDVEESAEHEALNDVDVDGSLEDAALQRSRHASHAFQLKYWRAQTQKFGVRCRVLGGSTAGWAGKVAPFDPLDFAAREWIPDSGWPIADTDIAPYVERAARRLDVGPIVGGQAFWHAAKLREPAEMARMRHVSSFFWQLARSHRNLTDVMRFGPDFRSESHPGVTVVLNATACAIHADAAGVTGVEIVSSLSGKRRRVLASRHVVLAAGAIENARLLLMSRDADGRALGNAHDVVGRYLTDHPCMSIGTFSPDSQASAAALLGFFSLQRDYRAFMYSHGLALRPEVQQQRRLPNMAAYANARISDDDPVVALKRLAKRQSKRPLADLLLVLQRSGVVVSFVGRRIVGSSILPRRLRRLIVDTVIRLDANFVARDYVAKGTGRKIEKVTLDVICEQPPLRDNRVTLSSRCDRLGLPVAHVTWEPGSLMKEAVVTFAQLLESDLREAGIRGFELRRDISAGDVSGIALHDMAHTAGTTRMGRDPATSVVDANCRVHDVDGLYVAGASVFPTSGHANPTMVIMALAIRLADHLKSRLVERRIAALKPPVATDDARPLVLVTGATGNLGADVVGQLIRHGYRVRGQFHRKVPSDSRVEWVAVDFSDANLADAALDRLVDGVAAVVHLAGGLPGTPHLETINVTNLKRLADACVRNGVGYFGHASSMVVYGSPCRRLVDENAPLLDVSRPIERQYFESPQMREYARSKRIGEDVLSRYAERMHVDLYRIALAQQPGYLEASLQWNRTKRLFALYRNSHYISPRNVARAIVHLLRRSLDRGARSGIEAFNIADTASPTYEEVYRRAGRKPLVHVPLLADVVKSVAVGKRVAKRFPMGFYRLDDRKLRSTGFMLDRDS
>NZ_CP009794.1|WP_006767198.1|607586_608327_-|SDR-family-oxidoreductase
MSESSGKIAIVTGSSRGIGADIAVRLAHDGFKVVVNYASNAAPAEEVAARIREGGGDALLVKADIADPAATIALFDATEKAYGGVDVVVNSAGVMHQARLAEFDDATFDRTVAINFKGAFNVSREAARRVRDGGRIMNLTTSVTGVRLPTYAVYIATKCAVEGLTQVLAQELRGRGISVNAVAPGPVATELFLAGKSAELIDRMAKMNPLERLGQPADISAVVAFLASPEGAWINGQVVRANGGMC
>NZ_CP009794.1|WP_006767199.1|608470_609376_-|SDR-family-oxidoreductase
MSKVILVTGASSGFGRLTAEALAHAGHTVYASMRDTGARNAPVVEQMRALARDAHVDLRPLELDVQSDASIDRAVEQLVAQAGRIDVLIHNAGHMAFGPAEAFTPEQYAQLYDINVLSTQRVNRAVLPHLRAQRQGLLIWVSSSSAAGGTPPYLAPYFGAKAAMDAIAVLYARELSRWGIETSIVVPGAFTQGTNHFAHASAPADAARAAEYDAGPYPDFGREVQDAFAAIVPADAHASLVADAIVDVVAAPAGKRPFRVHIDPTEDGANVGFAVLDRLRAEMLHRVGLSDLLSPRIRTSD
>NZ_CP009794.1|WP_081293523.1|609421_610534_-|HoxN/HupN/NixA-family-nickel/cobalt-transporter
MLARRHLPPATGVAPAAHARVRSIDLSALWIVAFIVLLHVVGWGTLIALIVPQHLSVGSRAFGIGAGITAYSLGMRHAFDADHIAAIDNTTRKLLGEGQRSASVGFWFSFGHSSVVFGLAVLISLGMHSVSTHVVDAGSTLRALTSVLGATVSSVFLYAIAALNVAAFYDLYRAFRAMRTGRFDEAQLERRLESRGIVARVLAPLMRIVRKPAQMYFVGLLFGLGFDTATEIALLVLTGSGAASGLPWYAILCLPVLFAAGMLLFDTIDGSFMHVAYGWALARPVRKIYYNLVVTGLSIGVALVIGTIEMLGLLNHALGMHGAFGAWLSALDLNDVGFAIVGLFVATWAISVAIWKFGRIEQRWAAGPDA
>NZ_CP009794.1|WP_174484782.1|610606_611638_-|DUF4331-family-protein
MSHHLDSPLARQDIRLDITDLYCFRGEIGTVLVINVCHSIAGDVPTPGYHPEGFYEFKLDLDGDAIEDVTYRIRFDARDAAGVQRFELRRIAGAAATDPHADGELVLRGRTDETAGAGSGVRVWAGKAGDPFWIEPDVLHAVGHAFQDGTPLDLGTWEPSHARNLFAGHTVYSIVLEVPDADLVGNAATNRKVGVWAVATLATDAGGWRSINRVGLPMIHPLFTQYNEDLGDRLNAGCPADDFATYGETVIASVAGAVRANGTAEDPVGYATAVAHRFLPNVLPYTIGTPAVFGMAEWNGRSLTDNAPDVMFTIASNTPIRLGIGKESVTSKPTSTFPYVPKA
>NZ_CP009794.1|WP_035975607.1|611903_613220_-|MFS-transporter
MKREPVVPDADVAPAIAGHTDRRTPERRILATIVIANALEFFDYFSYAVFAAFITRTFFPHVADGYGTLLSLGTFAAGFLSRPIGALAIGVHADAAGRKPALLLTAALVTAGSFGLAVIPGYATLGIAAPIAVLLCRILQGIAIGGEMGASGALLIERCPPDRKCTYAGWLMAGQGLALVAAGACGVALHATLSAAQIERWGWRVPFALAAALIPVQIYLRRHIDETWEARRATLAFGALLGRHRGRWLLAIALIFGGTVPTYVATYATTFGVAGPPPSAYASFVTTAAVGAVTLVLSIAGGCAADRIGRIRTIVLARALTMAVVLPAFYYAAVHPHPLALLGVVALFAGLSALAGAPSIVAILDMFPARGRAAALSVVYATGVALFGGTAPFVVASVGVWAGTHRAAGWYVFVSAAVTLIAIAAARAAGEPTSTARR
>NZ_CP009794.1|WP_035975608.1|613216_614536_-|HAMP-domain-containing-histidine-kinase
MNEPHAATGSIRDRETRAADDRAAADDARVDALFRSAPIPILIEDWSGIKRWIDTLKARGVTDLEAYLDAHPDVIDEVRRLHAFVDANDATLALFDAQSKDAFFAAAQRLLPASRLSNSQVLHAMFEGRSSCQGERTLATLSGRKVPIVWRCALPADDDAYRRLHFYAFDVTEYKENSERLDALRAQLARTARASMMGQLVASITHEIGQPLGAIRTALDAAVRWLDRAEPNVAEATAAFRHASRWTDDMANICRRLRGFLAGAPVEAVALDCAEVVASAMQLIASEAGTHGIALGSEVAPGTTAHADRIQLQQVLTNLLINGIHAIDATRDDGRERRLHVRAGRYDDTHTLFEVADTGCGIASTPPDAIFQPFSSTKRDGMGMGLPISKSIVEAHGGAIWIGDTGAHGTRFCFTLPSAPRANGSTADAAQRDRRQGAQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

658655 : 683201

Burkholderia_phage(50.0%)

integrase,tail,transposase

attL 676119:676135|attR 694511:694527

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006767226.1\|658655_659162_+\|tail	phage tail protein	R4JGF0	Burkholderia_phage	8.3e-78	89.3
WP_006767227.1\|659166_660246_+	phage late control D family protein	R4JDM6	Burkholderia_phage	7.2e-180	88.6
WP_123806780.1\|660290_661046_-	hypothetical protein	A0A089FKT7	Burkholderia_phage	3.3e-22	34.7
WP_045552353.1\|661134_661662_-	hypothetical protein	R4JDM9	Burkholderia_phage	7.6e-42	51.7
WP_035974134.1\|661900_663391_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_035975634.1\|663987_664884_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035975636.1\|665423_665729_-	hypothetical protein	NA	NA	NA	NA
WP_006767229.1\|665780_666842_-	aldo/keto reductase	NA	NA	NA	NA
WP_158380464.1\|667596_668073_+	universal stress protein	NA	NA	NA	NA
WP_158380465.1\|668253_669426_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_158380466.1\|669418_670138_+	HAD family phosphatase	NA	NA	NA	NA
WP_123806779.1\|670097_671111_+	hypothetical protein	NA	NA	NA	NA
WP_035975644.1\|671446_671632_+	DUF3563 family protein	NA	NA	NA	NA
WP_174484783.1\|671828_672236_-	VOC family protein	NA	NA	NA	NA
WP_035975646.1\|672456_672894_+	hypothetical protein	NA	NA	NA	NA
WP_006767235.1\|673084_673993_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035975648.1\|674360_676235_+	amidohydrolase	NA	NA	NA	NA
676119:676135	attL	NA	NA	NA	NA
WP_006767237.1\|676494_677148_+	hydrolase	NA	NA	NA	NA
WP_128567397.1\|677412_678795_-	hypothetical protein	NA	NA	NA	NA
WP_035975650.1\|678812_680549_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	A0A0R6PI85	Moraxella_phage	3.1e-23	25.3
WP_006764058.1\|680689_680953_+\|transposase	transposase	NA	NA	NA	NA
WP_045552354.1\|680979_681675_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	S5WIU1	Leptospira_phage	1.3e-28	40.4
WP_081293702.1\|681615_682884_-\|transposase	IS256-like element ISBcen18 family transposase	A0A218MNI5	uncultured_virus	1.7e-39	42.8
WP_158380467.1\|682964_683201_+\|transposase	transposase	S5WIU1	Leptospira_phage	1.5e-10	51.8
694511:694527	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009795

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009795_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009795_1

211321-211505

Orphan

Consensus_repeat	Method
CGAAGCCGAAGCCGAAGCCGATGGCGATG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009795_1

>merge|NZ_CP009795|1|211321-211505|CRISPRCasFinder
CGGCGCGGAAGCCGGTGCCGAAGGCCCCGACGGCGCGGCGGCGGGCGGCGACTGTGTCGATTCTGCCGATGGCGAAGCCGAAGCCGAAGCCGATGGCGATGCCGAAGCCGAAGCCGAAGCCGAAGCCGAAGCCGAAGCCGAAGCCGATGGCGATGGCGATGGCGATGGCGATGGCGATGGCGATG

>NZ_CP009795|1|1|211321-211505|CRISPRCasFinder
CGGCGCGGAAGCCGGTGCCGAAGGCCCCG	ACGGCGCGGCGGCGGGCGGCGACTGTGTCGA
TTCTGCCGATGGCGAAGCCGAAGCCGAAG	CCGATGGCGATGCCGAAGC
CGAAGCCGAAGCCGAAGCCGAAGCCGAAG	CCGAAGCCGATGGCGATGG
CGATGGCGATGGCGATGGCGATGGCGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009795.1\|WP_035971642.1\|221296_222085_-\|type-III-pantothenate-kinase	unknown	unknown	gnl\|CDD\|237352
NZ_CP009795.1\|WP_035971640.1\|216717_217944_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|132848
NZ_CP009795.1\|WP_006763274.1\|219460_219937_+\|D-glycero-beta-D-manno-heptose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|131254
NZ_CP009795.1\|WP_035971639.1\|215907_216693_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP009795.1\|WP_009693455.1\|210817_211075_-\|DUF3567-domain-containing-protein	unknown	unknown	gnl\|CDD\|378810
NZ_CP009795.1\|WP_006763266.1\|206669_209387_-\|methionine-synthase	unknown	unknown	gnl\|CDD\|236539
NZ_CP009795.1\|WP_035973257.1\|198042_199692_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP009795.1\|WP_035971643.1\|222081_223002_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|235896
NZ_CP009795.1\|WP_006763272.1\|215003_215831_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|235991
NZ_CP009795.1\|WP_006763262.1\|202590_203229_-\|thiol:disulfide-interchange-protein-DsbA/DsbL	unknown	unknown	gnl\|CDD\|239317
NZ_CP009795.1\|WP_006763273.1\|218419_219301_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153097
NZ_CP009795.1\|WP_035971637.1\|206258_206582_+\|DUF1840-domain-containing-protein	unknown	unknown	gnl\|CDD\|378087
NZ_CP009795.1\|WP_006763267.1\|209430_210501_-\|homocysteine-S-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|236539
NZ_CP009795.1\|WP_174484786.1\|203298_204177_-\|SPOR-domain-containing-protein	unknown	unknown	gnl\|CDD\|225629
NZ_CP009795.1\|WP_006763261.1\|201797_202571_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235910
NZ_CP009795.1\|WP_035971638.1\|212807_213674_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP009795.1\|WP_035971641.1\|220717_220960_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009795.1\|WP_006763264.1\|204276_206058_-\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234964
NZ_CP009795.1\|WP_035971634.1\|199882_201478_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP009795.1\|WP_006763271.1\|213801_214794_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257

Protein	Function_ID	Function_description	E-value
NZ_CP009795.1\|WP_035971642.1\|221296_222085_-\|type-III-pantothenate-kinase	gnl\|CDD\|237352	PRK13328, PRK13328, type III pantothenate kinase.	7.84449e-118
NZ_CP009795.1\|WP_035971640.1\|216717_217944_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|132848	cd07209, Pat_hypo_Ecoli_Z1214_like, Hypothetical patatin similar to Z1214 protein of Escherichia coli. Patatin-like phospholipase similar to Z1214 protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	1.30202e-32
NZ_CP009795.1\|WP_006763274.1\|219460_219937_+\|D-glycero-beta-D-manno-heptose-1-phosphate-adenylyltransferase	gnl\|CDD\|131254	TIGR02199, rfaE_dom_II, rfaE bifunctional protein, domain II. RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in E. coli, and separate proteins in some other genome. Domain I (TIGR02198) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (this family) adds ADP to yield ADP-D-glycero-D-manno-heptose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	1.38751e-74
NZ_CP009795.1\|WP_035971639.1\|215907_216693_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	5.3402e-07
NZ_CP009795.1\|WP_009693455.1\|210817_211075_-\|DUF3567-domain-containing-protein	gnl\|CDD\|378810	pfam12091, DUF3567, Protein of unknown function (DUF3567). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved EIVDK sequence motif.	1.65512e-47
NZ_CP009795.1\|WP_006763266.1\|206669_209387_-\|methionine-synthase	gnl\|CDD\|236539	PRK09490, metH, B12-dependent methionine synthase; Provisional.	0
NZ_CP009795.1\|WP_035973257.1\|198042_199692_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	9.9781e-111
NZ_CP009795.1\|WP_035971643.1\|222081_223002_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|235896	PRK06955, PRK06955, biotin--[acetyl-CoA-carboxylase] ligase.	6.48601e-138
NZ_CP009795.1\|WP_006763272.1\|215003_215831_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|235991	PRK07327, PRK07327, enoyl-CoA hydratase/isomerase family protein.	0
NZ_CP009795.1\|WP_006763262.1\|202590_203229_-\|thiol:disulfide-interchange-protein-DsbA/DsbL	gnl\|CDD\|239317	cd03019, DsbA_DsbA, DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.	6.89939e-73
NZ_CP009795.1\|WP_006763273.1\|218419_219301_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	0.0061599
NZ_CP009795.1\|WP_035971637.1\|206258_206582_+\|DUF1840-domain-containing-protein	gnl\|CDD\|378087	pfam08895, DUF1840, Domain of unknown function (DUF1840). This family of proteins are functionally uncharacterized.	1.45778e-34
NZ_CP009795.1\|WP_006763267.1\|209430_210501_-\|homocysteine-S-methyltransferase-family-protein	gnl\|CDD\|236539	PRK09490, metH, B12-dependent methionine synthase; Provisional.	0
NZ_CP009795.1\|WP_174484786.1\|203298_204177_-\|SPOR-domain-containing-protein	gnl\|CDD\|225629	COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning].	2.28054e-20
NZ_CP009795.1\|WP_006763261.1\|201797_202571_-\|SDR-family-oxidoreductase	gnl\|CDD\|235910	PRK07024, PRK07024, SDR family oxidoreductase.	6.75886e-154
NZ_CP009795.1\|WP_035971638.1\|212807_213674_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	8.37601e-52
NZ_CP009795.1\|WP_006763264.1\|204276_206058_-\|arginine--tRNA-ligase	gnl\|CDD\|234964	PRK01611, argS, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP009795.1\|WP_035971634.1\|199882_201478_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP009795.1\|WP_006763271.1\|213801_214794_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	2.33421e-57

>NZ_CP009795.1|WP_009693455.1|210817_211075_-|DUF3567-domain-containing-protein
MQMIYNSPNYCVVEFAPQAGHHLMNAGGYEIVDKNAQREIFIDGELAERFRAHVKQLIEEEPSLDEVDEFLGQFDSLMMMPVVLH
>NZ_CP009795.1|WP_006763267.1|209430_210501_-|homocysteine-S-methyltransferase-family-protein
MSATPSAASAAPLDAHYTRGAELPALLNSRILILDGAMGTMIQRYKLDEAAYRGERFKDFPRDVKGNNELLSITQPQVIREIHDQYFAAGADIVETNTFGATSVAQADYGMEDLVVEMNVASAKLARESAAKYATPDKPRFVAGAIGPTPKTASISPDVNDPGARNVTFDELRDAYYTQAKALLDGGVDLFLVETIFDTLNAKAALFALDQLFEDTGERLPIMISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLCDTYVSCYPNAGLPNPMADTGFDETPDVTSGLLKEFAQAGLVNLAGGCCGTTPEHIAEIAKALADVKPRRWPSQYSEAA
>NZ_CP009795.1|WP_006763266.1|206669_209387_-|methionine-synthase
MTDHMMRLAGLEPFNVTPGTLFINVGERTNVTGSKAFARMILNGQFDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKWDVIEAGLKCVQGKAIVNSISLKEGEEAFRHHAKLIRRYGAAAVVMAFDEQGQADTFARKTEICKRSYDFLVNEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQNLPYAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDPELRERVEDVILNRRPDSTDRLLEIADKFKTGAAKKEENLEWRNQPVEKRLAHALVHGITNFIVEDTEEARVKIAAAGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHLIPFIEEEKRLLAEAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMVPCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSRVHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAAKYLDELKADYERIRDQHANRKAQPMVTLAEARANKTKIDWANYTPVKPKFIGRRVFRNYDLNELANYIDWGPFFQTWDLAGPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVNDDDIEIYTDDSRSEVLLTWRNLRQQSVRPVVDGVMRPNRSLADFIAPKASGVADYIGMFAVTAGLGVDAKEKQFEADHDDYSAIMLKALADRFAEAFAEAMHARVRRELWGYASGETLDNDALIAEKYTGIRPAPGYPACPDHLVKRDMFAALQADEIGMSVTDSLAMLPAASVSGFYLAHPDSRYFSVGKIGQDQLEDYAQRMALSLDDARRALAPQL
>NZ_CP009795.1|WP_035971637.1|206258_206582_+|DUF1840-domain-containing-protein
MITFKSKAAQDLDVLKDFAVYVLGLVGKQLGERGVITHEELDHAIAKLEDAVAQAKQERAEHAGHYHEDEADHAHHEVPPSLAQRVAPFLTMLREAKAAQADVHWGF
>NZ_CP009795.1|WP_006763264.1|204276_206058_-|arginine--tRNA-ligase
MLPAHKQTLEALLADSVKQVAHALKGADAAFVPPAITLERPKVAAHGDVACNVAMQLAKPLGTNPRQLAEQIVAAVNAHPAAQGLVEAAEIAGPGFINLRLTAAAKQAVIGAVFAQGSAFGTSDREKGKRVLLEFVSANPTGPLHVGHGRQAALGDVLANVIASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIARDYMNCETVAAKDGEPVKGAGDVDDLDAIRKFAVAYLRHEQDMDLQAFGVKFDQYYLESSLYSEGRVEKTVDALIKAGMTYEQDGALWLRTTDEGDDKDRVMRKSDGTYTYFVPDVAYHVTKWERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKISKRAGSYVTVRDLIEWSGGAAPGQEAAPDLIDEATITRGRDAVRFFLISRKADTEFVFDIDLALKQNDENPVYYVQYAHARICSVLNEWQSRYNGDLAQLPHADLSQLTSAQAASLMQKLAEYPDMLTHAANELAPHAVAFYLRDLAGEFHSFYNAERVLVDDEAPRNARAALLAATRQVLANGLAMLGVSAPAKM
>NZ_CP009795.1|WP_174484786.1|203298_204177_-|SPOR-domain-containing-protein
MQVTQAMAQPRRTSKQSKQAGGTFLGIVLGLIVGLAIAVVVALYITRSPSPFVSKVAPPSADNGASQPQQFDPNRALQGKTPGQPVPQAAQPAPPNTAPGQAANQTQGGLLPEPQIVEVPPSASSAGSTSASNNASNNGVAVAPKPAENTPPKKTQPPAGEDDLARFAAQKQAQQQAAAQKQQQQQQQAANASKPTSSATAAAAAKPPSANDANTGYFLQVGAYKTEGDAEQQRARLGFQGFESKVSKRDVSGVTYYRVRVGPFSKFEDMNSARQRLSDAGVDTAVIRFTKQ
>NZ_CP009795.1|WP_006763262.1|202590_203229_-|thiol:disulfide-interchange-protein-DsbA/DsbL
MKKLLSTLLLSLGLVAGLAHATPAAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGSNIDFKRVPVAFRDDFVPHSKLFYAVSALGIAEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKQFMDAYNSFSVQSQVKQSAELLKNYAIDGVPTIVVQGKYKTGPAYTNSIPGTAQVLDYLVKQVQDKKL
>NZ_CP009795.1|WP_006763261.1|201797_202571_-|SDR-family-oxidoreductase
MTAPLKVFITGASSGLGLAIADEYARQGATLALVARRVDALEAFARRFPKLSISIYAADVRDADALATAAASFIAAHGCPDVVIANAGISQGAVTGQGDLATFRDVMDVNYYGMVATFEPFVGPMTAARHGTLVGIASVAGVRGLPGSGAYSASKSAAIKYLEALRVELRPAGVGVVTIAPGYIRTPMTEHNPYRMPFLMDADRFAAHAARAIARQHAFRVIPWQMGIVAKVLHVLPRWLYDRLFEKAPRKPKAGTH
>NZ_CP009795.1|WP_035971634.1|199882_201478_-|ABC-transporter-substrate-binding-protein
MHVKLFAAAAIAAALAAPGVVAAKPLTVCTESSPDGFDVVQYNSLVTTNASADVIFNSLVSYDEAAKKVVPALADKWEASADGLTYTFHLRPNVAFQTTDYFKPSRPLNADDVVFTFSRMLDDSNPWHKVAGASGFPHAQSMGLTKLVKSVTKVDDSTVKFVLNEPNATFVPILTMGFASIYSAEYADQLLKAGKQADLNAKPIGTGPFVLKSYTKDALIRYDVNPTYWGPKPKIDRLIYAITPDPSVRMQKVKAGECQIALSPKPQDVLAAKGESALKVVQTPAFMTAFVALNTQKKPLDNDKVREALNLAFDRATYLKVVFDNTATAANNPYPPNTWSYAKDVAPYPYDPAKAKQLLASAGFPNGFSTTIWTRPTGSVLNPNPKAGAELLQADLAKIGVKADVKVIEWGELIKQAKLGQHDMLFMGWAGDNGDPDNYLTPLFSCNAVKSGINFARFCDAQLDKLIADGKTTADQAKRAKLYEAAQKIIHDEALWIPLGYPTAAALTRANVSGYRVSPFGRQNFTTVAVQ
>NZ_CP009795.1|WP_035973257.1|198042_199692_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MAAATPTGALVALHHVSFRFDDGFTLFDSLDLVVDRVPTGIVGRNGAGKSVLAQLIAGRCAPSSGAIDRQTSVAYVAQQHADMPAGSQSVAAIAELDVPLAALARLAQGEADAHDFDSIGERWDLAERLRAALDAAGLHDVQPDAAADTLSGGQLARVALIGALLSGAGLLVLDEPTNHLDAPGRAWLRAALDGWRGGLVVVSHDRALLGSLQRIVEVTPHGVRSYGGNYALYRAQRDAEDAAAQAALDHARAGRSREKKRLEREHDTIQRHAAGSLRDAKTANLSSMARQSRKGAARSIMGTVRRHHGELKATLDERVHEAAARVDAGAPVLVSLPGTEVSARRQLFTLECAQPPWPADADAPPITWSASGAVRIALTGPNGCGKSTLLRMLAGELAPRAGECRTHVSAAYLDQRLALLDRDRSIVEQLGLLDTPLAEGELRSRLALLQLDASRATQPVHRLSGGERLKAALACALWRGTPAQLLLLDEPTNHLDLESVRAIEAALTGFPGAIVVASHDAAFLAALDPTHTMQWHRDGWRYEPVASLA
>NZ_CP009795.1|WP_035971638.1|212807_213674_-|IclR-family-transcriptional-regulator
MPASPPPDDDLVDPDTDDAASGDNGEKVRSGIQSIEVGFRLLDVLTSEPRAMMLRDLAQRAGMSPAKAHRYLVSFSRLGVVSQDPVSGRYELGGFALQMGLARLARVDGVKLARIALTEFRDRLDQTVGIAVWGNQGPTIVHWMESSHPAKASLKLGDVMPLLGSATGLLFAAYLPRSKTAAMIERELADTRRSPHHGGPRTLEEVEAVLADVRKHQAARVEGMLLPTIHAFCMPVFDAVGELALAIVALGQEGTFDIAWGGEIDTALRACAQKLSYELGYSSDARDA
>NZ_CP009795.1|WP_006763271.1|213801_214794_+|fumarylacetoacetate-hydrolase-family-protein
MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFYAPQLRELYDALNHGRARNAFAFDAANCMAPLPRAFQWADGSAYVNHVELVRRARGAEMPPEFWTDPLMYQGGSDDFLGARDDIVCPSEAWGIDFEAEVAVITGDVPMSTSPDDALKAVRLVTLVNDVSLRNLIPAELAKGFGFFQSKPATAFAPVAVTPDELGDAWHDGRMHRPMIVHWNGKKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGSIVGSGTVSNKDAKRGYCCIAEKRCLETIEHGAPQTEFMRYGDTVRIEMFDAAGKSIFGAIEQSVAPPDGAA
>NZ_CP009795.1|WP_006763272.1|215003_215831_+|enoyl-CoA-hydratase/isomerase-family-protein
MADLAAYGSYEALKVTRRDHGVLDIVMSGEGANRSGLATADARMHRELADIWRDVDRDPDTRVAVIRGEGKGFSAGGDLALVEQMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGPAVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLLLCEPVSGDEAERIGLVSLAVEPADLLPKAYEVAERLANGSQTAIRWTKYALNNWLRTAGPAFDTSLALEFMGFSGPDVHEGVRSLRERRPPDFRGDAPF
>NZ_CP009795.1|WP_035971639.1|215907_216693_+|hypothetical-protein
MTTDASGSNPFAGFAGFQPADMLDRMWEMMRMSPFGAMAPFPGAPAGLPPSLSAMSDMMAPLTSVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLATLRAFGAFAQSSMSAAEDAATAAAKAASAPLGEAPRQPDAAASAAAASATSGGDAAGSDASPEGGAAPQAFDPAGWWNLLQAQFNQLASLAMAQPGMQPAASGDGAAGAAAPPPEQPTPAAAAPRKPAAKRAKPAGSAAARAAAASSPETRPPKRST
>NZ_CP009795.1|WP_035971640.1|216717_217944_+|patatin-like-phospholipase-family-protein
MRLALVLMGGGARAAYQVGVLKALAEIAREADPQRHTLPFAVVCGSSAGAINATSIASHADDFSHGVRRLLEFWEHLRADYVYRTDWLGIAAAGARWLATMTFGWAARRSPRGLLDNTPLAHLLQRELSFHRIEQMLEARLLHALAVTALSYSSGRHLTFYQAAEPIQAWRRAQRTARLVDLSASHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPLSPAIHFGADCIVVVGAADPRPEIPAANGAGLVRGYPTLAQIGQQVLASVFLDSIGSDIERIEHINRMIEHLPHQVEVDSGWRHVDVLAIAPSERIELIAAKHLKQMPATMRGLLGAVGGSQPAGASFASYLLFEEAFTRELIELGYRDGRAQRDTLADWIARADGGGATAAGGVSDDGRTAGQIRV
>NZ_CP009795.1|WP_006763273.1|218419_219301_+|ferritin-like-domain-containing-protein
MNTMLYPELYKSLEAVRWDMEKDIPWDKFDASLLTDEQARTIKMNAITEWSALPATEMFLRDNQHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELVPTEEELHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRCAADWHTEPVIKHIYETISRDEARHGGAYLRYMKKALNNCGDVARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRLPDPEWLERWLDEQIRFDGEWEKKVVERILHNLSILFERTFATAQELNRYRKEVTSRLQATEGGPSSAAQPA
>NZ_CP009795.1|WP_006763274.1|219460_219937_+|D-glycero-beta-D-manno-heptose-1-phosphate-adenylyltransferase
MPATFERKLISRDALVAMRASLPSPVVFTNGVFDILHRGHVTYLADAKALGACLIVGVNSDASVRMLGKGDDRPINGEDDRMALLAALESADWVVKFEEKTPVSLIEAVRPDILVKGGDYDMDALPESAIVRGWGGRALAIPFEHDRSTTALLRKVRG
>NZ_CP009795.1|WP_035971641.1|220717_220960_-|hypothetical-protein
MLRWLIAILFLANLLAFVAARGVFGPLPAAGARDPDVLSRQVRPDALHATPLAQPTDQPLVGGPIAPPAVAAEPLAASAQ
>NZ_CP009795.1|WP_035971642.1|221296_222085_-|type-III-pantothenate-kinase
MSVTDLLIDAGNSRIKWALADAQRALVDTGTFGHVRDGGADPDWSTLPRPRSAWISNVAGADVAARLDALLDARWPGLPRTTIRARDAQCGVTNGYTLPEQLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGRFTGGLIAPGWALMMRSLGTHTAQLPTLTTDIASGLLAGAQADPFQVDTPRSLSAGCLYAQAGLIERAWRELADAWQAPVRLVLAGGAADDVARVLTLPHTRHDALILSGLALIAADAAAPG
>NZ_CP009795.1|WP_035971643.1|222081_223002_-|biotin--[acetyl-CoA-carboxylase]-ligase
MNTLTSPDTPEPGAAHIARSRLDAHLDAAPRAWPLDIVAATGSTNADLALRLKALPRTATALPAPLVRVAFEQTAGRGRQGRPWFAQPGNALLCSVGCIVPRPVDALGGLSIAIGVALAEGLATLPLDSGARVALKWPNDLLLTAADDGTPRIVGKLAGILIETVWTTADATAVVIGFGINVRGAEAVAAQVDALRAREATLASGLPPAALSAACASANLTDTLAASLNALTPALAQFAADGLAPFLPRWHALHAYAGREVVLLEQGVERARGIATGIDAAGQLLLDTPHGVQAIAAGDVSLREAQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009795_1	1.2\|211410\|19\|NZ_CP009795\|CRISPRCasFinder	211410-211428	19	NZ_CP009795.1	2081584-2081602	2	0.895
NZ_CP009795_1	1.2\|211410\|19\|NZ_CP009795\|CRISPRCasFinder	211410-211428	19	NZ_CP009795.1	2081770-2081788	2	0.895
NZ_CP009795_1	1.2\|211410\|19\|NZ_CP009795\|CRISPRCasFinder	211410-211428	19	NZ_CP009793.1	1287712-1287730	1	0.947
NZ_CP009795_1	1.2\|211410\|19\|NZ_CP009795\|CRISPRCasFinder	211410-211428	19	NZ_CP009793.1	758559-758577	2	0.895
NZ_CP009795_1	1.3\|211458\|19\|NZ_CP009795\|CRISPRCasFinder	211458-211476	19	NZ_CP009795.1	2081764-2081782	1	0.947

1. spacer 1.2|211410|19|NZ_CP009795|CRISPRCasFinder matches to position: 2081584-2081602, mismatch: 2, identity: 0.895

ccgatggcgatgccgaagc	CRISPR spacer
ccgatgccgatgccgacgc	Protospacer
****** ********* **

2. spacer 1.2|211410|19|NZ_CP009795|CRISPRCasFinder matches to position: 2081770-2081788, mismatch: 2, identity: 0.895

ccgatggcgatgccgaagc	CRISPR spacer
ccgatggcgatggcgatgc	Protospacer
************ *** **

3. spacer 1.2|211410|19|NZ_CP009795|CRISPRCasFinder matches to position: 1287712-1287730, mismatch: 1, identity: 0.947

ccgatggcgatgccgaagc	CRISPR spacer
ccgatgccgatgccgaagc	Protospacer
****** ************

4. spacer 1.2|211410|19|NZ_CP009795|CRISPRCasFinder matches to position: 758559-758577, mismatch: 2, identity: 0.895

ccgatggcgatgccgaagc	CRISPR spacer
ccgatcgcgacgccgaagc	Protospacer
***** ****.********

5. spacer 1.3|211458|19|NZ_CP009795|CRISPRCasFinder matches to position: 2081764-2081782, mismatch: 1, identity: 0.947

ccgaagccgatggcgatgg	CRISPR spacer
ccgatgccgatggcgatgg	Protospacer
**** **************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009795_1	1.3\|211458\|19\|NZ_CP009795\|CRISPRCasFinder	211458-211476	19	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	94723-94741	0	1.0
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP044550	Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence	270814-270844	5	0.839
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_015169	Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence	236258-236288	6	0.806
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	89763-89793	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP013109	Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence	170784-170814	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	496848-496878	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2220063-2220093	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	104590-104620	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	146574-146604	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	28492-28522	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	24045-24075	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	22901-22931	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MH479927	Gordonia phage TimTam, complete genome	22514-22544	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	KU963255	Gordonia phage Nymphadora, complete genome	22514-22544	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MT889398	Gordonia phage Herod, complete genome	22514-22544	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK878898	Gordonia phage Zameen, complete genome	22511-22541	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK919483	Gordonia phage Suscepit, complete genome	22511-22541	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK112547	Gordonia phage Maridalia, complete genome	22511-22541	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MT952844	Gordonia phage Bosnia, complete genome	22514-22544	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MH479912	Gordonia phage Eviarto, complete genome	22514-22544	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK016492	Gordonia phage Bialota, complete genome	22526-22556	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK820642	Gordonia phage Polly, complete genome	21954-21984	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK814755	Gordonia phage Antonio, complete genome	22511-22541	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MK875796	Gordonia phage Tayonia, complete genome	22511-22541	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	KU963249	Gordonia phage Yeezy, complete genome	21733-21763	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	KX557273	Gordonia phage BatStarr, complete genome	22514-22544	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MT521999	Gordonia Phage Jablanski, complete genome	23105-23135	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	KU963257	Gordonia phage Kita, complete genome	22511-22541	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_031097	Gordonia phage Zirinka, complete genome	22526-22556	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	MG872834	Gordonia phage Confidence, complete genome	22026-22056	7	0.774
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP013072	Sphingobium indicum B90A plasmid pSRL2, complete sequence	6664-6694	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	241528-241558	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	344978-345008	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP048816	Caulobacter rhizosphaerae strain KCTC 52515 plasmid unnamed	182485-182515	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1045617-1045647	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	767454-767484	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	297721-297751	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	186362-186392	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP015370	Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p3, complete sequence	26531-26561	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	KY622015	Shewanella phage SppYZU01, complete genome	27889-27919	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NC_049432	Ralstonia phage RsoM1USA, complete genome	17178-17208	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP047174	Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence	152449-152479	8	0.742
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	LN997845	Streptomyces reticuli genome assembly TUE45, plasmid : IV	3491-3521	9	0.71
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	46753-46783	9	0.71
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	5583-5613	9	0.71
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	20918-20948	9	0.71
NZ_CP009795_1	1.1\|211350\|31\|NZ_CP009795\|CRISPRCasFinder	211350-211380	31	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	5197-5227	9	0.71

1. spacer 1.3|211458|19|NZ_CP009795|CRISPRCasFinder matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 0, identity: 1.0

ccgaagccgatggcgatgg	CRISPR spacer
ccgaagccgatggcgatgg	Protospacer
*******************

2. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP044550 (Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence) position: , mismatch: 5, identity: 0.839

acggcgcggcggcgggcggcgactgtgtcga-	CRISPR spacer
gcggcgcggcggcgggcgcggactg-gccgaa	Protospacer
.*****************  ***** *.***

3. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_015169 (Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcagcgcagcggcgggcggcgactttgtggc	Protospacer
.*.****.**************** *** *

4. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgtggcggtgggcggcgactgcatgac	Protospacer
******.*****.************..* .

5. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP013109 (Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
ggcgggcggcggcgggcggcgagtatgtcgc	Protospacer
.  * ***************** *.*****

6. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcggcggcgggcgtcgaatatcgggt	Protospacer
****************** *** *.*   *

7. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcggcggctggcggcgatggtcgtgc	Protospacer
************* ********. **  .*

8. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgcggtggcgggcggcgtctcttgcgt	Protospacer
 ********.*********** ** *  **

9. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga-	CRISPR spacer
tgggtgcggcggccggcggcgactg-gctgat	Protospacer
  **.******** *********** *..**

10. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgctgcgccgggcggcgacgatgaccg	Protospacer
******* *** *********** .** * .

11. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga----	CRISPR spacer
acagcgcggcggcgggcgtcgac----ccgaacct	Protospacer
**.*************** ****    .***

12. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga----	CRISPR spacer
acagcgcggcggcgggcgtcgac----ccgaacct	Protospacer
**.*************** ****    .***

13. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MH479927 (Gordonia phage TimTam, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

14. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to KU963255 (Gordonia phage Nymphadora, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

15. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MT889398 (Gordonia phage Herod, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

16. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK878898 (Gordonia phage Zameen, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

17. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK919483 (Gordonia phage Suscepit, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

18. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK112547 (Gordonia phage Maridalia, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

19. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MT952844 (Gordonia phage Bosnia, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

20. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MH479912 (Gordonia phage Eviarto, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

21. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK016492 (Gordonia phage Bialota, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

22. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK820642 (Gordonia phage Polly, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggccggcggcgacttcgtgca	Protospacer
 ****** ***** ********** .**  *

23. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK814755 (Gordonia phage Antonio, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

24. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MK875796 (Gordonia phage Tayonia, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

25. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to KU963249 (Gordonia phage Yeezy, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

26. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to KX557273 (Gordonia phage BatStarr, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

27. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MT521999 (Gordonia Phage Jablanski, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggtgcggcggccggcggcgacttcgtgca	Protospacer
 ***.******** ********** .**  *

28. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to KU963257 (Gordonia phage Kita, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

29. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_031097 (Gordonia phage Zirinka, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

30. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to MG872834 (Gordonia phage Confidence, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggccggcggcgacttcgtgca	Protospacer
 ****** ***** ********** .**  *

31. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP013072 (Sphingobium indicum B90A plasmid pSRL2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcggcgcggcgacgggcggcgacgcgatctg	Protospacer
.**********.***********   .** .

32. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcggcggtgcgcggcgacccacgcgg	Protospacer
************.* ********.    **.

33. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcgccagcgggcggcgactccgctcc	Protospacer
******** *.************* .*..

34. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP048816 (Caulobacter rhizosphaerae strain KCTC 52515 plasmid unnamed) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
cgggcgcggcggcgggccgcgacttttgggg	Protospacer
  *************** ****** *   *.

35. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgcggcggcgggcggtgaccgccgggc	Protospacer
 ******************.***.*.   *

36. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgcggcggcgggcggtgaccgccgggc	Protospacer
 ******************.***.*.   *

37. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcgccgcggcggcgggcggcggctcggctaa	Protospacer
 ** *****************.**  *...*

38. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcggcgcggcggcgggcggggacggcgcttt	Protospacer
.****************** *** *.*..

39. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP015370 (Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p3, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcggcccggcggcgggcggcggcttcgccct	Protospacer
.**** ***************.** .*.*

40. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to KY622015 (Shewanella phage SppYZU01, complete genome) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gagtagaggcggcgggcgccgactgggtcgt	Protospacer
. *  * *********** ****** ****

41. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NC_049432 (Ralstonia phage RsoM1USA, complete genome) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcgcgctggcggcgggcggcgcctgggtcgt	Protospacer
.**   .************** *** ****

42. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP047174 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcgtcgcggcggcgggcggcggctccttcag	Protospacer
 ** *****************.** . **..

43. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to LN997845 (Streptomyces reticuli genome assembly TUE45, plasmid : IV) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
cccaattcccggcgggcggcgaccgtgtcga	Protospacer
 * .  .  **************.*******

44. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatccgcg	Protospacer
**** ** *************** .* .  .

45. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatccgcg	Protospacer
**** ** *************** .* .  .

46. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatcagcg	Protospacer
**** ** *************** .*    .

47. spacer 1.1|211350|31|NZ_CP009795|CRISPRCasFinder matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatccgcg	Protospacer
**** ** *************** .* .  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 38286

Xanthomonas_phage(14.29%)

protease,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971546.1\|822_1089_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_035971547.1\|1127_4580_+	RHS repeat protein	NA	NA	NA	NA
WP_006763106.1\|4658_6011_-	hypothetical protein	A0A292GJ55	Xanthomonas_phage	4.3e-105	45.9
WP_006763107.1\|6040_7075_-	fimbrial protein	NA	NA	NA	NA
WP_006763108.1\|7124_8183_-	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_006763109.1\|8179_9241_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_006763110.1\|9244_11125_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006763111.1\|11126_11648_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_174484792.1\|11631_12444_-	ImpE protein superfamily protein	NA	NA	NA	NA
WP_006763113.1\|12488_13151_-	TagK domain-containing protein	NA	NA	NA	NA
WP_006763114.1\|13657_16315_+	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	1.1e-72	31.0
WP_006763115.1\|16416_17088_-	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_006763116.1\|17054_17846_-	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_006490510.1\|17842_18742_-	acetylglutamate kinase	NA	NA	NA	NA
WP_035973239.1\|19033_19258_+	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_035971549.1\|19363_20797_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_006763117.1\|20810_21353_+	response regulator transcription factor	NA	NA	NA	NA
WP_035971551.1\|21687_23031_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	1.6e-43	29.2
WP_045552400.1\|23041_23578_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_006402995.1\|23839_24256_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_035971552.1\|24744_25821_-	GTP-binding protein	NA	NA	NA	NA
WP_006763120.1\|26020_27235_-	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_006763121.1\|27307_28228_-	tyrosine recombinase XerC	A0A1I9SC88	Mycobacterium_phage	3.1e-14	30.3
WP_006763122.1\|28241_28967_-	DUF484 family protein	NA	NA	NA	NA
WP_035971553.1\|29021_29891_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_006763124.1\|30150_31035_-	lauroyl acyltransferase	A0A1W6JP29	Morganella_phage	2.8e-28	29.7
WP_035971554.1\|31297_32485_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.2e-121	60.7
WP_006763126.1\|32584_32926_-	hypothetical protein	NA	NA	NA	NA
WP_035971555.1\|33276_34050_+	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_094190513.1\|34169_35539_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.8e-75	54.4
WP_006763130.1\|35651_35858_-	DUF3185 family protein	NA	NA	NA	NA
WP_006763131.1\|36050_37094_+	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
WP_006762893.1\|37194_38286_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

44225 : 45866

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971557.1\|44225_45866_+	GMC family oxidoreductase N-terminal domain-containing protein	A0A2I2L3D3	Orpheovirus	2.6e-35	29.1

DBSCAN-SWA_3

68443 : 69751

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971578.1\|68443_69751_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.6e-93	44.9

DBSCAN-SWA_4

73731 : 75743

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763158.1\|73731_74730_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-17	31.8
WP_006763159.1\|74726_75743_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	31.0

DBSCAN-SWA_5

85171 : 86413

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763168.1\|85171_86413_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.5e-80	45.6

DBSCAN-SWA_6

95554 : 96523

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763180.1\|95554_96523_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A160LKR7	Bacillus_phage	2.3e-15	42.3

DBSCAN-SWA_7

101122 : 102430

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763184.1\|101122_102430_+	pyrimidine permease	Q9KX94	Enterobacteria_phage	2.0e-160	71.0

DBSCAN-SWA_8

117599 : 119769

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763199.1\|117599_118604_-	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	1.1e-09	23.4
WP_045552403.1\|118614_119769_-	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.4e-24	32.7

DBSCAN-SWA_9

130431 : 133665

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971599.1\|130431_132249_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-141	46.7
WP_006763213.1\|132303_133665_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L821	Tupanvirus	1.1e-31	34.6

DBSCAN-SWA_10

152707 : 154614

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763232.1\|152707_153640_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	1.7e-39	34.0
WP_006763233.1\|153672_154614_-	glyoxylate/hydroxypyruvate reductase A	M1NSB9	Streptococcus_phage	3.2e-06	28.4

DBSCAN-SWA_11

188412 : 189597

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971629.1\|188412_189597_-	8-amino-7-oxononanoate synthase	V5LQ39	Emiliania_huxleyi_virus	3.5e-18	26.3

DBSCAN-SWA_12

193235 : 193913

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763256.1\|193235_193913_-	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.3e-06	27.7

DBSCAN-SWA_13

198042 : 199692

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973257.1\|198042_199692_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	4.1e-17	24.4

DBSCAN-SWA_14

204276 : 206058

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763264.1\|204276_206058_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	4.6e-14	20.4

DBSCAN-SWA_15

209430 : 210501

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763267.1\|209430_210501_-	homocysteine S-methyltransferase family protein	A0A140XBC7	Dickeya_phage	1.4e-10	48.4

DBSCAN-SWA_16

219460 : 219937

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763274.1\|219460_219937_+	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	1.6e-14	34.0

DBSCAN-SWA_17

229560 : 230445

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971647.1\|229560_230445_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.3e-21	32.6

DBSCAN-SWA_18

235008 : 238637

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971652.1\|235008_236325_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.5e-67	38.9
WP_006763288.1\|236373_237300_+	D-amino acid aminotransferase	NA	NA	NA	NA
WP_035973260.1\|237299_237608_+	YbeD family protein	NA	NA	NA	NA
WP_006763290.1\|237644_238637_-	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	3.3e-30	32.4

DBSCAN-SWA_19

242193 : 245913

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971653.1\|242193_242991_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.1e-31	40.4
WP_035971654.1\|242987_243953_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_006763296.1\|244038_245913_-	gamma-glutamyltransferase	Q5GF27	Diachasmimorpha_longicaudata_entomopoxvirus	6.6e-11	27.0

DBSCAN-SWA_20

266757 : 268530

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973262.1\|266757_268530_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	2.1e-11	26.9

DBSCAN-SWA_21

272575 : 275069

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763317.1\|272575_272836_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	1.5e-11	46.2
WP_006763318.1\|272939_273422_+	protein-export chaperone SecB	NA	NA	NA	NA
WP_035971663.1\|273448_274447_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_006763320.1\|274544_275069_+	O-acetyl-ADP-ribose deacetylase	E2CTW8	Turbot_reddish_body_iridovirus	4.3e-37	50.3

DBSCAN-SWA_22

279928 : 281536

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763326.1\|279928_281536_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.5e-08	37.7

DBSCAN-SWA_23

288790 : 290428

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971674.1\|288790_290428_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.8e-10	62.3

DBSCAN-SWA_24

294326 : 311222

Pithovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971680.1\|294326_295121_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.0e-05	25.7
WP_035973265.1\|295422_296130_+	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_035971682.1\|296062_297544_+	DNA polymerase Y family protein	NA	NA	NA	NA
WP_035971683.1\|297550_300766_+	error-prone DNA polymerase	A0A1C9LWI9	Streptomyces_phage	4.2e-98	27.9
WP_006763344.1\|301066_301801_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_035971685.1\|301896_303000_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_035971687.1\|302992_304009_+	SIS domain-containing protein	F2Y1G4	Organic_Lake_phycodnavirus	1.3e-13	26.4
WP_035971689.1\|304024_306619_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.1e-08	28.3
WP_035971690.1\|306696_308466_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_035971692.1\|308726_311222_-	carbohydate-binding domain-containing protein	A0A076G5S5	Staphylococcus_phage	2.2e-06	30.2

DBSCAN-SWA_25

315372 : 316308

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763351.1\|315372_316308_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.0e-36	36.7

DBSCAN-SWA_26

323813 : 328363

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398238.1\|323813_324311_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	9.8e-31	45.3
WP_006763359.1\|324370_324637_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	3.0e-18	55.8
WP_006763360.1\|324716_325784_-	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_006763361.1\|325928_326528_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_035971697.1\|326636_327245_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_006763363.1\|327406_328363_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	6.9e-41	34.6

DBSCAN-SWA_27

334740 : 335649

Corynebacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763369.1\|334740_335649_-	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	1.5e-05	30.8

DBSCAN-SWA_28

339696 : 355600

Brazilian_cedratvirus(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763374.1\|339696_340473_-	LPS export ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.1e-16	28.8
WP_006763375.1\|340469_341135_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_006763376.1\|341155_341770_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_006763377.1\|341773_342310_-	HAD family hydrolase	E3T535	Cafeteria_roenbergensis_virus	1.0e-09	26.8
WP_035973266.1\|342309_343293_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	2.6e-43	37.2
WP_006763379.1\|343417_345424_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_035971710.1\|345523_346090_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.7e-27	41.1
WP_006763381.1\|346115_346730_+	LysE family translocator	NA	NA	NA	NA
WP_035971712.1\|346735_347602_+	DUF4743 domain-containing protein	NA	NA	NA	NA
WP_035973267.1\|347669_348554_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	1.1e-13	35.7
WP_006763384.1\|348632_349715_-	hypothetical protein	NA	NA	NA	NA
WP_006763385.1\|349938_352824_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	4.8e-303	54.3
WP_006763386.1\|353086_354274_+	MFS transporter	NA	NA	NA	NA
WP_006763387.1\|354375_354921_+	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	6.0e-50	88.1
WP_006763388.1\|355177_355600_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.3e-46	63.8

DBSCAN-SWA_29

379360 : 380185

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763410.1\|379360_380185_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.2e-38	36.8

DBSCAN-SWA_30

389907 : 395137

Tetraselmis_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763418.1\|389907_391485_+	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2P0VMP1	Tetraselmis_virus	1.0e-28	26.5
WP_035971723.1\|391502_392129_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035971724.1\|392225_392555_+	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_006763420.1\|392616_393267_+	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.1e-13	29.0
WP_006763421.1\|393334_395137_+\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	2.4e-18	30.0

DBSCAN-SWA_31

406713 : 408585

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971736.1\|406713_408585_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	2.5e-42	27.5

DBSCAN-SWA_32

423954 : 425583

uncultured_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763445.1\|423954_425583_+	hypothetical protein	D6PFH9	uncultured_phage	2.8e-10	27.9

DBSCAN-SWA_33

430462 : 431509

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552409.1\|430462_431509_-	PhoH family protein	H6X2N1	Pseudomonas_phage	3.2e-47	48.2

DBSCAN-SWA_34

436690 : 437401

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763454.1\|436690_437401_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.0e-42	44.7

DBSCAN-SWA_35

445526 : 446243

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763462.1\|445526_446243_-	aquaporin family protein	M1HJ77	Paramecium_bursaria_Chlorella_virus	4.9e-23	32.5

DBSCAN-SWA_36

450590 : 451370

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971753.1\|450590_451370_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.1e-23	30.2

DBSCAN-SWA_37

454944 : 456375

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971757.1\|454944_456375_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-54	34.0

DBSCAN-SWA_38

460114 : 461263

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971761.1\|460114_461263_-	galactonate dehydratase	Q6A202	Oenococcus_phage	5.3e-56	33.7

DBSCAN-SWA_39

472962 : 476524

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971768.1\|472962_474516_-	sensor histidine kinase	A0A1V0SGX0	Hokovirus	4.4e-05	24.5
WP_035971770.1\|474532_475264_-	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	9.4e-06	29.2
WP_006763488.1\|475453_476524_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	9.5e-116	62.8

DBSCAN-SWA_40

480531 : 481236

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971771.1\|480531_481236_+	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.5e-37	46.3

DBSCAN-SWA_41

504075 : 507828

Mollivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763510.1\|504075_504966_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.0e-54	39.1
WP_006763511.1\|504982_505504_+	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_006763512.1\|505594_506788_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_035971791.1\|506799_507828_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	8.2e-40	38.4

DBSCAN-SWA_42

512832 : 515773

Bacillus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763518.1\|512832_514179_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.0e-18	29.8
WP_006763519.1\|514288_515773_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.6e-26	30.6

DBSCAN-SWA_43

526220 : 534051

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971810.1\|526220_527597_-	purine permease	Q9KX94	Enterobacteria_phage	3.5e-30	30.7
WP_035971811.1\|528058_529510_+	carbohydrate kinase	NA	NA	NA	NA
WP_123806814.1\|529493_529817_-	hypothetical protein	NA	NA	NA	NA
WP_006763529.1\|530077_531184_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.5e-34	30.2
WP_006763530.1\|531198_532047_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_035973283.1\|532385_533171_-	metal ABC transporter permease	NA	NA	NA	NA
WP_035971814.1\|533163_534051_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-10	23.7

DBSCAN-SWA_44

542259 : 546377

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763541.1\|542259_542988_+	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	2.5e-06	42.7
WP_006763542.1\|543064_544174_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	4.0e-24	35.0
WP_006763543.1\|544187_545072_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035971820.1\|545186_546377_+	serine hydrolase	A0A0B5A4V6	Mycobacterium_phage	3.5e-10	30.7

DBSCAN-SWA_45

550249 : 551644

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763547.1\|550249_551644_-	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	8.0e-46	30.2

DBSCAN-SWA_46

560932 : 573627

Orpheovirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763557.1\|560932_562153_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	3.1e-46	33.1
WP_006763558.1\|562271_562916_-	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_006763559.1\|563045_563903_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.4e-13	32.0
WP_006763560.1\|564048_564897_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	3.7e-14	37.8
WP_035971825.1\|564948_565830_-	pirin family protein	NA	NA	NA	NA
WP_174484794.1\|566098_566977_+	EamA family transporter	NA	NA	NA	NA
WP_045552415.1\|567029_568568_-	N-acetylmuramoyl-L-alanine amidase	Q5YA51	Bacillus_phage	7.5e-13	28.9
WP_035971828.1\|568549_569104_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_006763564.1\|569121_570357_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_006763566.1\|570482_570953_+	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_006763567.1\|570949_571900_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	9.0e-25	29.5
WP_006763568.1\|572064_573627_-	AMP-binding protein	A0A1V0SBX8	Catovirus	6.7e-17	28.1

DBSCAN-SWA_47

576979 : 577909

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763572.1\|576979_577909_-	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.4e-22	27.0

DBSCAN-SWA_48

585371 : 587681

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971834.1\|585371_586754_+	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	3.6e-30	29.8
WP_035971835.1\|587099_587681_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.8e-44	44.8

DBSCAN-SWA_49

601418 : 606974

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971848.1\|601418_603530_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.7e-55	26.4
WP_035971849.1\|603726_604227_-	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	3.2e-13	41.2
WP_080599357.1\|604385_604601_-	hypothetical protein	NA	NA	NA	NA
WP_006763594.1\|604879_605458_-	pseudouridine synthase	NA	NA	NA	NA
WP_035971851.1\|605509_605719_-	hypothetical protein	NA	NA	NA	NA
WP_006763595.1\|605717_606974_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.5e-11	63.0

DBSCAN-SWA_50

612154 : 624163

Lake_Baikal_phage(14.29%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196460.1\|612154_612358_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_006398529.1\|612902_613217_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_045552418.1\|613213_615502_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.5e-163	41.0
WP_006763599.1\|615602_616982_+	amino acid permease	NA	NA	NA	NA
WP_006763600.1\|617163_617610_-	dUTP diphosphatase	A0A0A0YRI4	Escherichia_phage	7.4e-46	65.3
WP_006763601.1\|617665_618877_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.2e-43	32.7
WP_006763602.1\|618944_619445_-	lipoprotein signal peptidase	NA	NA	NA	NA
WP_006763603.1\|619448_622286_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	6.3e-82	26.1
WP_006763604.1\|622384_623377_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_006763605.1\|623500_624163_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	5.7e-26	40.0

DBSCAN-SWA_51

639357 : 641934

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763617.1\|639357_640074_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-15	26.9
WP_006763618.1\|640281_640737_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_035971864.1\|640749_641934_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	3.0e-25	27.1

DBSCAN-SWA_52

659170 : 660487

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763638.1\|659170_660487_+	sulfate adenylyltransferase subunit 1	A0A1V0SGC3	Hokovirus	3.0e-34	29.8

DBSCAN-SWA_53

664195 : 665707

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763643.1\|664195_665707_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	8.1e-52	40.0

DBSCAN-SWA_54

674221 : 677976

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971873.1\|674221_676135_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.8e-06	32.0
WP_035973294.1\|676174_677173_+	iron ABC transporter permease	NA	NA	NA	NA
WP_035971875.1\|677169_677976_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-10	26.8

DBSCAN-SWA_55

686363 : 687023

Vibrio_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763663.1\|686363_687023_+	ParA family protein	A2I303	Vibrio_virus	1.4e-13	35.4

DBSCAN-SWA_56

696124 : 698287

Indivirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971888.1\|696124_698287_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.7e-53	28.7

DBSCAN-SWA_57

701529 : 702099

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398615.1\|701529_702099_+	dCTP deaminase	S5VM63	Pseudomonas_phage	1.0e-71	70.6

DBSCAN-SWA_58

705340 : 708855

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552420.1\|705340_706165_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.7e-73	53.6
WP_123806816.1\|706164_706455_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006763677.1\|706529_707789_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_105773993.1\|707758_708061_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_035971898.1\|708171_708855_-	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	4.7e-07	26.0

DBSCAN-SWA_59

729563 : 733871

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763688.1\|729563_730091_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	2.0e-50	53.2
WP_035971913.1\|730145_730745_-	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	2.2e-08	44.4
WP_035971914.1\|730885_732064_-	N-acetyltransferase	NA	NA	NA	NA
WP_035973296.1\|732173_733871_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	2.6e-91	36.9

DBSCAN-SWA_60

737693 : 738473

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763695.1\|737693_738473_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.4e-17	28.8

DBSCAN-SWA_61

742012 : 742738

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006755678.1\|742012_742738_+	response regulator	W8CYM9	Bacillus_phage	8.4e-31	35.8

DBSCAN-SWA_62

746597 : 747935

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552421.1\|746597_747935_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-32	37.2

DBSCAN-SWA_63

751083 : 751677

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763706.1\|751083_751677_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	6.6e-26	64.0

DBSCAN-SWA_64

757069 : 763543

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763715.1\|757069_759100_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.2e-22	41.4
WP_035971926.1\|759243_760014_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_123806818.1\|760095_760329_-	hypothetical protein	NA	NA	NA	NA
WP_035971928.1\|760990_761572_-	hypothetical protein	S5FXQ0	Shigella_phage	6.3e-21	40.9
WP_123806819.1\|761574_762534_-	hypothetical protein	NA	NA	NA	NA
WP_162487089.1\|762923_763073_+	hypothetical protein	NA	NA	NA	NA
WP_165802991.1\|763087_763543_+	AlpA family transcriptional regulator	A0A077K9Z8	Ralstonia_phage	2.0e-14	66.1

DBSCAN-SWA_65

766927 : 806070

Burkholderia_virus(31.82%)

head,integrase,tail

attL 773267:773284|attR 813692:813709

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971938.1\|766927_767110_+	hypothetical protein	A0A127KNC5	Pseudomonas_phage	4.0e-06	41.7
WP_052688657.1\|767102_768101_+	DUF1376 domain-containing protein	A9YWY6	Burkholderia_phage	4.2e-25	49.6
WP_006763718.1\|768097_768589_+	hypothetical protein	NA	NA	NA	NA
WP_006763719.1\|768576_769539_+	AAA family ATPase	K4NWL6	Pseudomonas_phage	4.6e-61	41.6
WP_035971941.1\|769618_769816_+	hypothetical protein	NA	NA	NA	NA
WP_123806822.1\|769787_769967_-	hypothetical protein	NA	NA	NA	NA
WP_123806823.1\|770106_770904_+	hypothetical protein	NA	NA	NA	NA
WP_045552423.1\|770907_771171_+	hypothetical protein	NA	NA	NA	NA
WP_035971942.1\|771231_771729_+	hypothetical protein	NA	NA	NA	NA
WP_035971943.1\|771740_772001_+	hypothetical protein	NA	NA	NA	NA
WP_006763721.1\|772243_773863_+\|head,tail	head-tail connector protein	A0A2H4J3N6	uncultured_Caudovirales_phage	1.1e-163	59.2
773267:773284	attL	NA	NA	NA	NA
WP_035971944.1\|773859_774111_+	hypothetical protein	NA	NA	NA	NA
WP_123806824.1\|774548_775496_+	hypothetical protein	NA	NA	NA	NA
WP_006763722.1\|775739_776627_+	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	1.2e-47	40.5
WP_105773944.1\|776693_777155_+	hypothetical protein	NA	NA	NA	NA
WP_035971947.1\|777229_777832_+	hypothetical protein	A0A2H4JCY7	uncultured_Caudovirales_phage	5.3e-47	51.1
WP_105773946.1\|779017_780235_+	hypothetical protein	A0A2H4J6H2	uncultured_Caudovirales_phage	2.4e-107	47.8
WP_035971948.1\|780239_780692_+	GNAT family N-acetyltransferase	A0A2H4J9Z5	uncultured_Caudovirales_phage	2.2e-21	39.1
WP_094190535.1\|780684_781185_+	hypothetical protein	NA	NA	NA	NA
WP_006763727.1\|781197_783294_+	hypothetical protein	Q6J1R2	Burkholderia_virus	3.9e-105	45.2
WP_006763728.1\|783295_785590_+	transglycosylase SLT domain-containing protein	Q6J1R1	Burkholderia_virus	3.4e-203	54.3
WP_006763729.1\|785593_788191_+	hypothetical protein	Q6J1R0	Burkholderia_virus	0.0e+00	78.4
WP_081293570.1\|788187_788682_+	HNH endonuclease	Q7Y5F9	Xanthomonas_virus	4.1e-29	43.1
WP_035971950.1\|788691_789084_+	hypothetical protein	NA	NA	NA	NA
WP_052688661.1\|790752_793119_+	hypothetical protein	Q6J1Q9	Burkholderia_virus	2.3e-69	51.0
WP_006763731.1\|793131_793467_+	hypothetical protein	Q6J1Q7	Burkholderia_virus	1.3e-50	95.5
WP_035971951.1\|793463_793742_+	hypothetical protein	Q6J1Q6	Burkholderia_virus	1.3e-40	91.1
WP_006763733.1\|793728_794148_+	glycoside hydrolase family protein	A0A1I9L2K1	Xanthomonas_phage	9.8e-16	39.0
WP_035971952.1\|794144_794642_+	DUF2514 family protein	Q6J1Q4	Burkholderia_virus	3.7e-54	76.7
WP_035971954.1\|794638_795610_+	hypothetical protein	NA	NA	NA	NA
WP_006763735.1\|795606_796665_-	acyltransferase	A9YX16	Burkholderia_phage	1.1e-23	33.5
WP_006763736.1\|796837_798040_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	5.2e-86	44.6
WP_006763737.1\|798448_798631_-	rubredoxin	NA	NA	NA	NA
WP_035971957.1\|798855_799260_+	DUF4399 domain-containing protein	NA	NA	NA	NA
WP_174484795.1\|799449_801435_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.2e-48	28.9
WP_006763740.1\|801698_803681_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.1e-92	34.7
WP_006763741.1\|803748_806070_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.1e-83	35.9
813692:813709	attR	NA	NA	NA	NA

DBSCAN-SWA_66

809721 : 812061

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552424.1\|809721_812061_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	2.1e-14	34.7

DBSCAN-SWA_67

818647 : 820546

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763753.1\|818647_820546_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	7.3e-119	38.2

DBSCAN-SWA_68

825763 : 826717

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763760.1\|825763_826717_-	transaldolase	A0A0E3F5V4	Synechococcus_phage	3.3e-11	30.4

DBSCAN-SWA_69

840567 : 845493

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971976.1\|840567_845493_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.2e-83	48.8

DBSCAN-SWA_70

848680 : 856084

Diachasmimorpha_longicaudata_entomopoxvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763776.1\|848680_850216_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.1e-54	35.6
WP_035971983.1\|850535_851429_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_035971986.1\|851461_852316_-	sulfurtransferase	NA	NA	NA	NA
WP_006763779.1\|852550_856084_+	DNA polymerase III subunit alpha	A0A0K1Y906	Streptomyces_phage	3.4e-186	36.3

DBSCAN-SWA_71

862137 : 863919

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094190536.1\|862137_863919_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	4.7e-43	25.3

DBSCAN-SWA_72

885931 : 888043

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972025.1\|885931_888043_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.6e-21	26.0

DBSCAN-SWA_73

897987 : 915547

Micromonas_sp._RCC1109_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972032.1\|897987_898605_+	DUF924 domain-containing protein	E3T4R4	Cafeteria_roenbergensis_virus	8.2e-11	28.9
WP_006763813.1\|898663_900562_-	hypothetical protein	NA	NA	NA	NA
WP_006763814.1\|900790_901552_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.0e-07	29.5
WP_006763815.1\|901574_902156_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	5.2e-15	34.9
WP_006763816.1\|902152_902896_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006763817.1\|903107_903644_-	diacylglycerol kinase	NA	NA	NA	NA
WP_006763818.1\|903640_904675_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_006763819.1\|904704_905643_-	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	4.7e-66	48.1
WP_035972035.1\|905908_906418_-	RDD family protein	NA	NA	NA	NA
WP_035972037.1\|906424_907186_-	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_006763821.1\|907212_907638_-	DUF3619 family protein	NA	NA	NA	NA
WP_006763822.1\|907634_908198_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_162487090.1\|908266_908665_-	hypothetical protein	NA	NA	NA	NA
WP_006763823.1\|908549_910313_+	acetolactate synthase 3 catalytic subunit	E5EQ70	Micromonas_sp._RCC1109_virus	1.7e-53	29.4
WP_006398781.1\|910427_910919_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_006415560.1\|911013_912030_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_006763824.1\|912157_912802_+	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	4.1e-13	28.4
WP_006763825.1\|912817_913690_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_006763826.1\|914002_915547_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	1.2e-07	24.9

DBSCAN-SWA_74

941068 : 941659

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763847.1\|941068_941659_+	NUDIX hydrolase	A0A2K9VDH1	Lactobacillus_phage	2.1e-11	37.8

DBSCAN-SWA_75

983582 : 987476

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763887.1\|983582_984167_-	TIGR00645 family protein	K4K6D8	Caulobacter_phage	2.6e-22	33.5
WP_035972060.1\|984281_985190_-	DMT family transporter	NA	NA	NA	NA
WP_158380472.1\|985312_985507_+	hypothetical protein	NA	NA	NA	NA
WP_006763889.1\|985493_987476_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.8e-80	44.2

DBSCAN-SWA_76

999379 : 1000903

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763898.1\|999379_1000903_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	2.5e-77	36.8

DBSCAN-SWA_77

1014055 : 1018225

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972079.1\|1014055_1018225_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	1.2e-49	29.8

DBSCAN-SWA_78

1032832 : 1035990

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972090.1\|1032832_1034920_-	M3 family metallopeptidase	A0A1V0SD92	Indivirus	9.8e-40	22.3
WP_035972093.1\|1035132_1035990_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.6e-39	41.9

DBSCAN-SWA_79

1044355 : 1046125

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972099.1\|1044355_1046125_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.7e-35	23.6

DBSCAN-SWA_80

1054910 : 1067963

Lake_Baikal_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763936.1\|1054910_1055318_+	Fe-S cluster assembly scaffold IscU	A0A2H4N7M4	Lake_Baikal_phage	3.1e-51	78.7
WP_011885413.1\|1055382_1055706_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.0e-25	52.3
WP_035973324.1\|1055802_1056330_+	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_006763939.1\|1056384_1058253_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.8e-101	41.9
WP_006401949.1\|1058340_1058682_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_006412879.1\|1058749_1058959_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_035972102.1\|1059101_1059827_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_006763941.1\|1060164_1061691_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	7.3e-85	36.4
WP_105773950.1\|1061763_1062868_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_035972104.1\|1063023_1064721_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	7.1e-57	29.9
WP_006763943.1\|1064732_1065809_-	hypothetical protein	NA	NA	NA	NA
WP_006763944.1\|1065958_1067212_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_035972105.1\|1067267_1067963_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	1.1e-32	40.0

DBSCAN-SWA_81

1072624 : 1076527

Only_Syngen_Nebraska_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763948.1\|1072624_1074286_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.4e-150	52.2
WP_006763949.1\|1074282_1075137_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.0e-47	40.5
WP_006478406.1\|1075243_1076527_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	3.8e-151	62.4

DBSCAN-SWA_82

1091998 : 1094656

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763967.1\|1091998_1094656_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.1e-24	23.4

DBSCAN-SWA_83

1098828 : 1102377

Bodo_saltans_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763971.1\|1098828_1099320_-	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	4.4e-07	29.6
WP_006763972.1\|1099408_1099984_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	1.8e-12	39.3
WP_035972123.1\|1100022_1100745_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_006763974.1\|1100979_1102377_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	7.0e-42	30.6

DBSCAN-SWA_84

1119051 : 1121477

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763987.1\|1119051_1120674_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-20	32.3
WP_006763988.1\|1120802_1121477_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	6.2e-20	37.1

DBSCAN-SWA_85

1133923 : 1138543

Diachasmimorpha_longicaudata_entomopoxvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972135.1\|1133923_1135447_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.7e-46	30.0
WP_006763999.1\|1135828_1136098_-	acyl-CoA-binding protein	NA	NA	NA	NA
WP_035972137.1\|1136245_1137013_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_035972139.1\|1137009_1137510_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_006764001.1\|1137496_1138543_+	uracil-DNA glycosylase	A0A1P8DII7	Virus_Rctr197k	6.7e-05	36.4

DBSCAN-SWA_86

1147011 : 1147491

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764009.1\|1147011_1147491_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	2.7e-25	39.6

DBSCAN-SWA_87

1159967 : 1162573

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764019.1\|1159967_1162043_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	4.2e-152	45.4
WP_006764020.1\|1162039_1162573_+	peptide deformylase	A0A1D8KUY1	Synechococcus_phage	8.6e-09	33.6

DBSCAN-SWA_88

1171480 : 1212091

Stx2-converting_phage(21.43%)

protease,integrase,transposase

attL 1176944:1176964|attR 1223612:1223632

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764028.1\|1171480_1172263_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.2e-19	38.3
WP_006764029.1\|1172256_1173078_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_035972158.1\|1173093_1174290_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_035972159.1\|1174301_1175672_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_006764032.1\|1175736_1178043_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
1176944:1176964	attL	NA	NA	NA	NA
WP_035972161.1\|1178107_1178605_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_006764034.1\|1178621_1179728_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_006495559.1\|1179857_1180325_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_006764035.1\|1180383_1181172_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_035972165.1\|1181175_1182345_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_006764036.1\|1182341_1182989_+	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	2.7e-28	42.8
WP_006764037.1\|1182985_1183768_+	RNA methyltransferase	NA	NA	NA	NA
WP_035972167.1\|1183882_1184698_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_006764039.1\|1185074_1187474_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	6.3e-168	35.7
WP_006764040.1\|1187598_1188033_+	NfeD family protein	NA	NA	NA	NA
WP_006764041.1\|1188066_1189002_+	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_006764042.1\|1189155_1189602_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.0e-26	42.1
WP_006764043.1\|1189700_1190138_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_006764044.1\|1190142_1190466_+	RnfH family protein	NA	NA	NA	NA
WP_006764045.1\|1190554_1191538_-	DMT family transporter	NA	NA	NA	NA
WP_006764046.1\|1191632_1192325_-	hypothetical protein	NA	NA	NA	NA
WP_035972169.1\|1192356_1193514_-	HTH domain-containing protein	NA	NA	NA	NA
WP_006764047.1\|1193627_1194392_+	DUF899 domain-containing protein	NA	NA	NA	NA
WP_045552515.1\|1194432_1195248_+	DUF2182 domain-containing protein	NA	NA	NA	NA
WP_006764048.1\|1195524_1196985_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.3e-95	39.6
WP_035972172.1\|1196991_1197609_+	hypothetical protein	NA	NA	NA	NA
WP_006764050.1\|1197724_1199344_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.5e-14	28.6
WP_006764051.1\|1199645_1200902_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9TCT6	Enterobacter_phage	1.0e-116	52.8
WP_081293581.1\|1200962_1201238_+	hypothetical protein	NA	NA	NA	NA
WP_035973335.1\|1201242_1201767_+	DNA-binding protein	J9Q7G7	Salmonella_phage	2.4e-11	36.0
WP_035972174.1\|1201835_1205075_+	hypothetical protein	NA	NA	NA	NA
WP_158380473.1\|1205138_1205783_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.5e-43	45.8
WP_006764054.1\|1205873_1206281_+	IS66 family insertion sequence hypothetical protein	B6DZU5	Stx2-converting_phage	1.5e-13	45.1
WP_006764055.1\|1206277_1206625_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_006764056.1\|1206654_1208217_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.6e-151	54.3
WP_006765345.1\|1208257_1208854_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	6.0e-27	38.6
WP_006764058.1\|1209097_1209361_-\|transposase	transposase	NA	NA	NA	NA
WP_006763677.1\|1210831_1212091_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
1223612:1223632	attR	NA	NA	NA	NA

DBSCAN-SWA_89

1231977 : 1232766

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972190.1\|1231977_1232766_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.8e-34	37.4

DBSCAN-SWA_90

1240217 : 1240793

Pandoravirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972193.1\|1240217_1240793_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	1.1e-06	31.6

DBSCAN-SWA_91

1272612 : 1273338

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199523.1\|1272612_1273338_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	8.1e-34	36.7

DBSCAN-SWA_92

1278465 : 1279575

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972202.1\|1278465_1279575_-	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	2.1e-41	32.9

DBSCAN-SWA_93

1287974 : 1292685

Agrobacterium_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408392.1\|1287974_1288628_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.3e-54	55.4
WP_006764117.1\|1288792_1290064_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.6e-133	58.5
WP_006764118.1\|1290261_1292685_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.4e-225	53.4

DBSCAN-SWA_94

1296353 : 1297067

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972210.1\|1296353_1297067_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.7e-31	39.6

DBSCAN-SWA_95

1302089 : 1318327

Burkholderia_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972215.1\|1302089_1306154_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	9.9e-222	92.1
WP_035972217.1\|1306161_1306713_+	N-acetyltransferase	NA	NA	NA	NA
WP_006764125.1\|1306863_1307646_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_006764126.1\|1307664_1307973_-	BolA family transcriptional regulator	NA	NA	NA	NA
WP_006764127.1\|1307974_1308505_-	septation protein A	NA	NA	NA	NA
WP_006764128.1\|1308644_1309076_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_035972219.1\|1309114_1310683_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	8.1e-55	31.7
WP_035972222.1\|1310828_1312472_+	fatty-acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.2e-21	25.4
WP_006764131.1\|1312673_1314758_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_035972224.1\|1314815_1315448_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	5.2e-21	37.1
WP_006764133.1\|1315497_1316676_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_045552429.1\|1316926_1318327_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.4e-18	32.0

DBSCAN-SWA_96

1325777 : 1326737

Acanthamoeba_polyphaga_lentillevirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764139.1\|1325777_1326737_+	alpha/beta hydrolase	J3IZC7	Acanthamoeba_polyphaga_lentillevirus	2.0e-32	31.6

DBSCAN-SWA_97

1330279 : 1330900

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764144.1\|1330279_1330900_+	dTMP kinase	A0A1L2BX49	Bacteriophage	2.8e-27	39.3

DBSCAN-SWA_98

1335385 : 1336567

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764150.1\|1335385_1336567_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	7.4e-69	39.6

DBSCAN-SWA_99

1344010 : 1345786

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764159.1\|1344010_1345786_-	glyoxylate carboligase	E4WLQ6	Ostreococcus_tauri_virus	7.3e-44	27.7

DBSCAN-SWA_100

1350397 : 1356946

Burkholderia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764165.1\|1350397_1351780_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	3.6e-139	58.9
WP_006764166.1\|1351918_1352545_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_006764167.1\|1352555_1353566_+	inorganic phosphate transporter	NA	NA	NA	NA
WP_035972242.1\|1353803_1354910_-	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	4.1e-13	35.6
WP_035972243.1\|1355146_1356946_-	PhoH family protein	A0A2I7SAD7	Vibrio_phage	9.5e-76	39.3

DBSCAN-SWA_101

1360753 : 1361776

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972248.1\|1360753_1361776_-	glycosyltransferase	S5FKN0	Shigella_phage	5.7e-33	29.8

DBSCAN-SWA_102

1373904 : 1376502

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764185.1\|1373904_1376502_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.7e-121	37.2

DBSCAN-SWA_103

1385448 : 1386564

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972275.1\|1385448_1386564_+	acetoin dehydrogenase dihydrolipoyllysine-residue acetyltransferase subunit	A0A1I9SC21	Mycobacterium_phage	6.6e-11	31.0

DBSCAN-SWA_104

1395812 : 1409889

uncultured_Mediterranean_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402348.1\|1395812_1396139_-	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	1.8e-17	44.1
WP_035972280.1\|1396749_1399113_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	3.1e-42	40.9
WP_006399891.1\|1399207_1399534_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_006764202.1\|1399565_1400162_+	recombination protein RecR	NA	NA	NA	NA
WP_035972281.1\|1400209_1401415_+	CoA transferase	NA	NA	NA	NA
WP_006764204.1\|1401530_1402292_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-65	51.6
WP_035972282.1\|1402288_1403212_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.9e-36	49.7
WP_006764206.1\|1403217_1404099_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_006764207.1\|1404110_1405196_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.0e-32	35.4
WP_006764208.1\|1405199_1405976_+	3'-5' exonuclease	NA	NA	NA	NA
WP_035972284.1\|1406008_1406863_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_006764210.1\|1407051_1408449_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.7e-27	24.7
WP_035972285.1\|1408514_1409213_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_006764212.1\|1409463_1409889_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	2.3e-20	42.1

DBSCAN-SWA_105

1424018 : 1428151

Powai_lake_megavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764225.1\|1424018_1425365_+	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	4.0e-71	36.8
WP_006764226.1\|1425370_1425967_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_006764227.1\|1426237_1428151_+	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	2.6e-79	32.8

DBSCAN-SWA_106

1431865 : 1434112

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764231.1\|1431865_1434112_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	5.3e-76	29.3

DBSCAN-SWA_107

1453372 : 1454074

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972308.1\|1453372_1454074_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	6.2e-07	26.9

DBSCAN-SWA_108

1457320 : 1458913

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972312.1\|1457320_1458913_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	1.8e-54	27.2

DBSCAN-SWA_109

1463732 : 1465819

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764259.1\|1463732_1464893_+	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.3e-22	33.7
WP_006764260.1\|1464889_1465819_+	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	9.8e-08	23.3

DBSCAN-SWA_110

1476289 : 1479442

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764268.1\|1476289_1479442_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	5.5e-10	18.2

DBSCAN-SWA_111

1488690 : 1491041

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764276.1\|1488690_1489656_+	D-glycerate dehydrogenase	M1I539	Acanthocystis_turfacea_Chlorella_virus	1.3e-18	27.8
WP_006764277.1\|1489997_1491041_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-13	25.9

DBSCAN-SWA_112

1501148 : 1502408

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763677.1\|1501148_1502408_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0

DBSCAN-SWA_113

1522383 : 1530737

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972363.1\|1522383_1525614_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.0e-59	22.9
WP_035972364.1\|1525663_1527085_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_035972365.1\|1527113_1528604_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_006764311.1\|1528584_1530063_-	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	5.2e-19	27.6
WP_006764312.1\|1530059_1530737_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	9.9e-34	36.1

DBSCAN-SWA_114

1535306 : 1536386

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972375.1\|1535306_1536386_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-23	37.3

DBSCAN-SWA_115

1572193 : 1588931

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972402.1\|1572193_1577176_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.6e-48	22.6
WP_035972403.1\|1577197_1586893_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	4.2e-93	23.5
WP_035972404.1\|1587185_1588931_+	cyclic peptide export ABC transporter	G9BWD6	Planktothrix_phage	1.2e-14	25.3

DBSCAN-SWA_116

1592972 : 1593821

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972409.1\|1592972_1593821_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.5e-10	25.5

DBSCAN-SWA_117

1598930 : 1605656

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972417.1\|1598930_1602065_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.3e-51	21.6
WP_006764344.1\|1602080_1603283_-	MexX/AxyX family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_006764345.1\|1603433_1604081_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_035972419.1\|1604420_1605656_+	M23 family metallopeptidase	A0A222Z0G0	Rhodococcus_phage	9.3e-14	46.0

DBSCAN-SWA_118

1608676 : 1626018

Burkholderia_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764350.1\|1608676_1609981_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.5e-43	30.8
WP_006764351.1\|1610224_1611901_-	SpoVR family protein	NA	NA	NA	NA
WP_006764352.1\|1611897_1613166_-	YeaH/YhbH family protein	A0A219UQP6	Bacillus_phage	2.4e-09	37.2
WP_006764353.1\|1613291_1615214_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_035972424.1\|1615756_1617547_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.3e-10	29.2
WP_006764355.1\|1617810_1618740_-	ribokinase	NA	NA	NA	NA
WP_035972425.1\|1618736_1619768_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	8.0e-35	31.4
WP_006764357.1\|1619801_1620821_-	ABC transporter permease	NA	NA	NA	NA
WP_035972426.1\|1620817_1622431_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.0e-09	26.1
WP_035972427.1\|1622576_1623521_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006764360.1\|1623959_1624886_-	CysB family HTH-type transcriptional regulator	NA	NA	NA	NA
WP_035972428.1\|1624959_1626018_-	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-28	33.2

DBSCAN-SWA_119

1629296 : 1632906

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400150.1\|1629296_1629944_+	transcriptional repressor LexA	F1C5A6	Cronobacter_phage	4.3e-10	39.0
WP_006764364.1\|1629969_1630305_+	hypothetical protein	NA	NA	NA	NA
WP_035972430.1\|1630336_1631044_+	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_006764365.1\|1631139_1631637_-	universal stress protein	NA	NA	NA	NA
WP_035972432.1\|1631991_1632906_+	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	3.8e-28	27.8

DBSCAN-SWA_120

1636658 : 1640505

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764371.1\|1636658_1637612_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.1e-09	30.6
WP_006764372.1\|1637764_1639183_+	M20 family metallopeptidase	NA	NA	NA	NA
WP_035972435.1\|1639218_1640505_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.2e-85	42.0

DBSCAN-SWA_121

1649771 : 1705238

Burkholderia_phage(53.23%)

terminase,plate,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764383.1\|1649771_1650467_-	SOS response-associated peptidase family protein	Q8W6R8	Burkholderia_virus	2.7e-95	72.2
WP_052688675.1\|1650604_1650988_+	hypothetical protein	NA	NA	NA	NA
WP_045552433.1\|1651062_1651500_+	hypothetical protein	NA	NA	NA	NA
WP_045552434.1\|1651512_1651989_-	DUF2514 family protein	Q3HQV1	Burkholderia_phage	1.3e-56	85.7
WP_006764384.1\|1651988_1652486_-	lysozyme	Q3HQU9	Burkholderia_phage	4.3e-79	87.9
WP_045552435.1\|1652478_1652661_-	hypothetical protein	NA	NA	NA	NA
WP_123806836.1\|1652758_1653943_+	hypothetical protein	NA	NA	NA	NA
WP_045552437.1\|1654171_1655164_-	hypothetical protein	A9YX14	Burkholderia_phage	1.9e-62	37.0
WP_045552438.1\|1655227_1655893_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	1.4e-112	88.1
WP_006764386.1\|1655892_1657074_-\|plate	baseplate J/gp47 family protein	A9YX12	Burkholderia_phage	3.1e-192	91.6
WP_045552439.1\|1657070_1657424_-	hypothetical protein	A9YX11	Burkholderia_phage	2.8e-56	94.9
WP_052688677.1\|1657428_1657905_-	HNH endonuclease	A0A0E3M1E6	Bacillus_phage	4.1e-18	40.0
WP_006764388.1\|1657913_1658663_-	hypothetical protein	A9YX06	Burkholderia_phage	3.8e-127	93.6
WP_006764389.1\|1658666_1659044_+	hypothetical protein	A9YX05	Burkholderia_phage	2.6e-60	91.2
WP_045552440.1\|1659040_1660009_-	hypothetical protein	A9YX04	Burkholderia_phage	5.2e-145	88.6
WP_045552441.1\|1660005_1660323_-	hypothetical protein	NA	NA	NA	NA
WP_045552442.1\|1660322_1660898_-	hypothetical protein	A0A0M3ULD5	Salmonella_phage	2.0e-19	36.8
WP_006764391.1\|1660894_1662889_-	hypothetical protein	A0A0M4REK7	Salmonella_phage	9.7e-37	35.0
WP_045552443.1\|1663072_1663642_-	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	6.4e-18	35.4
WP_045552444.1\|1663650_1664148_-	HNH endonuclease	Q2NPG0	Xanthomonas_virus	2.7e-33	45.6
WP_006764395.1\|1664147_1664588_-	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	7.1e-41	57.5
WP_006764396.1\|1664603_1666079_-	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	1.1e-109	46.7
WP_158380477.1\|1666193_1666676_+	HNH endonuclease	A0A220GJG3	Streptococcus_phage	1.0e-16	38.2
WP_006764397.1\|1666663_1667242_-	hypothetical protein	A9YX29	Burkholderia_phage	2.0e-91	88.2
WP_045552446.1\|1667246_1667618_-	hypothetical protein	A9YX28	Burkholderia_phage	7.2e-63	94.3
WP_006764399.1\|1667679_1668162_-	hypothetical protein	A9YX26	Burkholderia_phage	4.2e-71	88.7
WP_006764400.1\|1668189_1668573_-	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	1.3e-59	90.6
WP_045552447.1\|1668632_1669118_-	hypothetical protein	A9YX24	Burkholderia_phage	3.5e-17	78.4
WP_006764401.1\|1669119_1670211_-	DUF2184 domain-containing protein	A9YX23	Burkholderia_phage	8.4e-152	92.0
WP_045552448.1\|1670278_1670785_-	hypothetical protein	NA	NA	NA	NA
WP_006764402.1\|1670794_1672246_-	DUF2213 domain-containing protein	A9YX03	Burkholderia_phage	4.3e-212	89.9
WP_045552449.1\|1672417_1672711_-	hypothetical protein	A9YWZ9	Burkholderia_phage	1.1e-53	92.8
WP_006764404.1\|1672712_1673468_-\|capsid	minor capsid protein	A9YWZ8	Burkholderia_phage	9.7e-131	96.0
WP_006764405.1\|1673464_1674931_-	DUF1073 domain-containing protein	A9YWZ7	Burkholderia_phage	5.8e-265	94.8
WP_006764406.1\|1674951_1676505_-\|terminase	phage terminase large subunit	H9C0C7	Vibrio_phage	8.7e-110	45.4
WP_006764407.1\|1676455_1676935_-	DUF2280 domain-containing protein	A9YWZ5	Burkholderia_phage	4.1e-58	78.9
WP_006764408.1\|1676952_1677606_-	hypothetical protein	A9YWZ4	Burkholderia_phage	1.1e-103	84.9
WP_045552450.1\|1677602_1677782_-	hypothetical protein	NA	NA	NA	NA
WP_045552451.1\|1677906_1678338_-	hypothetical protein	NA	NA	NA	NA
WP_045552452.1\|1678334_1678664_-	hypothetical protein	A9YWZ0	Burkholderia_phage	6.1e-21	60.2
WP_006764411.1\|1678674_1679145_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	1.4e-63	80.1
WP_045552453.1\|1679141_1679402_-	hypothetical protein	NA	NA	NA	NA
WP_045552520.1\|1679398_1679830_-	hypothetical protein	NA	NA	NA	NA
WP_006764413.1\|1680498_1681476_-	phosphoadenosine phosphosulfate reductase family protein	Q8W6P3	Burkholderia_virus	6.6e-140	73.6
WP_045552522.1\|1681472_1681943_-	hypothetical protein	Q6JIG5	Burkholderia_virus	9.8e-65	80.0
WP_045552455.1\|1681996_1682644_+	hypothetical protein	NA	NA	NA	NA
WP_045552523.1\|1682700_1682916_-	hypothetical protein	A9YWY0	Burkholderia_phage	3.0e-29	85.7
WP_045552456.1\|1682918_1683293_-	hypothetical protein	A9YWX9	Burkholderia_phage	1.7e-59	87.9
WP_045552457.1\|1683459_1683840_+	hypothetical protein	NA	NA	NA	NA
WP_045552458.1\|1683990_1684236_-	helix-turn-helix domain-containing protein	A0A0M3LQ90	Mannheimia_phage	2.2e-12	47.3
WP_045552459.1\|1684322_1684709_+	hypothetical protein	A9YWX7	Burkholderia_phage	2.4e-08	64.3
WP_006764415.1\|1685716_1686133_+	hypothetical protein	NA	NA	NA	NA
WP_123806838.1\|1686229_1686961_+	hypothetical protein	A0A291L9Z7	Bordetella_phage	2.3e-73	57.2
WP_045552462.1\|1687362_1687653_+	hypothetical protein	Q6V7Q5	Burkholderia_virus	1.0e-24	60.8
WP_045552463.1\|1687649_1687829_+	hypothetical protein	A9YWW6	Burkholderia_phage	2.5e-13	69.0
WP_165802997.1\|1687825_1687996_+	hypothetical protein	NA	NA	NA	NA
WP_165802996.1\|1687992_1688136_+	hypothetical protein	A9YWW4	Burkholderia_phage	2.7e-10	73.9
WP_006764418.1\|1688132_1688942_+	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	8.0e-91	60.9
WP_045552464.1\|1688956_1690156_+	hypothetical protein	J7HXB6	Pseudomonas_phage	1.1e-62	52.2
WP_045552465.1\|1690168_1691935_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	5.7e-73	37.0
WP_006764420.1\|1691931_1692567_+	hypothetical protein	A9YX18	Burkholderia_phage	2.1e-17	85.2
WP_105773984.1\|1692792_1694289_+	hypothetical protein	A0A0K2FMB2	Brevibacillus_phage	1.4e-80	45.3
WP_045552466.1\|1694294_1694747_+	hypothetical protein	A9YX19	Burkholderia_phage	6.3e-77	90.8
WP_045552467.1\|1694743_1694938_+	hypothetical protein	A9YX20	Burkholderia_phage	1.7e-18	82.1
WP_105773983.1\|1694942_1695422_+	hypothetical protein	A0A0K2FHI1	Achromobacter_phage	5.0e-32	48.2
WP_045552468.1\|1695561_1695885_+	hypothetical protein	A0A076G9A8	Mycobacterium_phage	2.7e-05	31.3
WP_006764424.1\|1695917_1696742_+	YfdQ family protein	I6NVL7	Burkholderia_virus	1.9e-39	37.5
WP_006764425.1\|1696971_1698981_+	DNA cytosine methyltransferase	A9YX21	Burkholderia_phage	2.9e-158	74.8
WP_006764426.1\|1698977_1700012_+	site-specific DNA-methyltransferase	Q8W6P4	Burkholderia_virus	1.2e-134	66.8
WP_006764427.1\|1700030_1700825_+	hypothetical protein	B5WZW7	Pseudomonas_phage	7.8e-22	46.1
WP_045552470.1\|1700821_1702138_+	hypothetical protein	A4JWW2	Burkholderia_virus	1.0e-10	56.2
WP_123806839.1\|1702127_1702499_+	hypothetical protein	Q6JIJ2	Burkholderia_virus	5.6e-07	41.2
WP_006764430.1\|1702501_1702711_-	hypothetical protein	A9YWV5	Burkholderia_phage	2.8e-24	77.9
WP_045552471.1\|1702746_1703667_+	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	5.5e-128	66.9
WP_045552472.1\|1703669_1704005_-	hypothetical protein	NA	NA	NA	NA
WP_006764431.1\|1704042_1704531_+	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	5.4e-42	52.5
WP_006764432.1\|1704527_1705238_+	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	3.6e-34	42.9

DBSCAN-SWA_122

1708714 : 1709674

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972446.1\|1708714_1709674_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-29	38.1

DBSCAN-SWA_123

1722968 : 1727254

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764450.1\|1722968_1723826_-	N-acetylmuramoyl-L-alanine amidase	A0A223VZK2	Agrobacterium_phage	6.9e-08	29.9
WP_035972455.1\|1723909_1724653_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_035972456.1\|1724794_1727254_-	ribonuclease R	Q0GXV6	Lactococcus_phage	7.7e-68	32.7

DBSCAN-SWA_124

1731086 : 1732640

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972459.1\|1731086_1732640_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	27.5

DBSCAN-SWA_125

1741900 : 1743658

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764461.1\|1741900_1743658_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.1e-39	27.0

DBSCAN-SWA_126

1767637 : 1769068

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764481.1\|1767637_1769068_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.8e-43	28.0

DBSCAN-SWA_127

1782404 : 1785314

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972495.1\|1782404_1785314_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	5.2e-23	25.3

DBSCAN-SWA_128

1789526 : 1790573

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972499.1\|1789526_1790573_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.4e-23	35.7

DBSCAN-SWA_129

1802005 : 1809475

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006486093.1\|1802005_1802392_-	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	3.5e-12	41.1
WP_006764504.1\|1802465_1804895_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_035972514.1\|1804976_1805990_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	5.1e-26	38.6
WP_006764506.1\|1806219_1806579_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_004191477.1\|1806609_1806807_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_071734130.1\|1806993_1807518_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.1e-11	29.3
WP_006764507.1\|1807567_1809475_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	9.0e-125	36.9

DBSCAN-SWA_130

1826013 : 1827114

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972523.1\|1826013_1827114_-	chorismate synthase	A0A291AU41	Pandoravirus	2.5e-79	44.5

DBSCAN-SWA_131

1834356 : 1835187

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973366.1\|1834356_1835187_+	metallophosphoesterase	A0A291ATQ8	Pandoravirus	3.0e-24	28.6

DBSCAN-SWA_132

1841552 : 1852144

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972533.1\|1841552_1843226_-	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-09	44.7
WP_006764534.1\|1843620_1844862_+	MFS transporter	NA	NA	NA	NA
WP_035972534.1\|1844940_1845738_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_006764536.1\|1845734_1848095_-	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	4.4e-73	31.9
WP_006764537.1\|1848307_1851172_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.5e-147	39.8
WP_006764538.1\|1851259_1852144_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.7e-70	48.3

DBSCAN-SWA_133

1867694 : 1869251

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764552.1\|1867694_1869251_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.1e-15	24.8

DBSCAN-SWA_134

1877822 : 1879276

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972552.1\|1877822_1878527_-	ATP-binding cassette domain-containing protein	F2Y302	Organic_Lake_phycodnavirus	6.9e-06	28.8
WP_035972554.1\|1878523_1879276_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	8.2e-13	28.6

DBSCAN-SWA_135

1885171 : 1887799

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972560.1\|1885171_1887799_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	2.2e-81	39.3

DBSCAN-SWA_136

1892670 : 1894977

Escherichia_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764572.1\|1892670_1894380_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	3.7e-186	58.0
WP_035973368.1\|1894506_1894977_-	NUDIX hydrolase	A0A023W5N2	Serratia_phage	3.8e-24	46.7

DBSCAN-SWA_137

1927941 : 1929771

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972599.1\|1927941_1929771_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.0e-13	42.4

DBSCAN-SWA_138

1938845 : 1945166

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973377.1\|1938845_1939571_+	response regulator	W8CYM9	Bacillus_phage	2.9e-31	33.3
WP_006764603.1\|1939571_1940942_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	6.5e-16	24.2
WP_035972609.1\|1941506_1945166_+	PAS domain-containing protein	B5LWA6	Feldmannia_species_virus	1.0e-12	24.0

DBSCAN-SWA_139

1948198 : 1964862

Moraxella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764606.1\|1948198_1958338_-	contact-dependent inhibition toxin BcpA	A0A0R6PJK4	Moraxella_phage	1.6e-26	29.5
WP_006764607.1\|1958876_1960241_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	5.0e-69	35.8
WP_006764608.1\|1960300_1961122_-	alpha/beta hydrolase	A0A2R4AP45	Mycobacterium_phage	7.0e-18	30.5
WP_006764609.1\|1961157_1962165_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_035972613.1\|1962201_1963056_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_006764610.1\|1963099_1963819_-	hypothetical protein	NA	NA	NA	NA
WP_006764611.1\|1963815_1964862_-	alcohol dehydrogenase catalytic domain-containing protein	M1PHA2	Moumouvirus	1.4e-23	25.6

DBSCAN-SWA_140

1986557 : 1989247

Corynebacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764628.1\|1986557_1987259_+	peptidoglycan DD-metalloendopeptidase family protein	A0A1W6JQH9	Corynebacterium_phage	1.8e-06	38.1
WP_035972632.1\|1987627_1989247_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	8.9e-65	34.5

DBSCAN-SWA_141

2002977 : 2014388

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764640.1\|2002977_2004297_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	8.6e-34	35.1
WP_035972642.1\|2004354_2005056_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	2.3e-33	37.3
WP_006764642.1\|2005090_2005795_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_006764643.1\|2005813_2006662_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	9.5e-18	34.4
WP_006764644.1\|2006677_2007571_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_035972644.1\|2007567_2008554_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_006764646.1\|2008648_2009683_-	phosphate ABC transporter substrate-binding protein PstS	A0A1D7SRJ6	Cyanophage	6.5e-45	35.6
WP_006764647.1\|2010134_2011490_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_006764648.1\|2011519_2012461_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	8.1e-26	34.7
WP_035972647.1\|2012489_2014388_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	C7U047	Ostreococcus_tauri_virus	1.5e-111	41.1

DBSCAN-SWA_142

2021042 : 2030909

Halovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972651.1\|2021042_2022188_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	6.5e-46	34.0
WP_035972653.1\|2022568_2023786_-	MFS transporter	NA	NA	NA	NA
WP_006764657.1\|2023966_2025559_-	transglycosylase SLT domain-containing protein	U5PVY0	Bacillus_phage	6.4e-07	36.4
WP_006764658.1\|2025710_2026517_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_006764660.1\|2027344_2027788_+	ribonuclease HI	J9Q745	Salmonella_phage	4.0e-44	55.2
WP_006764661.1\|2027826_2028561_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	2.1e-37	39.3
WP_035973384.1\|2028583_2028916_-	YnfA family protein	A0A218MNG8	uncultured_virus	8.2e-26	54.6
WP_045552478.1\|2029421_2030909_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	2.3e-59	32.3

DBSCAN-SWA_143

2046325 : 2047081

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972668.1\|2046325_2047081_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	3.7e-37	37.9

DBSCAN-SWA_144

2051230 : 2054893

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764683.1\|2051230_2052253_-	histone deacetylase family protein	A0A0N9QAS6	Chrysochromulina_ericina_virus	1.0e-21	29.0
WP_035972674.1\|2052252_2053551_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_006764685.1\|2053582_2054893_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	9.5e-41	30.7

DBSCAN-SWA_145

2065183 : 2066215

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764692.1\|2065183_2066215_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-22	32.4

DBSCAN-SWA_146

2080543 : 2086665

Virus_Rctr197k(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552479.1\|2080543_2082955_-	AAA family ATPase	A0A1P8DII4	Virus_Rctr197k	2.5e-02	38.8
WP_035972687.1\|2082951_2086665_-	exodeoxyribonuclease V subunit beta	G3MA40	Bacillus_virus	3.5e-08	30.8

DBSCAN-SWA_147

2095960 : 2096734

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552480.1\|2095960_2096734_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-23	35.4

DBSCAN-SWA_148

2113836 : 2184586

Stx2-converting_phage(25.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552534.1\|2113836_2114967_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_035972705.1\|2115483_2116932_-	NYN domain-containing protein	A0A2P0VNQ4	Tetraselmis_virus	2.9e-06	33.0
WP_006764722.1\|2117226_2117853_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_035972708.1\|2117908_2118457_-	peroxiredoxin	NA	NA	NA	NA
WP_035972710.1\|2118640_2120473_+	sensor domain-containing phosphodiesterase	NA	NA	NA	NA
WP_035972712.1\|2120500_2122000_+	HDOD domain-containing protein	NA	NA	NA	NA
WP_035972714.1\|2122099_2122894_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035972715.1\|2123199_2124258_-	succinylglutamate desuccinylase	NA	NA	NA	NA
WP_035972717.1\|2124241_2125582_-	N-succinylarginine dihydrolase	NA	NA	NA	NA
WP_035972719.1\|2125596_2127060_-	succinylglutamate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_035972720.1\|2127067_2128114_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_006764730.1\|2128110_2129178_-	arginine/ornithine succinyltransferase subunit alpha	NA	NA	NA	NA
WP_006764731.1\|2129208_2130441_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_094190579.1\|2130634_2131764_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-50	43.5
WP_165802993.1\|2132136_2132292_-	hypothetical protein	A0A1S5NTJ1	Burkholderia_phage	4.7e-16	78.0
WP_123806846.1\|2132438_2134928_+	hypothetical protein	NA	NA	NA	NA
WP_165802994.1\|2135056_2136254_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	6.7e-102	64.8
WP_123806847.1\|2137914_2138868_-	hypothetical protein	NA	NA	NA	NA
WP_123806848.1\|2139412_2139676_+	hypothetical protein	NA	NA	NA	NA
WP_006764737.1\|2139793_2140834_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_006764738.1\|2140856_2141651_-	ATP-binding cassette domain-containing protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	9.2e-07	23.1
WP_006764739.1\|2141672_2142386_-	ABC transporter permease	NA	NA	NA	NA
WP_035972727.1\|2142382_2143072_-	histidine ABC transporter permease HisQ	NA	NA	NA	NA
WP_006764740.1\|2143346_2143904_-	hypothetical protein	NA	NA	NA	NA
WP_035972729.1\|2144012_2145050_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_035972731.1\|2145046_2145931_-	hopanoid biosynthesis-associated protein HpnK	NA	NA	NA	NA
WP_035972733.1\|2145934_2147356_-	hopanoid biosynthesis associated radical SAM protein HpnJ	NA	NA	NA	NA
WP_035972735.1\|2147516_2148692_-	bacteriohopanetetrol glucosamine biosynthesis glycosyltransferase HpnI	NA	NA	NA	NA
WP_035972737.1\|2149322_2150321_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_006764746.1\|2150378_2151440_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_006764747.1\|2151614_2152475_+	pyridoxal kinase PdxY	NA	NA	NA	NA
WP_035972739.1\|2152733_2154875_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_006764750.1\|2155241_2156390_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035972741.1\|2156615_2157377_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_006764752.1\|2157797_2159150_+	glucarate dehydratase	NA	NA	NA	NA
WP_006764753.1\|2159302_2159767_-	DUF2214 family protein	NA	NA	NA	NA
WP_006764754.1\|2159804_2160608_-	hypothetical protein	NA	NA	NA	NA
WP_006764755.1\|2160853_2161918_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_035972743.1\|2162486_2164319_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.6e-40	27.9
WP_006764757.1\|2164527_2165907_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_006764758.1\|2165903_2166656_-	trehalose-phosphatase	NA	NA	NA	NA
WP_035972744.1\|2166948_2167584_+	SCO family protein	NA	NA	NA	NA
WP_006764759.1\|2167592_2168033_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_006764760.1\|2168043_2168913_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_035972745.1\|2168937_2169429_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_035973394.1\|2169552_2170419_-	pirin family protein	NA	NA	NA	NA
WP_006764762.1\|2170528_2171446_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006764764.1\|2171578_2172082_+	GAF domain-containing protein	NA	NA	NA	NA
WP_035972746.1\|2172254_2173061_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_035972748.1\|2173060_2173297_-	ParD-like family protein	NA	NA	NA	NA
WP_035972750.1\|2173443_2174067_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006764767.1\|2174105_2174654_+	N-acetyltransferase	NA	NA	NA	NA
WP_052688700.1\|2176827_2177475_-	hypothetical protein	NA	NA	NA	NA
WP_094190582.1\|2177510_2178640_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-50	43.5
WP_006763677.1\|2179855_2181115_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_006764054.1\|2181605_2182013_+	IS66 family insertion sequence hypothetical protein	B6DZU5	Stx2-converting_phage	1.5e-13	45.1
WP_006764055.1\|2182009_2182357_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_006764056.1\|2182386_2183949_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.6e-151	54.3
WP_006765345.1\|2183989_2184586_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	6.0e-27	38.6

DBSCAN-SWA_149

2187717 : 2192833

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764774.1\|2187717_2190030_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	3.4e-25	29.2
WP_035972754.1\|2190049_2192833_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.0e-84	33.0

DBSCAN-SWA_150

2205146 : 2216696

Micromonas_pusilla_virus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972759.1\|2205146_2206424_-	ribonuclease III	G8DDA3	Micromonas_pusilla_virus	9.9e-19	30.7
WP_035972760.1\|2206578_2207472_-	signal peptidase I	NA	NA	NA	NA
WP_035972761.1\|2207488_2209282_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.3e-21	23.5
WP_006764790.1\|2209504_2209741_-	glutaredoxin family protein	NA	NA	NA	NA
WP_006764791.1\|2209743_2211222_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.6e-20	28.9
WP_006764792.1\|2211238_2212291_-	MucB/RseB C-terminal domain-containing protein	NA	NA	NA	NA
WP_035972763.1\|2212296_2212911_-	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_006764794.1\|2212999_2213599_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	5.0e-05	26.6
WP_006764795.1\|2213690_2214155_-	hypothetical protein	NA	NA	NA	NA
WP_035972764.1\|2214167_2215400_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_004197638.1\|2215562_2215802_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.6e-10	47.1
WP_035972766.1\|2215946_2216696_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	5.8e-19	32.1

DBSCAN-SWA_151

2234012 : 2242462

uncultured_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081293705.1\|2234012_2235281_-\|transposase	IS256-like element ISBcen18 family transposase	A0A218MNI5	uncultured_virus	2.3e-39	42.8
WP_045552482.1\|2235543_2236380_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.9e-75	54.0
WP_006764814.1\|2236466_2237942_-	DNA recombination protein RmuC	NA	NA	NA	NA
WP_035973396.1\|2237938_2238928_-	D-glycerate dehydrogenase	M1HST2	Paramecium_bursaria_Chlorella_virus	1.3e-13	23.3
WP_006764816.1\|2239021_2240452_-	sodium:proton antiporter	NA	NA	NA	NA
WP_035972790.1\|2240490_2241153_-	lactate utilization protein C	NA	NA	NA	NA
WP_035973397.1\|2241262_2242462_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.0e-57	35.7

DBSCAN-SWA_152

2255741 : 2263136

Klebsiella_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764829.1\|2255741_2256713_-	thymidylate synthase	A0A159B803	Klebsiella_phage	1.6e-48	37.5
WP_006764830.1\|2256754_2258152_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_045552483.1\|2259199_2259700_+	dihydrofolate reductase	A0A0A0PL85	Bacillus_phage	1.6e-25	41.0
WP_006764832.1\|2259793_2261164_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_006764833.1\|2261282_2261891_+	ribosome-associated protein	NA	NA	NA	NA
WP_006764834.1\|2261874_2262495_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_006764835.1\|2262512_2263136_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.8e-27	40.5

DBSCAN-SWA_153

2278984 : 2290662

Bacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973400.1\|2278984_2280019_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.9e-26	33.2
WP_035972823.1\|2280235_2281153_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006764855.1\|2281173_2282097_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	6.7e-41	34.6
WP_006764856.1\|2282140_2283478_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_006764857.1\|2283563_2284466_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	5.3e-51	39.5
WP_006764858.1\|2284684_2285032_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_006764859.1\|2285104_2286097_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.1e-28	31.5
WP_052688707.1\|2286160_2287111_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.4e-16	28.1
WP_006764861.1\|2287118_2288519_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	8.8e-77	37.5
WP_006764862.1\|2288609_2289782_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_006764863.1\|2289835_2290129_-	LapA family protein	NA	NA	NA	NA
WP_006764864.1\|2290338_2290662_-	integration host factor subunit beta	A7KV42	Bacillus_phage	2.8e-10	40.0

DBSCAN-SWA_154

2296781 : 2301346

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972827.1\|2296781_2297864_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.3e-85	46.6
WP_035973403.1\|2298036_2298636_-	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_006764872.1\|2298742_2301346_-	DNA gyrase subunit A	A0A172JHV7	Bacillus_phage	2.3e-99	29.6

DBSCAN-SWA_155

2316088 : 2317384

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972833.1\|2316088_2317384_-	MFS transporter	Q6JIH2	Burkholderia_virus	4.3e-62	36.7

DBSCAN-SWA_156

2324318 : 2325323

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973404.1\|2324318_2325323_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	4.7e-40	35.5

DBSCAN-SWA_157

2332867 : 2333881

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972854.1\|2332867_2333881_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	9.2e-52	36.1

DBSCAN-SWA_158

2340622 : 2342115

Croceibacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764902.1\|2340622_2341750_-	DNA polymerase III subunit epsilon	I6R9X8	Croceibacter_phage	7.2e-13	31.3
WP_006764903.1\|2341911_2342115_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	3.5e-19	72.7

DBSCAN-SWA_159

2345695 : 2349071

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764908.1\|2345695_2348062_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	1.5e-12	33.5
WP_006025620.1\|2348125_2348329_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_006764909.1\|2348387_2349071_-	guanylate kinase	A0A218KC48	Bacillus_phage	2.3e-14	32.9

DBSCAN-SWA_160

2364783 : 2375190

Bacillus_virus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972885.1\|2364783_2366085_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.6e-96	52.1
WP_035972887.1\|2366336_2366603_+	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_006764925.1\|2366653_2367964_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.1e-81	40.2
WP_035972888.1\|2368144_2368834_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_006764927.1\|2368880_2371190_-	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	6.5e-85	50.3
WP_006764928.1\|2371486_2372449_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	6.0e-61	42.3
WP_006764929.1\|2372582_2373362_+	Smr/MutS family protein	NA	NA	NA	NA
WP_035972889.1\|2373330_2373972_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_006764931.1\|2374071_2375190_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	6.9e-24	35.3

DBSCAN-SWA_161

2378896 : 2380366

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972890.1\|2378896_2380366_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	6.6e-75	36.1

DBSCAN-SWA_162

2385072 : 2392853

Staphylococcus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764937.1\|2385072_2386290_-	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	2.7e-26	26.2
WP_006764938.1\|2386525_2386978_+	hypothetical protein	NA	NA	NA	NA
WP_006764939.1\|2387159_2388443_+	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_006764940.1\|2388458_2389580_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2I2L4R9	Orpheovirus	4.4e-47	36.1
WP_006764941.1\|2389594_2390224_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.8e-30	39.6
WP_006764942.1\|2390432_2390951_+	DUF1993 domain-containing protein	NA	NA	NA	NA
WP_006764943.1\|2391141_2392284_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.2e-49	35.9
WP_006764944.1\|2392337_2392853_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.3e-19	38.0

DBSCAN-SWA_163

2401634 : 2406732

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972902.1\|2401634_2402021_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.9e-21	48.5
WP_006764954.1\|2402406_2403618_+	S53 family peptidase	A0A1V0SLL0	Klosneuvirus	6.5e-20	30.7
WP_045552535.1\|2403676_2404498_-	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	2.8e-06	22.6
WP_006764956.1\|2404788_2405958_-	mandelate racemase	NA	NA	NA	NA
WP_035972904.1\|2406112_2406376_-	hypothetical protein	NA	NA	NA	NA
WP_006764957.1\|2406528_2406732_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-19	70.1

DBSCAN-SWA_164

2423783 : 2425338

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764973.1\|2423783_2424641_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.9e-10	24.6
WP_006764974.1\|2424645_2425338_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	9.8e-13	24.9

DBSCAN-SWA_165

2434590 : 2435985

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764985.1\|2434590_2435985_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	8.5e-56	31.6

DBSCAN-SWA_166

2439498 : 2440521

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006764989.1\|2439498_2440521_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	5.2e-87	48.2

DBSCAN-SWA_167

2444661 : 2445630

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973410.1\|2444661_2445630_-	SDR family oxidoreductase	G8DDL6	Micromonas_pusilla_virus	1.7e-07	27.9

DBSCAN-SWA_168

2456605 : 2469008

Enterobacteria_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765002.1\|2456605_2457523_-	NAD-dependent epimerase/dehydratase family protein	A0A222YY99	Synechococcus_phage	6.9e-14	25.0
WP_006765003.1\|2457500_2458541_-	GDP-mannose 4,6-dehydratase	M1I1J0	Paramecium_bursaria_Chlorella_virus	5.3e-103	54.7
WP_006765004.1\|2458553_2462279_-	glycosyltransferase	A0A1X9SJW0	Sulfolobus_islandicus_rod-shaped_virus	1.6e-05	26.3
WP_045552536.1\|2462279_2463608_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_006765006.1\|2463950_2465396_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.0e-52	28.2
WP_035972940.1\|2465618_2466509_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.6e-26	34.6
WP_035972942.1\|2466505_2467057_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.7e-50	53.6
WP_035972943.1\|2467041_2467935_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.3e-97	59.2
WP_006765010.1\|2467946_2469008_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-86	47.3

DBSCAN-SWA_169

2473792 : 2474542

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765013.1\|2473792_2474542_-	ABC transporter ATP-binding protein	M1I1A6	Acanthocystis_turfacea_Chlorella_virus	2.7e-08	28.8

DBSCAN-SWA_170

2478934 : 2479966

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765018.1\|2478934_2479966_-	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	1.9e-28	34.0

DBSCAN-SWA_171

2484693 : 2486674

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400973.1\|2484693_2486334_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	7.1e-171	62.6
WP_006400974.1\|2486380_2486674_-	co-chaperone GroES	A0A221S4A8	uncultured_virus	1.6e-17	42.6

DBSCAN-SWA_172

2505498 : 2513809

Acinetobacter_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552537.1\|2505498_2506206_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	3.1e-22	42.3
WP_006765043.1\|2506207_2508562_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	3.3e-238	55.6
WP_006765044.1\|2508579_2510178_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	1.5e-128	50.0
WP_006765045.1\|2510504_2511719_+	MFS transporter	NA	NA	NA	NA
WP_006765046.1\|2511850_2512741_-	EamA family transporter	NA	NA	NA	NA
WP_035972967.1\|2512873_2513809_+	helix-turn-helix transcriptional regulator	A0A291LAM3	Bordetella_phage	7.0e-14	40.8

DBSCAN-SWA_173

2516894 : 2517893

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765050.1\|2516894_2517893_+	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	3.3e-62	43.6

DBSCAN-SWA_174

2537433 : 2538681

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972982.1\|2537433_2538681_-	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	8.3e-95	51.7

DBSCAN-SWA_175

2551533 : 2567808

Wolbachia_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972990.1\|2551533_2553528_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.6e-79	33.0
WP_035972992.1\|2553524_2554499_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_035972994.1\|2554636_2555032_-	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_006765089.1\|2555145_2556201_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SEW4	Cyanophage	6.4e-72	45.5
WP_006765090.1\|2556399_2557179_+	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_006765091.1\|2557190_2557868_+	HAD-IB family hydrolase	NA	NA	NA	NA
WP_035972999.1\|2557873_2559427_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	8.6e-25	31.8
WP_006765093.1\|2559460_2560000_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_006765094.1\|2559996_2560683_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	1.4e-06	27.3
WP_006765095.1\|2560726_2561542_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	5.7e-36	32.9
WP_035973001.1\|2561710_2562091_+	BPSL0067 family protein	NA	NA	NA	NA
WP_123806796.1\|2562306_2562528_+	hypothetical protein	NA	NA	NA	NA
WP_006765096.1\|2562534_2564463_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	5.6e-58	36.2
WP_006765097.1\|2564467_2565598_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.1e-24	39.0
WP_006765098.1\|2565858_2567808_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	4.5e-148	51.0

DBSCAN-SWA_176

2584916 : 2589973

Klebsiella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765112.1\|2584916_2585990_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	1.4e-79	48.5
WP_006765113.1\|2586110_2587319_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_006765114.1\|2587415_2587967_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_035973013.1\|2588563_2589973_+	FAD-binding protein	S4VRT3	Pandoravirus	5.1e-08	29.7

DBSCAN-SWA_177

2598868 : 2599357

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765122.1\|2598868_2599357_-	non-specific DNA-binding protein DpsA	A0A2H4N7L5	Lake_Baikal_phage	1.4e-21	36.9

DBSCAN-SWA_178

2602578 : 2603538

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765124.1\|2602578_2603538_-	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	2.0e-08	25.2

DBSCAN-SWA_179

2607448 : 2615437

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765127.1\|2607448_2608636_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.8e-84	45.5
WP_006401647.1\|2608915_2609239_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-12	42.2
WP_006765128.1\|2609345_2611367_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_006765129.1\|2611384_2612335_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.8e-41	34.6
WP_174484791.1\|2612771_2613197_-	hypothetical protein	NA	NA	NA	NA
WP_035973023.1\|2613184_2613922_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_035973025.1\|2614159_2615437_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.6e-85	45.1

DBSCAN-SWA_180

2638868 : 2643003

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765151.1\|2638868_2640434_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.9e-68	47.7
WP_006765152.1\|2640585_2641128_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_035973042.1\|2641246_2641828_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_006765154.1\|2641935_2643003_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	7.0e-10	27.0

DBSCAN-SWA_181

2647941 : 2648313

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765160.1\|2647941_2648313_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	1.6e-30	58.3

DBSCAN-SWA_182

2660452 : 2661178

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973051.1\|2660452_2661178_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-30	38.9

DBSCAN-SWA_183

2666516 : 2667905

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765171.1\|2666516_2667905_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.6e-110	46.9

DBSCAN-SWA_184

2677671 : 2683380

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973057.1\|2677671_2678943_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.3e-83	46.2
WP_006765182.1\|2679082_2680177_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_006765183.1\|2680195_2680747_-	hypothetical protein	NA	NA	NA	NA
WP_006765184.1\|2680785_2683380_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.8e-176	40.1

DBSCAN-SWA_185

2691313 : 2692204

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973065.1\|2691313_2692204_-	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	2.6e-10	23.2

DBSCAN-SWA_186

2698220 : 2698637

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973428.1\|2698220_2698637_+	VOC family protein	A0A2K9L1J4	Tupanvirus	2.5e-11	32.5

DBSCAN-SWA_187

2704979 : 2705480

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765205.1\|2704979_2705480_+	CinA family protein	B5TK85	Pseudomonas_phage	5.8e-31	49.0

DBSCAN-SWA_188

2710660 : 2714133

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765211.1\|2710660_2712172_-	L-arabinose ABC transporter ATP-binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	1.3e-14	28.5
WP_006765212.1\|2712245_2713241_-	arabinose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035973430.1\|2713353_2714133_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.0e-18	30.2

DBSCAN-SWA_189

2735255 : 2739823

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765233.1\|2735255_2736467_-	ribonucleotide-diphosphate reductase subunit beta	A0A2P0VNY9	Tetraselmis_virus	4.3e-40	31.2
WP_035973083.1\|2736829_2739823_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	1.4e-169	44.0

DBSCAN-SWA_190

2743649 : 2744201

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765238.1\|2743649_2744201_+	hypoxanthine-guanine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	9.2e-06	33.8

DBSCAN-SWA_191

2748232 : 2749351

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765243.1\|2748232_2749351_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	8.3e-62	42.4

DBSCAN-SWA_192

2759593 : 2760043

Rhizoctonia_fumigata_mycovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973095.1\|2759593_2760043_-	NUDIX domain-containing protein	A0A0B5CYJ3	Rhizoctonia_fumigata_mycovirus	2.3e-07	37.4

DBSCAN-SWA_193

2767101 : 2767608

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973101.1\|2767101_2767608_-	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-27	51.6

DBSCAN-SWA_194

2787902 : 2789576

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973119.1\|2787902_2789576_-	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	27.0

DBSCAN-SWA_195

2808398 : 2813902

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765281.1\|2808398_2809892_+	anthranilate synthase component I	A0A0B5J984	Pandoravirus	1.5e-37	32.4
WP_006765282.1\|2809905_2810493_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.4e-68	61.1
WP_006765283.1\|2810505_2811537_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.3e-81	47.0
WP_006765284.1\|2811566_2812352_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.4e-52	46.3
WP_006765285.1\|2812351_2812978_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_006765286.1\|2812990_2813902_+	uracil-DNA glycosylase	G3G8V0	Suid_alphaherpesvirus	9.1e-51	51.3

DBSCAN-SWA_196

2825523 : 2912539

Pseudomonas_phage(15.79%)

transposase,plate,integrase,tRNA,protease

attL 2842304:2842322|attR 2914428:2914446

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973122.1\|2825523_2827191_+	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	2.6e-43	28.1
WP_006765296.1\|2827354_2827978_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_006765297.1\|2827974_2828526_-	isochorismatase family protein	NA	NA	NA	NA
WP_006765298.1\|2828578_2830393_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	5.5e-172	50.2
WP_006765299.1\|2830411_2830666_-	hypothetical protein	NA	NA	NA	NA
WP_006765300.1\|2830837_2831599_+	response regulator transcription factor	NA	NA	NA	NA
WP_006765301.1\|2831625_2832924_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006765302.1\|2833006_2834089_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_006765303.1\|2834096_2834939_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006765304.1\|2835006_2835318_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_006765305.1\|2835346_2835943_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_006765306.1\|2836163_2836955_+	dioxygenase	NA	NA	NA	NA
WP_006765307.1\|2837066_2838665_-	APC family permease	NA	NA	NA	NA
WP_006477070.1\|2839088_2839292_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_045552539.1\|2839390_2840641_-	Hsp70 family protein	NA	NA	NA	NA
WP_035973132.1\|2840835_2841441_-	nitroreductase family protein	NA	NA	NA	NA
WP_035973134.1\|2841574_2842858_-	MFS transporter	NA	NA	NA	NA
2842304:2842322	attL	NA	NA	NA	NA
WP_006765310.1\|2843078_2843699_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_035973136.1\|2843760_2844333_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_006765312.1\|2844396_2845287_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035973137.1\|2845376_2846510_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035973138.1\|2846824_2847316_-	LEA type 2 family protein	NA	NA	NA	NA
WP_006765315.1\|2847960_2850129_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.4e-49	26.4
WP_035973435.1\|2850248_2851277_-	transporter	NA	NA	NA	NA
WP_006765317.1\|2851472_2852435_-	hypothetical protein	NA	NA	NA	NA
WP_006765318.1\|2852556_2853402_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_006765319.1\|2853703_2857645_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_006765320.1\|2857641_2858631_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_006765321.1\|2858635_2859589_+	OmpA family protein	NA	NA	NA	NA
WP_006765322.1\|2859944_2861081_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_006765323.1\|2861122_2863789_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	5.9e-90	31.6
WP_006765324.1\|2863833_2864934_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_006765325.1\|2864897_2866733_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006765326.1\|2866810_2867296_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006765327.1\|2867358_2867862_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006765328.1\|2867932_2869423_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006765329.1\|2869438_2869954_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_035973140.1\|2869991_2870624_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_006765331.1\|2871000_2871612_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006765332.1\|2871714_2873061_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_006765333.1\|2873057_2873840_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_006765334.1\|2873912_2874221_-	hypothetical protein	NA	NA	NA	NA
WP_123806799.1\|2874551_2875145_-	hypothetical protein	NA	NA	NA	NA
WP_081293616.1\|2875668_2875872_-	hypothetical protein	NA	NA	NA	NA
WP_081293617.1\|2875996_2876326_-	hypothetical protein	NA	NA	NA	NA
WP_006765336.1\|2880950_2884127_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.4e-58	26.8
WP_006765337.1\|2884452_2885253_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_006765338.1\|2885362_2885566_-	hypothetical protein	NA	NA	NA	NA
WP_052688713.1\|2886160_2887915_+	beta-galactosidase	NA	NA	NA	NA
WP_094190595.1\|2887977_2889106_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-50	43.5
WP_006765340.1\|2890206_2890914_-	pirin family protein	NA	NA	NA	NA
WP_035973142.1\|2890997_2891762_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	7.8e-11	29.3
WP_006765341.1\|2891900_2892818_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006765343.1\|2892980_2893946_+	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	5.9e-56	39.2
WP_035973143.1\|2893979_2894384_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_035973439.1\|2894654_2896085_-	hypothetical protein	NA	NA	NA	NA
WP_035973144.1\|2896624_2897200_-	recombinase family protein	A0A219Y912	Aeromonas_phage	1.2e-24	42.6
WP_035973145.1\|2897555_2898056_+	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_035973146.1\|2898052_2899177_+	hypothetical protein	NA	NA	NA	NA
WP_105773880.1\|2899344_2899536_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_006764054.1\|2899632_2900040_+	IS66 family insertion sequence hypothetical protein	B6DZU5	Stx2-converting_phage	1.5e-13	45.1
WP_006764055.1\|2900036_2900384_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_006764056.1\|2900413_2901976_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.6e-151	54.3
WP_006765345.1\|2902016_2902613_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	6.0e-27	38.6
WP_134220899.1\|2903322_2903550_+	hypothetical protein	NA	NA	NA	NA
WP_081054136.1\|2904529_2904721_+	AlpA family phage regulatory protein	A0A2L0V109	Agrobacterium_phage	3.2e-06	47.2
WP_045552490.1\|2904717_2905242_+	hypothetical protein	NA	NA	NA	NA
WP_012329039.1\|2905572_2905749_+	hypothetical protein	NA	NA	NA	NA
WP_035973149.1\|2905741_2906044_+	hypothetical protein	NA	NA	NA	NA
WP_006765346.1\|2906036_2906249_+	hypothetical protein	NA	NA	NA	NA
WP_006765347.1\|2906241_2906589_+	hypothetical protein	NA	NA	NA	NA
WP_006765348.1\|2906598_2906925_+	hypothetical protein	NA	NA	NA	NA
WP_035973150.1\|2907052_2909914_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	4.3e-70	35.4
WP_035973151.1\|2910530_2911748_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	1.3e-89	43.0
WP_035973440.1\|2912017_2912539_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.4e-21	52.0
2914428:2914446	attR	NA	NA	NA	NA

DBSCAN-SWA_197

2917087 : 2919265

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765356.1\|2917087_2918293_+	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	1.4e-11	34.3
WP_006765357.1\|2918482_2919265_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.9e-25	29.6

DBSCAN-SWA_198

2931320 : 2932247

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765374.1\|2931320_2932247_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	2.0e-21	29.8

DBSCAN-SWA_199

2935800 : 2936622

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765379.1\|2935800_2936622_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-21	29.4

DBSCAN-SWA_200

2953438 : 2955319

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973174.1\|2953438_2954203_-	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	2.4e-12	24.1
WP_006765391.1\|2954233_2955319_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	9.6e-23	35.6

DBSCAN-SWA_201

2994638 : 3010766

Klosneuvirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552492.1\|2994638_2995829_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	8.9e-14	27.9
WP_035973192.1\|2995867_2997970_-	elongation factor G	E4ZFJ7	Streptococcus_phage	8.9e-57	27.0
WP_006765419.1\|2998093_2998564_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_006400662.1\|2998737_2999118_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_006765420.1\|2999344_3001192_-	DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	8.6e-72	39.8
WP_123806801.1\|3001353_3001677_-	hypothetical protein	NA	NA	NA	NA
WP_081293623.1\|3001780_3002119_-	type IV secretion protein Rhs	NA	NA	NA	NA
WP_035973194.1\|3002396_3006638_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.6e-73	28.1
WP_035973195.1\|3006659_3010766_-	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	1.0e-24	21.1

DBSCAN-SWA_202

3014762 : 3015953

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552492.1\|3014762_3015953_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	8.9e-14	27.9

DBSCAN-SWA_203

3040711 : 3041398

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971351.1\|3040711_3041398_+	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	9.4e-16	28.1

DBSCAN-SWA_204

3055616 : 3056312

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762864.1\|3055616_3056312_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-37	40.5

DBSCAN-SWA_205

3069222 : 3071791

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762877.1\|3069222_3069834_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	5.6e-20	57.5
WP_035971369.1\|3070490_3071135_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_035971371.1\|3071131_3071791_+	exonuclease	A0A2L0UZL4	Agrobacterium_phage	3.1e-32	38.7

DBSCAN-SWA_206

3083379 : 3084798

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971376.1\|3083379_3084798_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.5e-44	30.7

DBSCAN-SWA_207

3097136 : 3102445

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401389.1\|3097136_3097532_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	9.2e-08	32.8
WP_035971386.1\|3097599_3098691_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_035971387.1\|3098687_3099446_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_035971388.1\|3099442_3100489_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_035971389.1\|3100492_3102445_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-09	58.3

DBSCAN-SWA_208

3130804 : 3131746

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971403.1\|3130804_3131746_-	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	5.0e-84	45.9

DBSCAN-SWA_209

3137592 : 3138753

uncultured_marine_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762923.1\|3137592_3138753_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	4.9e-17	35.8

DBSCAN-SWA_210

3143626 : 3149019

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762926.1\|3143626_3146134_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.0e-06	42.0
WP_045552497.1\|3146193_3149019_+	hypothetical protein	A0A218M2Y4	Acidovorax_phage	8.6e-15	36.2

DBSCAN-SWA_211

3152038 : 3154126

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971414.1\|3152038_3154126_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	5.8e-101	35.1

DBSCAN-SWA_212

3158461 : 3161389

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762936.1\|3158461_3161389_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	4.9e-263	52.1

DBSCAN-SWA_213

3181584 : 3184197

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971436.1\|3181584_3184197_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-131	44.9

DBSCAN-SWA_214

3205076 : 3206804

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762964.1\|3205076_3206804_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.3e-33	31.6

DBSCAN-SWA_215

3216374 : 3223563

Bifidobacterium_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035973219.1\|3216374_3217268_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.2e-17	38.1
WP_006762975.1\|3217299_3218079_-	ParA family protein	Q8JL10	Natrialba_phage	2.7e-19	34.5
WP_006762976.1\|3218129_3218816_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_006762977.1\|3218812_3220783_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_035971449.1\|3221023_3221779_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.2e-09	25.1
WP_006762979.1\|3221778_3223563_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	9.3e-15	27.8

DBSCAN-SWA_216

3230991 : 3233914

Staphylococcus_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006762986.1\|3230991_3231771_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-12	24.0
WP_035973221.1\|3232228_3233914_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	6.0e-56	29.9

DBSCAN-SWA_217

3250156 : 3252478

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401505.1\|3250156_3250435_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.1e-20	61.8
WP_035971458.1\|3250554_3251868_-	GTP-binding protein	NA	NA	NA	NA
WP_006763002.1\|3252028_3252478_-	lytic transglycosylase domain-containing protein	A0A0K2QQJ4	Ralstonia_phage	6.8e-15	38.3

DBSCAN-SWA_218

3276533 : 3281566

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763028.1\|3276533_3278552_+	site-specific DNA-methyltransferase	A0A2K5B255	Erysipelothrix_phage	1.7e-81	32.7
WP_035971470.1\|3278551_3281566_+	DEAD/DEAH box helicase family protein	A0A2K5B256	Erysipelothrix_phage	3.7e-173	37.5

DBSCAN-SWA_219

3294762 : 3308405

Burkholderia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081293705.1\|3294762_3296031_+\|transposase	IS256-like element ISBcen18 family transposase	A0A218MNI5	uncultured_virus	2.3e-39	42.8
WP_035971490.1\|3297259_3298546_+	DNA (cytosine-5-)-methyltransferase	E5E3X6	Burkholderia_phage	6.7e-148	66.4
WP_081293555.1\|3298603_3299089_+	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	8.0e-46	54.1
WP_081293556.1\|3299350_3300682_+	hypothetical protein	NA	NA	NA	NA
WP_035971491.1\|3301520_3303995_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.7e-115	34.2
WP_006763042.1\|3304187_3305294_-	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	2.4e-45	31.4
WP_035971492.1\|3305462_3307034_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_004198824.1\|3307451_3307586_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_035971493.1\|3307601_3308063_+	ribonuclease P protein component	NA	NA	NA	NA
WP_035971494.1\|3308138_3308405_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.1e-17	55.1

DBSCAN-SWA_220

3317307 : 3318399

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763054.1\|3317307_3318399_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	4.2e-18	34.9

DBSCAN-SWA_221

3340121 : 3353177

Bodo_saltans_virus(14.29%)

tRNA,integrase

attL 3331423:3331437|attR 3361426:3361440

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3331423:3331437	attL	NA	NA	NA	NA
WP_006763064.1\|3340121_3341345_-	ATP-binding protein	A0A2H4UTU5	Bodo_saltans_virus	1.2e-13	30.6
WP_035971515.1\|3341494_3342571_-\|integrase	site-specific integrase	A0A1S6L1B6	Ralstonia_phage	9.5e-47	36.7
WP_035971517.1\|3342999_3343404_+	PaaI family thioesterase	NA	NA	NA	NA
WP_006763066.1\|3343412_3344279_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_006763067.1\|3344336_3345350_-	D-2-hydroxyacid dehydrogenase family protein	M1HBE3	Paramecium_bursaria_Chlorella_virus	8.7e-10	23.2
WP_006763068.1\|3345773_3346823_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006763069.1\|3346945_3349540_-	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	4.5e-18	24.2
WP_006763070.1\|3349732_3350113_-	thioredoxin family protein	NA	NA	NA	NA
WP_105773954.1\|3350147_3351425_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.5e-22	35.8
WP_123806810.1\|3351483_3351672_-	hypothetical protein	NA	NA	NA	NA
WP_006763072.1\|3351655_3352159_+	peptide deformylase	A0A067XQZ3	Caulobacter_phage	9.9e-15	32.1
WP_035971518.1\|3352193_3353177_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.2e-08	36.2
3361426:3361440	attR	NA	NA	NA	NA

DBSCAN-SWA_222

3360677 : 3362588

Vibrio_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971524.1\|3360677_3361412_+	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.1e-50	43.1
WP_035971525.1\|3361484_3362117_+	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	3.0e-08	35.3
WP_035971526.1\|3362135_3362588_+	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	3.4e-14	31.4

DBSCAN-SWA_223

3375548 : 3377501

Phaeocystis_globosa_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006763085.1\|3375548_3376322_+	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	1.6e-27	32.3
WP_035971533.1\|3376448_3377501_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.2e-83	46.7

Anti-CRISPR protein detection

Acr_ID: NZ_CP009795.1|WP_006764754.1|2159804_2160608_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP009795.1|WP_006764754.1|2159804_2160608_-|hypothetical-protein

2159804_2160608_-

267 aa aa

2113836-2184586

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP009793_1	Orphan	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	2153318-2153300	2

1. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP009795 position: 2153318-2153300, mismatch: 2

gccgacgccgacgccgacg	CRISPR spacer
gccgccgccgacgccgtcg	Protospacer
**** *********** **

3. NZ_CP009793

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009793_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009793_1

1602562-1602753

Orphan

Consensus_repeat	Method
CCGACTCCGACTCCGACTCCGAC	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP009793_1

>merge|NZ_CP009793|1|1602562-1602753|CRISPRCasFinder
CCTACGCCGACACCGACACCGACGCCGACTCCGACGCCGACGCCGACGCCGACGCCGACTCCGACGCCGACGCCGACGCCGACGCCGACGCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACACCGACACCGACACCGACACCGACACCGACACCGACTCCGACT

>NZ_CP009793|1|1|1602562-1602753|CRISPRCasFinder
CCTACGCCGACACCGACACCGAC	GCCGACTCCGACGCCGACG
CCGACGCCGACGCCGACTCCGAC	GCCGACGCCGACGCCGACG
CCGACGCCGACTCCGACTCCGAC	TCCGACTCCGACTCCGACT
CCGACTCCGACTCCGACTCCGAC	ACCGACACCGACACCGACA
CCGACACCGACACCGACTCCGACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009793.1\|WP_081293642.1\|1606527_1608942_-\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|235549
NZ_CP009793.1\|WP_158380444.1\|1591978_1592824_+\|fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP009793.1\|WP_035975118.1\|1589911_1591393_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP009793.1\|WP_006765508.1\|1587199_1588318_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP009793.1\|WP_006765498.1\|1614388_1615198_-\|GTP-cyclohydrolase-I-FolE2	unknown	unknown	gnl\|CDD\|237466
NZ_CP009793.1\|WP_035973662.1\|1586249_1587107_-\|CerR-family-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|236928
NZ_CP009793.1\|WP_006765500.1\|1611892_1613113_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224992
NZ_CP009793.1\|WP_006765501.1\|1610979_1611426_-\|GatB/YqeY-domain-containing-protein	unknown	unknown	gnl\|CDD\|370480
NZ_CP009793.1\|WP_123806729.1\|1592866_1593799_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_006765499.1\|1613242_1614283_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP009793.1\|WP_035973646.1\|1615352_1617257_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP009793.1\|WP_006765504.1\|1596500_1598216_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_174484767.1\|1603732_1604635_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP009793.1\|WP_123806730.1\|1605420_1605936_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_006765507.1\|1588310_1589897_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP009793.1\|WP_006765502.1\|1609030_1610905_-\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NZ_CP009793.1\|WP_006765506.1\|1593817_1595242_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_004190342.1\|1611604_1611817_-\|30S-ribosomal-protein-S21	unknown	unknown	gnl\|CDD\|234707
NZ_CP009793.1\|WP_108623482.1\|1595362_1596409_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_CP009793.1\|WP_081293643.1\|1598216_1601600_-\|inverse-autotransporter-beta-domain-containing-protein	unknown	unknown	gnl\|CDD\|378762

Protein	Function_ID	Function_description	E-value
NZ_CP009793.1\|WP_035975118.1\|1589911_1591393_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	8.12594e-82
NZ_CP009793.1\|WP_006765508.1\|1587199_1588318_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	2.80779e-102
NZ_CP009793.1\|WP_006765498.1\|1614388_1615198_-\|GTP-cyclohydrolase-I-FolE2	gnl\|CDD\|237466	PRK13674, PRK13674, GTP cyclohydrolase I FolE2.	2.33162e-154
NZ_CP009793.1\|WP_108623482.1\|1595362_1596409_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.70006e-08
NZ_CP009793.1\|WP_006765500.1\|1611892_1613113_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224992	COG2081, COG2081, Predicted flavoproteins [General function prediction only].	1.28479e-175
NZ_CP009793.1\|WP_006765501.1\|1610979_1611426_-\|GatB/YqeY-domain-containing-protein	gnl\|CDD\|370480	pfam09424, YqeY, Yqey-like protein. The function of this domain found in the YqeY protein is uncertain.	2.06497e-59
NZ_CP009793.1\|WP_006765499.1\|1613242_1614283_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP009793.1\|WP_081293643.1\|1598216_1601600_-\|inverse-autotransporter-beta-domain-containing-protein	gnl\|CDD\|378762	pfam11924, IAT_beta, Inverse autotransporter, beta-domain. This is a family of beta-barrel porin-like outer membrane proteins from enteropathogenic Gram-negative bacteria. Intimins and invasins are virulence factors produced by pathogenic Gram-negative bacteria. They carry C-terminal extracellular passenger domains that are involved in adhesion to host cells and N-terminal beta domains that are embedded in the outer membrane. This family represents the beta-barrel porin-like domain in the outer membrane that can be found in intimins, invasins and some inverse autotransporters.	5.0044e-116
NZ_CP009793.1\|WP_174484767.1\|1603732_1604635_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	3.43375e-11
NZ_CP009793.1\|WP_035973646.1\|1615352_1617257_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP009793.1\|WP_006765507.1\|1588310_1589897_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.09184e-100
NZ_CP009793.1\|WP_006765502.1\|1609030_1610905_-\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NZ_CP009793.1\|WP_004190342.1\|1611604_1611817_-\|30S-ribosomal-protein-S21	gnl\|CDD\|234707	PRK00270, rpsU, 30S ribosomal protein S21; Reviewed.	4.66337e-16
NZ_CP009793.1\|WP_158380444.1\|1591978_1592824_+\|fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	9.0054e-14
NZ_CP009793.1\|WP_035973662.1\|1586249_1587107_-\|CerR-family-C-terminal-domain-containing-protein	gnl\|CDD\|236928	PRK11552, PRK11552, putative DNA-binding transcriptional regulator; Provisional.	4.27245e-26
NZ_CP009793.1\|WP_081293642.1\|1606527_1608942_-\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|235549	PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated.	0

>NZ_CP009793.1|WP_081293643.1|1598216_1601600_-|inverse-autotransporter-beta-domain-containing-protein
MFKWIPMRFRTRHAIGGRGRTSRCGVASRVFVMLLAIVAIGASQASAKESGSTIVTSSASAPVESAGNAPCGSRDGSACCASAPSSGADRPAVAASGPDGATGNGSAHTNCTSALSTINRPDRYNLPDLGAGKTAVTSKDDATRRSVLTPVLQQLTQFGSSAAYGQSMTDIGLGYLTGRANQYMFGGLQRWLSQFGTANVSMSVDNHGRLTDGSTNFLLPLYDDKGSWLVFTQLGYLRWDGRNTINVGLGARHFDNDWMNGVNAFFDDDLTGHNQRVGAGVELAANYLKFSANGYLGLTNWHRSLDYIDYDERPANGFDVASQMYLPSLPQLGVKLKYEQYFGSGVDLLGSGDRQKNPFAVTAGLEYTPVPAVTVGAAYRRGTGSISDVLFNVQLNYRLGVPLAQQFDPRAVGSMRTLAGSRYDLVQRNNRIVLDYRKHVEIRLSLGGALSGYAGQVIAVPVAVTATYGLQSIQWSAPELFARGGTVSGTNGSYFVTLPSYQPGGNNTYTIRGVAVDQRGNASSPAEMQVTVIGESAAISADQSSAAFSPDRIYADGRSTSTLTITVVDTNGNGVAGLAQDIDLQAAFNGGSTTQAQAGGSAITGGLSQQPRIGSITDLRNGIYVATVTAGTSTGTLTVTPLLRNEKIKLKAAPLMLVAPAQHSVKITNVSVTPQGNVAADGNAYYTFTAQVVDATTGLPVKNDPLVGLNWQVSPKPSTIGNAGWLVLTPGSSTTDDSGRITATLKSKIDDTAFTVSAQLGAAAPVSAPPVTFTVAARVAAVRIVVPSSGNYQIATLNNDLNIPVYVHAPLAGSGDQGFQYVATVVDARNLPVANRSLTSLGVQWLPSRSPSGSSESWTVQPTTNGAGEAIAVYRSWRVLGSDGPLSVSVQAGNQAAMRATGGSFDVVAFSDLPREDHQVQYVNSAGQTGSVLPAMLDTQATIYVTGVTFVELAQMAQLGNTDTVLRATSSNPSVFQITPSNLINALKPGSATVNVLYVHNGFRFTQNLSLTATFVAKVIGTPQEQPLLGDTPCRTSAGSQYDDINGADAANFFQFFSQDSTSPGYALDDIAKFWGGLSLNQTQKHFWLNYYGVAWYGGEVYNGPDAQGSINRTETGQGVMVCKVVS
>NZ_CP009793.1|WP_006765504.1|1596500_1598216_-|hypothetical-protein
MDDQATEQQAAGVIAGIHWDHRKEMVMAGGVTGAVIQPSSGDALVDGKALVTNPHGILEFSVQLQFSGTPVDGAVLLTVTEPNGVKLLNPSPGLPNEIVFTSGEPVVSPLFSIPYGATASGLTFSATPIWNDVTGTAVPMTQPLRWIDPGFLSPSVAVSNYAEGDIPTVNAYQADASGMVTALVKDMSGLVVSGATVLMGAPDDAYLGSFVLKDVNGQSLTASGKLQDGSPAVSVTTGSNGVAAFAICPNGESAHAFAGFDAQVSGRFISPGQSQAGFVVADLKSAQDDSVIAFATIPAPSIEGAEGKNYTPQPGQQHCRISIKTTWEKAALDDKILIVVQDRPRAVVSVADCVGDEKFTPGMEITYTMQVQQLITGNNISLRFLVLRNDADDPYYSYYTTWNIGTLPQPEPVLNSAVCPAPRLFVKTIDASGNAALGAELLSDIDYIVGWNDIREGGIYAFIPYHATDISQGVHGAVTMTAYLNGERPGGNVVVHQPKQYSVTVGDNAVSPSGANLPHGALVLMTTDVLRGWERDGNGYAQPFQVQYVDASTDYSKVWNGRIDTVPDDGQ
>NZ_CP009793.1|WP_108623482.1|1595362_1596409_-|glycosyltransferase
MLASDECVSTDDKRRPDHREGPQPVRMLPASGLTRRGNILFQYNLISGCSYHRVLLPLGNMPDFDTRVPVLYFNRDGFEPAALEDFRRRGGRVVIDLDDDIVLGDDHVLYDAFKDLGCAARIVTCVKLADAVLVTNEQLASRVAQFNRNVVVVPNALPFDEGQFGLTAPDGGRKIVYAGGYTHEADLRLVRDALPRDEFVLAGDPGTRGEDVASQAWTRIRAMLDFAEVRPALGVKEYMRHYVGRSISIAPLVDTPFNRCKSNLKALEAGAKGLAFVASRVLPYDNAVDKDVVLYASSEAEWKAVLGKLVDDPVYCAERGQALAEHVRRHYHIRDANAIRRQVFESFR
>NZ_CP009793.1|WP_006765506.1|1593817_1595242_+|hypothetical-protein
MEEDDTIPPAPWCDIAVKSGNGYTLDVSLIVDTFVIEVPAWNEGLGGPRPGDLYTVYFNDYIFTQEEVADEEQAQWNPYRVPFHVWEVPNGSYNVYYTLWDQVQSNPKRISKTYPLTITGSKAVGGLPAPTFPKSRPDPGNGQQRVEYFADIMADGGVAIEATYNVDPGDKVTFCWVGYDMNGDIVPQSKCMIPGTIAGGTAYATIPARHVLCLGPDSNASAYYHVERQPPNGDPTDSATATLGISFENIVTLEANVAQGAPAHILGTSFCGRAAVRVFGSPGKQVDASLPGDSRCTILEATQSDKRDHSLTLDEYGIGLFHVVPNDQYGTTVTLADDTFTSPPLPVQFSGAQSDSNDSAITAYTYTTGAAANSPMFQDVSVCSIYAKVDRSVLPSGINTLEVTVGGRARLFAFPGQQTASVPIDDDGTVAVDVIDSFVETVQVSIGVAGYPAIHFPIEFAAFPSWRKLSDSPA
>NZ_CP009793.1|WP_123806729.1|1592866_1593799_+|hypothetical-protein
MSAGRAHSTAARSGKSSVTTESTRTVRSIRCKHFTAARQTIRTSRFARRPRHVSLVAIPFPGALIVADIDAVFTTGAPLRDAPIEGKAFPEVKPYNVISVYGERGRAIDANAQGGAKFLEGNPSDPTHVGNYQLDENGRADLHLYFDYTDGHSRRIANLDSATVTVGYSNDLGDQTKPLQPVFSPYQRESTNTVILGFANTSEAPANGDSTMPTPCTVYVCVDTAMYKNVTSVRFAITNAEQGKVWIDDGSGQKPTWIDSPLAQGTSSTSVDILSNTAQKAWTVEISTQAPFDSAHVTVKFVEPPATPHR
>NZ_CP009793.1|WP_158380444.1|1591978_1592824_+|fimbrial-protein
MLPSNVSVSAAAPVGAVVWESPVIAKTFYCESSEKEPVAFWVNPRKESVGEGLEVAIRYKGKLYRQADGAIPTGAVIDGWGLAVWWKYFDVSYSVALIKTSASPGSGQATIANYPAFQLDSQSGLVVNPTRLFTQLLTGTVKFVPGTCDIRAGDDRKVVVLPAVANVSLSTVGATSGRTALSVAVQNCVGVKQVKFSFSGAPDDNMPVAFRNTGTAKGVAVRLAKAGDDGTIAANGTASSIVEPVTNDAASVRLHAEYIGTTGRPTAGSVSSLATMNIDYQ
>NZ_CP009793.1|WP_035975118.1|1589911_1591393_+|efflux-transporter-outer-membrane-subunit
MKPFPLPRHAALTLGAAACLLAGCTVGPDYRGAPAAPDTPIFVRAPASGVDAGTPAPSAWWHALNDRQLDALIAAALAHNPDVHAAQARLREARAQLTQQRAAQLPKSSATVAAIRMREPDVSGLGSLLPSNSDQSSRTSPSAGASGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSLAAEVATAYVDLRDRQQRLALSQRTAELQRRMLELTQQRRARGAAADADIERLTTQVENTRASLIPLDAQVTESLDRLAILTGRAPGALDAELSAPDAPLPTLPGSVPIGDPAALLKQRPDIRAAERRLASSNAQIGEHVADYFPKVTLLGDLGFSASDPGHLLRKQNFTWIGAPYLQWNILDFGRTRGAVRAAQASRDEAEANYRKAVLGALQDANTALQRYGHQREHVVALTKVRTSATHSAALMDQRYRAGVASMIDLLDTQREALAAQQNVIAGQAELIKDYVSLQKSLGLGWQSVG
>NZ_CP009793.1|WP_006765507.1|1588310_1589897_+|multidrug-efflux-MFS-transporter
MADTPATMPAPPHEGRASVTDWIAVAAGALGALMATLDISITNSALPQIQGEIGATGTEGTWISTGYLMSEIVMIPLAAWLTRVFGLRNFLLTNAALFIAFSMMCGWSNSLAMMIVGRIGQGFTGGALIPTAQTIIRTRLPLSQLPVGMTLFGLIVLLGPLFGPVLGGWLAENVSWSWCFFLNLPVCLLLMALLVFGLPSDRPQWATFRNADWLGIAGLAIGLSSLTVVLEEGQRERWFESQMIVTLSYVSLAGMILIALSQRFAKRPIMRLSLMRNPRYASVIVIVSAVGAGLYGVSYLLPQFLAIVAGYNAEQAGAIMLLSGLPAFLVMPILPRLLGKVDFRILVIAGLLLFCLSCMLDIDLTAQSVGHDFVWSQLIRGVAQMLAMMPLNQASMAAVAREESGDAAGLYNMARNLGGSIGLAVIGTVIDRRTTYHTAVLRESVSANSPIGQDRLSTYAANWFAHTGDAAYSNLRALGQFARQIQIQATVMTYSETFYLLGLALLACVPLAMLLRTPRGPQPTSSGH
>NZ_CP009793.1|WP_006765508.1|1587199_1588318_+|HlyD-family-secretion-protein
MSTPQDPPQKADRQEPGTAPRNGGSKRRILLVVVAVAALGGAIWLARWWTVGRFIESTNDAYLQADSMTAAPKVAGYVTDVYVRDNQAVKAGDPLVRLDVRQYRVALDQALATVDARRADIARAEADIAQQRANLEQAEAQAKVSQINARHASDEYARYAPLAATGAETHERVAELKSTRDQALATLAANNASIAAARTQIASFTAQLQQTRAQLEAAEASAAQARLDLDNTIVRSTLDGRVGDRTVRVGQYVQPGTRLLTVVPVDSIYLVANFKETQIGRMRIGQPVELHVDALPDAELTGTVDSFAPGTGAQFALLPPENATGNFTKIVQRVPVRIRLAADARAQRMLLPGLSVTVDVDTRSHGDEKRHG
>NZ_CP009793.1|WP_035973662.1|1586249_1587107_-|CerR-family-C-terminal-domain-containing-protein
MNEAKKLRRTATGGYARGDETRQRIIDAAIELFGEHGFAGASTRDIAAKAGVNAPALQYYFENKEGVYRACADAMAELGWSVLGPAVEHARSALDADADVDALIDAFIGILRTLADRIMTVPKTRGQRMFFAREQLGQEPESASEILMKRVRKPLNDVSAELVGRICGRPADDPVIRLRTMSLFGQLTVFQLVQRSALQLLDWETFEGEGAALLIATIGDQTRVLLEHWHAQRGEFAGDGAQAGAKRRARTGADAPAKRAAKPAQPTRAANRANPARQVKKPASR
>NZ_CP009793.1|WP_174484767.1|1603732_1604635_+|hypothetical-protein
MNNDLQLVIAVRRDDAPTNADAGDDTSADIARVTAFTDTNPEELQYGLDVALSLTGNDGAYFLPYDPHAPQSTTATTNLLGYCDVSVGSTHGGSVTLNAWLADDSNVQAQPQTLAFVQGGPGPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSVTPNAVVTITNHTDFLDHEVQTSGSVSGTITREGMDQSQIGGSVHLHFDPDGYLQQTSPFTENVYAGSFDLTIVNIYTNDGQNDDPVKCYVTVIYDDTGDQSKPVGIDVYPGPYPYPRAK
>NZ_CP009793.1|WP_123806730.1|1605420_1605936_+|hypothetical-protein
MIQLHRCKQDNPFDCFPELRTIWPEPHLQALAEQATIETLDAQTVPGTPDRGPIFLILDIDAAGYERVVGISGYYTLDDRAEQLGLRWHGIVPRARGHGFSRLAFEQVLQTIRTSLPNAREITEIVPLIERGEHIAKHFQQLGFTPRGEPKLYDWAPHAWQCWARILDFKA
>NZ_CP009793.1|WP_081293642.1|1606527_1608942_-|RNA-polymerase-sigma-factor-RpoD
MAKTTGGKKATGKGSTEPTKKVTAAKSASSARTTSSATSATARKKTAAGTAQAAPAPAARTRAAARPDSGPAKPAAKRASAKSARDAAAEPDETAVRTTHASTVQPAVVQQPRVDIAGTANSMTKKLNEVSVDDDANQSDEQPAAAAAPGKSKVRDRRAKEKALLKEAFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGIIGTFNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYMREMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEEIRVDELVDGLLDPNAADTDTDGFSAKEAEAIENEDEDAEEEEEEEEEEDDDGAAQATANAAQLEALKRASLEKFALISEWFDKMRRAFEKEGYKSKAYLKAQETIQSELMTIRFTARTVERLCDTLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGNETDLDWAEKIAAEGHPYSAVLSRNIPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETPIGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN
>NZ_CP009793.1|WP_006765502.1|1609030_1610905_-|DNA-primase
MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSPSFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSMRGGGGGGGGGDYPAPVSKSVATALSDVMSVACDYYRKQLRGATVAIQYLKSRGLTGEIAARFGLGYAPDGWQNLEAAFPDYRDESLVESGLVIVSEKTDAQGVARRYDRFRERIMFPIRNVKGQVIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDVVALAQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALDACLPHAADNRTIRFLFLPPEHDPDSYVREFGADAFSEQVERAMPLSQFLLNEAISGKALDQPEGRAKALFDAKPLLQALPANALRAQIMHMFADRLDIPFEEVAALCDVDSRIAAPLRHAPARSERRRVTDSEKRALRTLVMYPRIALQLDDEQIATLRVLPRIGELFAEVVDHARALGDGAEFRLLSDVLRTSSNAATYEEIFREILDYDENVRDLLLQNPDDDAAAERQREQERIAGEELQAAVLKMRYDACCDRLDRLARQSALTSEELAELTELNQQRTDMKRRLGL
>NZ_CP009793.1|WP_006765501.1|1610979_1611426_-|GatB/YqeY-domain-containing-protein
MSLKEQISEDMKAAMRAKESERLATIRLLMAAIKQREVDDQVTLDDAGITAVIDKMIKQRKDSISQFQAAGRDDLVAKEQAELTVLAAYMPAQLSDDEVAAEVQAAIAQTGAAGPQDMGKVMGVLKGKLAGRADMTAVSAQVKAALSK
>NZ_CP009793.1|WP_004190342.1|1611604_1611817_-|30S-ribosomal-protein-S21
MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRIRSQMLPKKLY
>NZ_CP009793.1|WP_006765500.1|1611892_1613113_-|NAD(P)/FAD-dependent-oxidoreductase
METYDIAVIGAGAAGMMSAAVAGQLGRRVVLIDHAPRLAEKIRISGGGRCNFTNLYAGPDNYLSANPHFARSALARYTPRDFLALLKRHRVTWHEKHKGQLFCDHGSDAIIDVLKHECDAGGIAWRRPVVVDAVRHAPADGFMLDTQQAGTIAARALIVATGGLSIPKIGATDFGYRLAKQFGHKLVDTRPALVPLTFAQQDWEPFAALSGVSLEVRVSTGDKKRGGEFVEDLLLTHRGLSGPGILQISSYWQPGDPIRVDLLPQRDAVADLLDAKRTSKRQIGSLLADWVPSRLAHVWLDTHGVAADARLADLPDKTLRRIGDALSGWTLTPNGTEGYKKAEVTKGGVDTRELSSATMMSARVPGLFFIGEAVDVTGWLGGYNFQWAWASGTAAGQAAAEFARGA
>NZ_CP009793.1|WP_006765499.1|1613242_1614283_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MLVLGIESSCDETGLALYDTQRGLLAHALHSQIAMHRDYGGVVPELASRDHIRRALPLLEEVMDKSGTRRDDIDAIAFTQGPGLAGALLVGASIANALALAWNKPTVGIHHLEGHLLSPLLVDEPPPFPFVALLVSGGHTQLMRVTEVGVYETLGETLDDAAGEAFDKTAKLLGLGYPGGPEVSKLAESGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTQMKKFDAAQLSGDALQRAKADLARGFVDAAVDVLVAKSLAALKKTKLKRLVVAGGVGANRQLRAALSAAAAKRGYDVHYPDLALCTDNGAMIALAGALRLGRWPEQANTDYAFTVKPRWDLASLAR
>NZ_CP009793.1|WP_006765498.1|1614388_1615198_-|GTP-cyclohydrolase-I-FolE2
MNQMNPAFVMPDVQSTVDTRQIPIQRVGVKAVRHPLTVCTESGDVQPTVGVWNLDVRLPADQKGTHMSRFVALLEENRAPLTVERFRAMLASMLAKLEAEAGRIEVTFPYFVNKTAPVSGVQSLLDYEVTLAGESRNGDTRVFLKVLVPVTSLCPCSKKISQYGAHNQRSHVTIDAELAADLPVEALIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFVEDLVRDVAQRLDADERIVAYVLEAENFESIHNHSAYALIERDKRQAG
>NZ_CP009793.1|WP_035973646.1|1615352_1617257_-|1-deoxy-D-xylulose-5-phosphate-synthase
MYDLLKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHTLRQFGGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVLSVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELRGPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQQPNPTAVRYPRGAGTGVATVKEFTEIPLGKGEVRRRTSQPEGKRVAILAFGTMVAPSLAAAEELDATVANMRFVKPLDAALVRELAQTHDYLVTAEEGCVMGGAGSACVEALMESGVIRPVLQLGLPDQFIDHGDPATLLSQCGLDAAGIAKSIRERFLNPAADVAGQAKRVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009793_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009793_2

1604093-1604241

Orphan

Consensus_repeat	Method
CCGACTCCGACTCCGACTCCGAC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009793_2

>merge|NZ_CP009793|2|1604093-1604241|CRISPRCasFinder
CCTGGGCCGACGCCAACACCGACTCCGACTCCAACGCCTACGCCTACGCCTACGCCGACACCGACACCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACTCCGACGCCAACGCCAACGCCAAC

>NZ_CP009793|2|2|1604093-1604241|CRISPRCasFinder
CCTGGGCCGACGCCAACACCGAC	TCCGACTCCAACGCCTACG
CCTACGCCTACGCCGACACCGAC	ACCGACTCCGACTCCGACT
CCGACTCCGACTCCGACTCCGAC	TCCGACTCCGACTCCGACT
CCGACGCCAACGCCAACGCCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009793.1\|WP_081293642.1\|1606527_1608942_-\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|235549
NZ_CP009793.1\|WP_158380444.1\|1591978_1592824_+\|fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP009793.1\|WP_035975118.1\|1589911_1591393_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP009793.1\|WP_006765508.1\|1587199_1588318_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP009793.1\|WP_006765498.1\|1614388_1615198_-\|GTP-cyclohydrolase-I-FolE2	unknown	unknown	gnl\|CDD\|237466
NZ_CP009793.1\|WP_035973662.1\|1586249_1587107_-\|CerR-family-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|236928
NZ_CP009793.1\|WP_006765500.1\|1611892_1613113_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224992
NZ_CP009793.1\|WP_006765501.1\|1610979_1611426_-\|GatB/YqeY-domain-containing-protein	unknown	unknown	gnl\|CDD\|370480
NZ_CP009793.1\|WP_006765496.1\|1617338_1618223_-\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|182567
NZ_CP009793.1\|WP_123806729.1\|1592866_1593799_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_006765499.1\|1613242_1614283_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP009793.1\|WP_006765504.1\|1596500_1598216_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_035973646.1\|1615352_1617257_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP009793.1\|WP_006765507.1\|1588310_1589897_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP009793.1\|WP_006765502.1\|1609030_1610905_-\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NZ_CP009793.1\|WP_123806730.1\|1605420_1605936_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_004190342.1\|1611604_1611817_-\|30S-ribosomal-protein-S21	unknown	unknown	gnl\|CDD\|234707
NZ_CP009793.1\|WP_108623482.1\|1595362_1596409_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_CP009793.1\|WP_006765506.1\|1593817_1595242_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009793.1\|WP_081293643.1\|1598216_1601600_-\|inverse-autotransporter-beta-domain-containing-protein	unknown	unknown	gnl\|CDD\|378762

Protein	Function_ID	Function_description	E-value
NZ_CP009793.1\|WP_035975118.1\|1589911_1591393_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	8.12594e-82
NZ_CP009793.1\|WP_006765508.1\|1587199_1588318_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	2.80779e-102
NZ_CP009793.1\|WP_006765498.1\|1614388_1615198_-\|GTP-cyclohydrolase-I-FolE2	gnl\|CDD\|237466	PRK13674, PRK13674, GTP cyclohydrolase I FolE2.	2.33162e-154
NZ_CP009793.1\|WP_108623482.1\|1595362_1596409_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.70006e-08
NZ_CP009793.1\|WP_006765500.1\|1611892_1613113_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224992	COG2081, COG2081, Predicted flavoproteins [General function prediction only].	1.28479e-175
NZ_CP009793.1\|WP_006765501.1\|1610979_1611426_-\|GatB/YqeY-domain-containing-protein	gnl\|CDD\|370480	pfam09424, YqeY, Yqey-like protein. The function of this domain found in the YqeY protein is uncertain.	2.06497e-59
NZ_CP009793.1\|WP_006765499.1\|1613242_1614283_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP009793.1\|WP_081293643.1\|1598216_1601600_-\|inverse-autotransporter-beta-domain-containing-protein	gnl\|CDD\|378762	pfam11924, IAT_beta, Inverse autotransporter, beta-domain. This is a family of beta-barrel porin-like outer membrane proteins from enteropathogenic Gram-negative bacteria. Intimins and invasins are virulence factors produced by pathogenic Gram-negative bacteria. They carry C-terminal extracellular passenger domains that are involved in adhesion to host cells and N-terminal beta domains that are embedded in the outer membrane. This family represents the beta-barrel porin-like domain in the outer membrane that can be found in intimins, invasins and some inverse autotransporters.	5.0044e-116
NZ_CP009793.1\|WP_006765496.1\|1617338_1618223_-\|polyprenyl-synthetase-family-protein	gnl\|CDD\|182567	PRK10581, PRK10581, (2E,6E)-farnesyl diphosphate synthase.	1.65828e-83
NZ_CP009793.1\|WP_035973646.1\|1615352_1617257_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP009793.1\|WP_006765507.1\|1588310_1589897_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.09184e-100
NZ_CP009793.1\|WP_006765502.1\|1609030_1610905_-\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NZ_CP009793.1\|WP_004190342.1\|1611604_1611817_-\|30S-ribosomal-protein-S21	gnl\|CDD\|234707	PRK00270, rpsU, 30S ribosomal protein S21; Reviewed.	4.66337e-16
NZ_CP009793.1\|WP_158380444.1\|1591978_1592824_+\|fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	9.0054e-14
NZ_CP009793.1\|WP_035973662.1\|1586249_1587107_-\|CerR-family-C-terminal-domain-containing-protein	gnl\|CDD\|236928	PRK11552, PRK11552, putative DNA-binding transcriptional regulator; Provisional.	4.27245e-26
NZ_CP009793.1\|WP_081293642.1\|1606527_1608942_-\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|235549	PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated.	0

>NZ_CP009793.1|WP_081293643.1|1598216_1601600_-|inverse-autotransporter-beta-domain-containing-protein
MFKWIPMRFRTRHAIGGRGRTSRCGVASRVFVMLLAIVAIGASQASAKESGSTIVTSSASAPVESAGNAPCGSRDGSACCASAPSSGADRPAVAASGPDGATGNGSAHTNCTSALSTINRPDRYNLPDLGAGKTAVTSKDDATRRSVLTPVLQQLTQFGSSAAYGQSMTDIGLGYLTGRANQYMFGGLQRWLSQFGTANVSMSVDNHGRLTDGSTNFLLPLYDDKGSWLVFTQLGYLRWDGRNTINVGLGARHFDNDWMNGVNAFFDDDLTGHNQRVGAGVELAANYLKFSANGYLGLTNWHRSLDYIDYDERPANGFDVASQMYLPSLPQLGVKLKYEQYFGSGVDLLGSGDRQKNPFAVTAGLEYTPVPAVTVGAAYRRGTGSISDVLFNVQLNYRLGVPLAQQFDPRAVGSMRTLAGSRYDLVQRNNRIVLDYRKHVEIRLSLGGALSGYAGQVIAVPVAVTATYGLQSIQWSAPELFARGGTVSGTNGSYFVTLPSYQPGGNNTYTIRGVAVDQRGNASSPAEMQVTVIGESAAISADQSSAAFSPDRIYADGRSTSTLTITVVDTNGNGVAGLAQDIDLQAAFNGGSTTQAQAGGSAITGGLSQQPRIGSITDLRNGIYVATVTAGTSTGTLTVTPLLRNEKIKLKAAPLMLVAPAQHSVKITNVSVTPQGNVAADGNAYYTFTAQVVDATTGLPVKNDPLVGLNWQVSPKPSTIGNAGWLVLTPGSSTTDDSGRITATLKSKIDDTAFTVSAQLGAAAPVSAPPVTFTVAARVAAVRIVVPSSGNYQIATLNNDLNIPVYVHAPLAGSGDQGFQYVATVVDARNLPVANRSLTSLGVQWLPSRSPSGSSESWTVQPTTNGAGEAIAVYRSWRVLGSDGPLSVSVQAGNQAAMRATGGSFDVVAFSDLPREDHQVQYVNSAGQTGSVLPAMLDTQATIYVTGVTFVELAQMAQLGNTDTVLRATSSNPSVFQITPSNLINALKPGSATVNVLYVHNGFRFTQNLSLTATFVAKVIGTPQEQPLLGDTPCRTSAGSQYDDINGADAANFFQFFSQDSTSPGYALDDIAKFWGGLSLNQTQKHFWLNYYGVAWYGGEVYNGPDAQGSINRTETGQGVMVCKVVS
>NZ_CP009793.1|WP_006765504.1|1596500_1598216_-|hypothetical-protein
MDDQATEQQAAGVIAGIHWDHRKEMVMAGGVTGAVIQPSSGDALVDGKALVTNPHGILEFSVQLQFSGTPVDGAVLLTVTEPNGVKLLNPSPGLPNEIVFTSGEPVVSPLFSIPYGATASGLTFSATPIWNDVTGTAVPMTQPLRWIDPGFLSPSVAVSNYAEGDIPTVNAYQADASGMVTALVKDMSGLVVSGATVLMGAPDDAYLGSFVLKDVNGQSLTASGKLQDGSPAVSVTTGSNGVAAFAICPNGESAHAFAGFDAQVSGRFISPGQSQAGFVVADLKSAQDDSVIAFATIPAPSIEGAEGKNYTPQPGQQHCRISIKTTWEKAALDDKILIVVQDRPRAVVSVADCVGDEKFTPGMEITYTMQVQQLITGNNISLRFLVLRNDADDPYYSYYTTWNIGTLPQPEPVLNSAVCPAPRLFVKTIDASGNAALGAELLSDIDYIVGWNDIREGGIYAFIPYHATDISQGVHGAVTMTAYLNGERPGGNVVVHQPKQYSVTVGDNAVSPSGANLPHGALVLMTTDVLRGWERDGNGYAQPFQVQYVDASTDYSKVWNGRIDTVPDDGQ
>NZ_CP009793.1|WP_108623482.1|1595362_1596409_-|glycosyltransferase
MLASDECVSTDDKRRPDHREGPQPVRMLPASGLTRRGNILFQYNLISGCSYHRVLLPLGNMPDFDTRVPVLYFNRDGFEPAALEDFRRRGGRVVIDLDDDIVLGDDHVLYDAFKDLGCAARIVTCVKLADAVLVTNEQLASRVAQFNRNVVVVPNALPFDEGQFGLTAPDGGRKIVYAGGYTHEADLRLVRDALPRDEFVLAGDPGTRGEDVASQAWTRIRAMLDFAEVRPALGVKEYMRHYVGRSISIAPLVDTPFNRCKSNLKALEAGAKGLAFVASRVLPYDNAVDKDVVLYASSEAEWKAVLGKLVDDPVYCAERGQALAEHVRRHYHIRDANAIRRQVFESFR
>NZ_CP009793.1|WP_006765506.1|1593817_1595242_+|hypothetical-protein
MEEDDTIPPAPWCDIAVKSGNGYTLDVSLIVDTFVIEVPAWNEGLGGPRPGDLYTVYFNDYIFTQEEVADEEQAQWNPYRVPFHVWEVPNGSYNVYYTLWDQVQSNPKRISKTYPLTITGSKAVGGLPAPTFPKSRPDPGNGQQRVEYFADIMADGGVAIEATYNVDPGDKVTFCWVGYDMNGDIVPQSKCMIPGTIAGGTAYATIPARHVLCLGPDSNASAYYHVERQPPNGDPTDSATATLGISFENIVTLEANVAQGAPAHILGTSFCGRAAVRVFGSPGKQVDASLPGDSRCTILEATQSDKRDHSLTLDEYGIGLFHVVPNDQYGTTVTLADDTFTSPPLPVQFSGAQSDSNDSAITAYTYTTGAAANSPMFQDVSVCSIYAKVDRSVLPSGINTLEVTVGGRARLFAFPGQQTASVPIDDDGTVAVDVIDSFVETVQVSIGVAGYPAIHFPIEFAAFPSWRKLSDSPA
>NZ_CP009793.1|WP_123806729.1|1592866_1593799_+|hypothetical-protein
MSAGRAHSTAARSGKSSVTTESTRTVRSIRCKHFTAARQTIRTSRFARRPRHVSLVAIPFPGALIVADIDAVFTTGAPLRDAPIEGKAFPEVKPYNVISVYGERGRAIDANAQGGAKFLEGNPSDPTHVGNYQLDENGRADLHLYFDYTDGHSRRIANLDSATVTVGYSNDLGDQTKPLQPVFSPYQRESTNTVILGFANTSEAPANGDSTMPTPCTVYVCVDTAMYKNVTSVRFAITNAEQGKVWIDDGSGQKPTWIDSPLAQGTSSTSVDILSNTAQKAWTVEISTQAPFDSAHVTVKFVEPPATPHR
>NZ_CP009793.1|WP_158380444.1|1591978_1592824_+|fimbrial-protein
MLPSNVSVSAAAPVGAVVWESPVIAKTFYCESSEKEPVAFWVNPRKESVGEGLEVAIRYKGKLYRQADGAIPTGAVIDGWGLAVWWKYFDVSYSVALIKTSASPGSGQATIANYPAFQLDSQSGLVVNPTRLFTQLLTGTVKFVPGTCDIRAGDDRKVVVLPAVANVSLSTVGATSGRTALSVAVQNCVGVKQVKFSFSGAPDDNMPVAFRNTGTAKGVAVRLAKAGDDGTIAANGTASSIVEPVTNDAASVRLHAEYIGTTGRPTAGSVSSLATMNIDYQ
>NZ_CP009793.1|WP_035975118.1|1589911_1591393_+|efflux-transporter-outer-membrane-subunit
MKPFPLPRHAALTLGAAACLLAGCTVGPDYRGAPAAPDTPIFVRAPASGVDAGTPAPSAWWHALNDRQLDALIAAALAHNPDVHAAQARLREARAQLTQQRAAQLPKSSATVAAIRMREPDVSGLGSLLPSNSDQSSRTSPSAGASGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSLAAEVATAYVDLRDRQQRLALSQRTAELQRRMLELTQQRRARGAAADADIERLTTQVENTRASLIPLDAQVTESLDRLAILTGRAPGALDAELSAPDAPLPTLPGSVPIGDPAALLKQRPDIRAAERRLASSNAQIGEHVADYFPKVTLLGDLGFSASDPGHLLRKQNFTWIGAPYLQWNILDFGRTRGAVRAAQASRDEAEANYRKAVLGALQDANTALQRYGHQREHVVALTKVRTSATHSAALMDQRYRAGVASMIDLLDTQREALAAQQNVIAGQAELIKDYVSLQKSLGLGWQSVG
>NZ_CP009793.1|WP_006765507.1|1588310_1589897_+|multidrug-efflux-MFS-transporter
MADTPATMPAPPHEGRASVTDWIAVAAGALGALMATLDISITNSALPQIQGEIGATGTEGTWISTGYLMSEIVMIPLAAWLTRVFGLRNFLLTNAALFIAFSMMCGWSNSLAMMIVGRIGQGFTGGALIPTAQTIIRTRLPLSQLPVGMTLFGLIVLLGPLFGPVLGGWLAENVSWSWCFFLNLPVCLLLMALLVFGLPSDRPQWATFRNADWLGIAGLAIGLSSLTVVLEEGQRERWFESQMIVTLSYVSLAGMILIALSQRFAKRPIMRLSLMRNPRYASVIVIVSAVGAGLYGVSYLLPQFLAIVAGYNAEQAGAIMLLSGLPAFLVMPILPRLLGKVDFRILVIAGLLLFCLSCMLDIDLTAQSVGHDFVWSQLIRGVAQMLAMMPLNQASMAAVAREESGDAAGLYNMARNLGGSIGLAVIGTVIDRRTTYHTAVLRESVSANSPIGQDRLSTYAANWFAHTGDAAYSNLRALGQFARQIQIQATVMTYSETFYLLGLALLACVPLAMLLRTPRGPQPTSSGH
>NZ_CP009793.1|WP_006765508.1|1587199_1588318_+|HlyD-family-secretion-protein
MSTPQDPPQKADRQEPGTAPRNGGSKRRILLVVVAVAALGGAIWLARWWTVGRFIESTNDAYLQADSMTAAPKVAGYVTDVYVRDNQAVKAGDPLVRLDVRQYRVALDQALATVDARRADIARAEADIAQQRANLEQAEAQAKVSQINARHASDEYARYAPLAATGAETHERVAELKSTRDQALATLAANNASIAAARTQIASFTAQLQQTRAQLEAAEASAAQARLDLDNTIVRSTLDGRVGDRTVRVGQYVQPGTRLLTVVPVDSIYLVANFKETQIGRMRIGQPVELHVDALPDAELTGTVDSFAPGTGAQFALLPPENATGNFTKIVQRVPVRIRLAADARAQRMLLPGLSVTVDVDTRSHGDEKRHG
>NZ_CP009793.1|WP_035973662.1|1586249_1587107_-|CerR-family-C-terminal-domain-containing-protein
MNEAKKLRRTATGGYARGDETRQRIIDAAIELFGEHGFAGASTRDIAAKAGVNAPALQYYFENKEGVYRACADAMAELGWSVLGPAVEHARSALDADADVDALIDAFIGILRTLADRIMTVPKTRGQRMFFAREQLGQEPESASEILMKRVRKPLNDVSAELVGRICGRPADDPVIRLRTMSLFGQLTVFQLVQRSALQLLDWETFEGEGAALLIATIGDQTRVLLEHWHAQRGEFAGDGAQAGAKRRARTGADAPAKRAAKPAQPTRAANRANPARQVKKPASR
>NZ_CP009793.1|WP_123806730.1|1605420_1605936_+|hypothetical-protein
MIQLHRCKQDNPFDCFPELRTIWPEPHLQALAEQATIETLDAQTVPGTPDRGPIFLILDIDAAGYERVVGISGYYTLDDRAEQLGLRWHGIVPRARGHGFSRLAFEQVLQTIRTSLPNAREITEIVPLIERGEHIAKHFQQLGFTPRGEPKLYDWAPHAWQCWARILDFKA
>NZ_CP009793.1|WP_081293642.1|1606527_1608942_-|RNA-polymerase-sigma-factor-RpoD
MAKTTGGKKATGKGSTEPTKKVTAAKSASSARTTSSATSATARKKTAAGTAQAAPAPAARTRAAARPDSGPAKPAAKRASAKSARDAAAEPDETAVRTTHASTVQPAVVQQPRVDIAGTANSMTKKLNEVSVDDDANQSDEQPAAAAAPGKSKVRDRRAKEKALLKEAFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGIIGTFNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYMREMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEEIRVDELVDGLLDPNAADTDTDGFSAKEAEAIENEDEDAEEEEEEEEEEDDDGAAQATANAAQLEALKRASLEKFALISEWFDKMRRAFEKEGYKSKAYLKAQETIQSELMTIRFTARTVERLCDTLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGNETDLDWAEKIAAEGHPYSAVLSRNIPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETPIGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN
>NZ_CP009793.1|WP_006765502.1|1609030_1610905_-|DNA-primase
MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSPSFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSMRGGGGGGGGGDYPAPVSKSVATALSDVMSVACDYYRKQLRGATVAIQYLKSRGLTGEIAARFGLGYAPDGWQNLEAAFPDYRDESLVESGLVIVSEKTDAQGVARRYDRFRERIMFPIRNVKGQVIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDVVALAQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALDACLPHAADNRTIRFLFLPPEHDPDSYVREFGADAFSEQVERAMPLSQFLLNEAISGKALDQPEGRAKALFDAKPLLQALPANALRAQIMHMFADRLDIPFEEVAALCDVDSRIAAPLRHAPARSERRRVTDSEKRALRTLVMYPRIALQLDDEQIATLRVLPRIGELFAEVVDHARALGDGAEFRLLSDVLRTSSNAATYEEIFREILDYDENVRDLLLQNPDDDAAAERQREQERIAGEELQAAVLKMRYDACCDRLDRLARQSALTSEELAELTELNQQRTDMKRRLGL
>NZ_CP009793.1|WP_006765501.1|1610979_1611426_-|GatB/YqeY-domain-containing-protein
MSLKEQISEDMKAAMRAKESERLATIRLLMAAIKQREVDDQVTLDDAGITAVIDKMIKQRKDSISQFQAAGRDDLVAKEQAELTVLAAYMPAQLSDDEVAAEVQAAIAQTGAAGPQDMGKVMGVLKGKLAGRADMTAVSAQVKAALSK
>NZ_CP009793.1|WP_004190342.1|1611604_1611817_-|30S-ribosomal-protein-S21
MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRIRSQMLPKKLY
>NZ_CP009793.1|WP_006765500.1|1611892_1613113_-|NAD(P)/FAD-dependent-oxidoreductase
METYDIAVIGAGAAGMMSAAVAGQLGRRVVLIDHAPRLAEKIRISGGGRCNFTNLYAGPDNYLSANPHFARSALARYTPRDFLALLKRHRVTWHEKHKGQLFCDHGSDAIIDVLKHECDAGGIAWRRPVVVDAVRHAPADGFMLDTQQAGTIAARALIVATGGLSIPKIGATDFGYRLAKQFGHKLVDTRPALVPLTFAQQDWEPFAALSGVSLEVRVSTGDKKRGGEFVEDLLLTHRGLSGPGILQISSYWQPGDPIRVDLLPQRDAVADLLDAKRTSKRQIGSLLADWVPSRLAHVWLDTHGVAADARLADLPDKTLRRIGDALSGWTLTPNGTEGYKKAEVTKGGVDTRELSSATMMSARVPGLFFIGEAVDVTGWLGGYNFQWAWASGTAAGQAAAEFARGA
>NZ_CP009793.1|WP_006765499.1|1613242_1614283_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MLVLGIESSCDETGLALYDTQRGLLAHALHSQIAMHRDYGGVVPELASRDHIRRALPLLEEVMDKSGTRRDDIDAIAFTQGPGLAGALLVGASIANALALAWNKPTVGIHHLEGHLLSPLLVDEPPPFPFVALLVSGGHTQLMRVTEVGVYETLGETLDDAAGEAFDKTAKLLGLGYPGGPEVSKLAESGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTQMKKFDAAQLSGDALQRAKADLARGFVDAAVDVLVAKSLAALKKTKLKRLVVAGGVGANRQLRAALSAAAAKRGYDVHYPDLALCTDNGAMIALAGALRLGRWPEQANTDYAFTVKPRWDLASLAR
>NZ_CP009793.1|WP_006765498.1|1614388_1615198_-|GTP-cyclohydrolase-I-FolE2
MNQMNPAFVMPDVQSTVDTRQIPIQRVGVKAVRHPLTVCTESGDVQPTVGVWNLDVRLPADQKGTHMSRFVALLEENRAPLTVERFRAMLASMLAKLEAEAGRIEVTFPYFVNKTAPVSGVQSLLDYEVTLAGESRNGDTRVFLKVLVPVTSLCPCSKKISQYGAHNQRSHVTIDAELAADLPVEALIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFVEDLVRDVAQRLDADERIVAYVLEAENFESIHNHSAYALIERDKRQAG
>NZ_CP009793.1|WP_035973646.1|1615352_1617257_-|1-deoxy-D-xylulose-5-phosphate-synthase
MYDLLKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHTLRQFGGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVLSVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELRGPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQQPNPTAVRYPRGAGTGVATVKEFTEIPLGKGEVRRRTSQPEGKRVAILAFGTMVAPSLAAAEELDATVANMRFVKPLDAALVRELAQTHDYLVTAEEGCVMGGAGSACVEALMESGVIRPVLQLGLPDQFIDHGDPATLLSQCGLDAAGIAKSIRERFLNPAADVAGQAKRVA
>NZ_CP009793.1|WP_006765496.1|1617338_1618223_-|polyprenyl-synthetase-family-protein
MTFEQWMRSVLDRVEDALGHYLPAESAVPTRLHEAMRYAVLGGGKRVRPLLCHAAGELTGATEAARNAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVQYDEPTALLVGDALQSQAFVALTDADALSPVQQAALVRELALASGSLGMAGGQAIDLASVGIKLTREQLETMHRMKTGALLRAAVRMGALAGETPSADTMAALDVYAGAVGLAFQVVDDILDVTTDSATLGKTAGKDAANDKPTYVSILGLDASRELAAQLRAEAHDALKPFGARAQRLAELADLVVNRVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1427679-1427697	1	0.947
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1427685-1427703	1	0.947
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1604242-1604260	1	0.947
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1446542-1446560	1	0.947
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1427691-1427709	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1604236-1604254	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	1863105-1863123	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	619669-619687	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	668735-668753	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009793.1	983469-983487	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009795.1	246236-246254	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009795.1	1404255-1404273	2	0.895
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	NZ_CP009794.1	1051-1069	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1446542-1446560	0	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1427679-1427697	0	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1427685-1427703	0	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1604242-1604260	0	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1427691-1427709	1	0.947
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1604236-1604254	1	0.947
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1073963-1073981	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1586804-1586822	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1993345-1993363	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	29473-29491	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	89446-89464	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1427727-1427745	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1427733-1427751	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1427739-1427757	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1563774-1563792	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1604230-1604248	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1863105-1863123	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009793.1	1908570-1908588	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	1548606-1548624	1	0.947
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	246236-246254	1	0.947
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	103892-103910	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	193292-193310	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	401662-401680	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	404180-404198	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	530275-530293	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	530287-530305	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	1487028-1487046	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	2058902-2058920	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	2153300-2153318	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	3396480-3396498	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	653616-653634	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	1737269-1737287	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	1828436-1828454	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	2074490-2074508	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009795.1	3306336-3306354	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009794.1	3059-3077	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009794.1	1051-1069	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009794.1	267914-267932	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009794.1	267920-267938	2	0.895
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009794.1	267926-267944	2	0.895
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009793.1	1106179-1106197	2	0.895
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009793.1	1602561-1602579	2	0.895
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122215-3122233	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122221-3122239	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122227-3122245	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122233-3122251	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122239-3122257	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122245-3122263	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122251-3122269	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122257-3122275	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122263-3122281	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122269-3122287	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122275-3122293	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122281-3122299	0	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009795.1	3122143-3122161	2	0.895
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009794.1	147551-147569	2	0.895
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009794.1	580841-580859	2	0.895

1. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427679-1427697, mismatch: 1, identity: 0.947

gccgactccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
****** ************

2. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427685-1427703, mismatch: 1, identity: 0.947

gccgactccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
****** ************

3. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1604242-1604260, mismatch: 1, identity: 0.947

gccgactccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
****** ************

4. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1446542-1446560, mismatch: 1, identity: 0.947

gccgactccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
****** ************

5. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427691-1427709, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgacgccgacgcctacg	Protospacer
****** ******** ***

6. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1604236-1604254, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccaacgccgacgccgacg	Protospacer
***.** ************

7. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1863105-1863123, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgataccgacgccgacg	Protospacer
*****. ************

8. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 619669-619687, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gcagactgcgacgccgacg	Protospacer
** **** ***********

9. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 668735-668753, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgactccgacgcggccg	Protospacer
************** * **

10. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 983469-983487, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgaatccgccgccgacg	Protospacer
***** **** ********

11. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 246236-246254, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgacgccgacgccggcg	Protospacer
****** *********.**

12. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1404255-1404273, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgaatccgacggcgacg	Protospacer
***** ******* *****

13. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to position: 1051-1069, mismatch: 2, identity: 0.895

gccgactccgacgccgacg	CRISPR spacer
gccgacacggacgccgacg	Protospacer
****** * **********

14. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1446542-1446560, mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

15. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427679-1427697, mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

16. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427685-1427703, mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

17. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1604242-1604260, mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

18. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427691-1427709, mismatch: 1, identity: 0.947

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgcctacg	Protospacer
*************** ***

19. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1604236-1604254, mismatch: 1, identity: 0.947

gccgacgccgacgccgacg	CRISPR spacer
gccaacgccgacgccgacg	Protospacer
***.***************

20. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1073963-1073981, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgtcgatgccgacg	Protospacer
*******.***.*******

21. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1586804-1586822, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgatgccgacgtcgacg	Protospacer
*****.*******.*****

22. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1993345-1993363, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccttcgccgacgccgacg	Protospacer
***  **************

23. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 29473-29491, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgtcgacgccggcg	Protospacer
*******.********.**

24. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 89446-89464, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgaagccggcgccgacg	Protospacer
***** ****.********

25. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427727-1427745, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gcccacgcccacgccgacg	Protospacer
*** ***** *********

26. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427733-1427751, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gcccacgccgacgcccacg	Protospacer
*** *********** ***

27. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1427739-1427757, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgcccacgcccacg	Protospacer
********* ***** ***

28. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1563774-1563792, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgaccacgacg	Protospacer
************  *****

29. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1604230-1604248, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccaacgccaacgccgacg	Protospacer
***.*****.*********

30. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1863105-1863123, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgataccgacgccgacg	Protospacer
*****..************

31. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1908570-1908588, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgccgccgacgtcgacg	Protospacer
**** ********.*****

32. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1548606-1548624, mismatch: 1, identity: 0.947

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgacgacg	Protospacer
************* *****

33. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 246236-246254, mismatch: 1, identity: 0.947

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccggcg	Protospacer
****************.**

34. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 103892-103910, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgaggccgacgacgacg	Protospacer
***** ******* *****

35. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 193292-193310, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgaggccgccgccgacg	Protospacer
***** **** ********

36. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 401662-401680, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacttcgacg	Protospacer
************ .*****

37. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 404180-404198, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgaccgcgacg	Protospacer
************  *****

38. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 530275-530293, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgtcgacgacgacg	Protospacer
*******.***** *****

39. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 530287-530305, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccggggccgacg	Protospacer
**********. *******

40. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1487028-1487046, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgtcgccggcgccgacg	Protospacer
**** *****.********

41. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 2058902-2058920, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gcccacgccgacaccgacg	Protospacer
*** ********.******

42. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 2153300-2153318, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgccgccgacgccgtcg	Protospacer
**** *********** **

43. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 3396480-3396498, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgtcgacggcgacg	Protospacer
*******.***** *****

44. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 653616-653634, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgacgacgtcgacg	Protospacer
******* *****.*****

45. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1737269-1737287, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgacgacgtcgacg	Protospacer
******* *****.*****

46. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1828436-1828454, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgaggccgatgccgacg	Protospacer
***** *****.*******

47. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 2074490-2074508, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacgcccacgtcgacg	Protospacer
********* ***.*****

48. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 3306336-3306354, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgaggccgacgccgccg	Protospacer
***** ********** **

49. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 3059-3077, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gctgccgccgacgccgacg	Protospacer
**.* **************

50. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 1051-1069, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacacggacgccgacg	Protospacer
******.* **********

51. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 267914-267932, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgccgccgccgccgacg	Protospacer
**** ***** ********

52. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 267920-267938, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgccgccgacggcgacg	Protospacer
**** ******** *****

53. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to position: 267926-267944, mismatch: 2, identity: 0.895

gccgacgccgacgccgacg	CRISPR spacer
gccgacggcgacggcgacg	Protospacer
******* ***** *****

54. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 1106179-1106197, mismatch: 2, identity: 0.895

accgacaccgacaccgaca	CRISPR spacer
accgacaccgcgaccgaca	Protospacer
**********  *******

55. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 1602561-1602579, mismatch: 2, identity: 0.895

accgacaccgacaccgaca	CRISPR spacer
acctacgccgacaccgaca	Protospacer
*** **.************

56. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122215-3122233, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

57. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122221-3122239, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

58. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122227-3122245, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

59. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122233-3122251, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

60. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122239-3122257, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

61. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122245-3122263, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

62. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122251-3122269, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

63. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122257-3122275, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

64. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122263-3122281, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

65. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122269-3122287, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

66. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122275-3122293, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

67. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122281-3122299, mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

68. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 3122143-3122161, mismatch: 2, identity: 0.895

accgacaccgacaccgaca	CRISPR spacer
accgataccgataccgaca	Protospacer
*****.*****.*******

69. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 147551-147569, mismatch: 2, identity: 0.895

accgacaccgacaccgaca	CRISPR spacer
accggcaccgacgccgaca	Protospacer
****.*******.******

70. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to position: 580841-580859, mismatch: 2, identity: 0.895

accgacaccgacaccgaca	CRISPR spacer
accgacaacgacgccgaca	Protospacer
******* ****.******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP009793_1	1.1\|1602585\|19\|NZ_CP009793\|CRISPRCasFinder	1602585-1602603	19	MF140398	Mycobacterium phage Amohnition, complete genome	9062-9080	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP014515	Frondihabitans sp. PAMC 28766 strain SR6 plasmid 2, complete sequence	93615-93633	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	545193-545211	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049749	Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence	129742-129760	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	16514-16532	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009804	Streptomyces sp. FR-008 plasmid pSSFR2, complete sequence	19858-19876	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP009804	Streptomyces sp. FR-008 plasmid pSSFR2, complete sequence	19864-19882	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	445279-445297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_012521	Rhodococcus opacus B4 plasmid pROB02, complete sequence	69635-69653	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP011248	Agrobacterium tumefaciens strain Ach5 plasmid pAt, complete sequence	533555-533573	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124763-124781	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124769-124787	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124775-124793	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124781-124799	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124787-124805	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124793-124811	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	124799-124817	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	458934-458952	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	458988-459006	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP010991	Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence	62271-62289	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP010991	Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence	62277-62295	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP010991	Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence	62283-62301	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP010991	Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence	62289-62307	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP010991	Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence	62295-62313	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	50679-50697	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1058112-1058130	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP040720	Rhodococcus pyridinivorans strain YF3 plasmid unnamed1, complete sequence	113571-113589	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3461718-3461736	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2579519-2579537	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2579525-2579543	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	165151-165169	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	166690-166708	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	133478-133496	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	133592-133610	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	133736-133754	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	140593-140611	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023496	Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence	142135-142153	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP031267	Staphylococcus warneri strain 16A plasmid unnamed3	79790-79808	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP031267	Staphylococcus warneri strain 16A plasmid unnamed3	80060-80078	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP031267	Staphylococcus warneri strain 16A plasmid unnamed3	108073-108091	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP031267	Staphylococcus warneri strain 16A plasmid unnamed3	108343-108361	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	527768-527786	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	312547-312565	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	312553-312571	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	318824-318842	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	84761-84779	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	159496-159514	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	159502-159520	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP033029	Agrobacterium tumefaciens strain A6 plasmid pAtA6, complete sequence	804348-804366	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	223142-223160	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	223148-223166	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	223154-223172	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	223160-223178	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP044078	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence	107704-107722	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	371830-371848	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	502381-502399	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	502387-502405	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	177239-177257	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP043960	Streptomyces tendae strain 139 plasmid unnamed1, complete sequence	44005-44023	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1996878-1996896	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510993	Pseudomonas phage BR201, partial genome	20061-20079	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510993	Pseudomonas phage BR201, partial genome	20067-20085	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510962	Pseudomonas phage CF3, partial genome	21664-21682	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510962	Pseudomonas phage CF3, partial genome	21670-21688	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510984	Pseudomonas phage BR200, partial genome	13893-13911	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510984	Pseudomonas phage BR200, partial genome	13899-13917	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510971	Pseudomonas phage CF79, partial genome	9546-9564	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510971	Pseudomonas phage CF79, partial genome	9552-9570	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510965	Pseudomonas phage CF34, partial genome	2020-2038	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510965	Pseudomonas phage CF34, partial genome	2026-2044	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MH744418	Streptomyces phage JustBecause, complete genome	90767-90785	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MH744418	Streptomyces phage JustBecause, complete genome	90773-90791	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MH744418	Streptomyces phage JustBecause, complete genome	90779-90797	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510970	Pseudomonas phage CF67, partial genome	29239-29257	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510970	Pseudomonas phage CF67, partial genome	29245-29263	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510992	Pseudomonas phage BR144, partial genome	14131-14149	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510992	Pseudomonas phage BR144, partial genome	14137-14155	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510990	Pseudomonas phage BR133, partial genome	32546-32564	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510990	Pseudomonas phage BR133, partial genome	32552-32570	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510968	Pseudomonas phage CF55, partial genome	30614-30632	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510968	Pseudomonas phage CF55, partial genome	30620-30638	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510969	Pseudomonas phage CF60, partial genome	15409-15427	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK510969	Pseudomonas phage CF60, partial genome	15415-15433	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MN694766	Marine virus AFVG_250M151, complete genome	26752-26770	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MT310898	Streptomyces phage Kela, complete genome	90647-90665	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MT310898	Streptomyces phage Kela, complete genome	90653-90671	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	26477-26495	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	26483-26501	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	26489-26507	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	26495-26513	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1725826-1725844	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1725832-1725850	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP024924	Sphingomonas sp. Cra20 plasmid unnamed, complete sequence	36044-36062	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	15851-15869	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	15857-15875	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	15863-15881	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	15869-15887	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	15875-15893	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	15881-15899	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP047175	Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence	23376-23394	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP047175	Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence	23382-23400	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	253855-253873	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	253861-253879	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	253867-253885	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	546166-546184	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	546172-546190	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	676725-676743	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	676731-676749	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	342845-342863	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	342851-342869	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	71306-71324	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	71312-71330	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	242688-242706	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1796041-1796059	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1796047-1796065	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	755026-755044	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	143898-143916	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1724848-1724866	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1724854-1724872	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1725819-1725837	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1725825-1725843	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1725140-1725158	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1725146-1725164	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1725808-1725826	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1725814-1725832	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP020813	Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed4, complete sequence	40873-40891	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP037915	Sphingomonas sp. AAP5 plasmid p150, complete sequence	77214-77232	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP037915	Sphingomonas sp. AAP5 plasmid p150, complete sequence	77220-77238	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	80551-80569	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	80557-80575	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	KJ538722	Mycobacterium phage HH92, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	KT222940	Mycobacterium phage Kinbote, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MH727549	Mycobacterium phage Gancho, complete genome	42003-42021	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK919482	Mycobacterium phage DeepSoil15, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MN062704	Gordonia phage JuJu, complete genome	6208-6226	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MN062704	Gordonia phage JuJu, complete genome	6214-6232	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MT657330	Mycobacterium phage Webster2, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MF919517	Mycobacterium phage LilHazelnut, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	EU203571	Mycobacterium phage Giles, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK494095	Mycobacterium phage Daegal, complete genome	42863-42881	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MT818421	Mycobacterium phage Luke, complete genome	42234-42252	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MK937606	Microbacterium phage Margaery, complete genome	34000-34018	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MH697577	Mycobacterium phage Amochick, complete genome	42301-42319	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MT684594	Mycobacterium phage Hadrien, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	MT114159	Mycobacterium phage Ein37, complete genome	42279-42297	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	GU169904	Staphylococcus phage SA1, complete genome	54435-54453	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	KT246485	Mycobacterium phage OBUpride, complete genome	42275-42293	1.0
NZ_CP009793_1	1.2\|1602627\|19\|NZ_CP009793\|CRISPRCasFinder	1602627-1602645	19	KT454972	Mycobacterium phage Evanesce, complete genome	42279-42297	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528971-528989	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528977-528995	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528983-529001	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528989-529007	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528995-529013	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386541-1386559	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525709-525727	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4658-4676	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4664-4682	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4670-4688	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	MN693281	Marine virus AFVG_25M371, complete genome	15151-15169	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518238-518256	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518244-518262	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518250-518268	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518256-518274	1.0
NZ_CP009793_1	1.3\|1602669\|19\|NZ_CP009793\|CRISPRCasFinder	1602669-1602687	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518262-518280	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP018759	Pseudomonas psychrotolerans strain PRS08-11306 plasmid pPRS08-11306, complete sequence	50862-50880	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP018759	Pseudomonas psychrotolerans strain PRS08-11306 plasmid pPRS08-11306, complete sequence	50868-50886	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	232553-232571	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	232559-232577	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP052758	Cellulosimicrobium sp. BI34T plasmid pCPRO01, complete sequence	140704-140722	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP024775	Bacillus thuringiensis LM1212 plasmid pLM4, complete sequence	6534-6552	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1020632-1020650	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1020638-1020656	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	100969-100987	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	127448-127466	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	127454-127472	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	68840-68858	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	299927-299945	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	299933-299951	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	299939-299957	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	299945-299963	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	233051-233069	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	232563-232581	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_MF398271	Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence	177936-177954	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP032156	Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence	88619-88637	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MK878901	Gordonia phage HannahD, complete genome	4440-4458	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7673-7691	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7679-7697	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7685-7703	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7691-7709	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7697-7715	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7703-7721	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7709-7727	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT843275	Serratia phage vB_SspM_BZS1, complete genome	7715-7733	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MH479915	Gordonia phage GEazy, complete genome	4440-4458	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	688468-688486	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	32456-32474	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	37853-37871	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	43250-43268	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	48647-48665	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	54044-54062	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	68675-68693	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	82472-82490	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	88206-88224	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	88212-88230	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	94572-94590	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	99951-99969	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	110913-110931	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	116307-116325	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	122670-122688	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	128085-128103	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_005916	Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence	133500-133518	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	728676-728694	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	66105-66123	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	748616-748634	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	748622-748640	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	748628-748646	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	748634-748652	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	748640-748658	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	748646-748664	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	792501-792519	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	792507-792525	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56575-56593	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56581-56599	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56587-56605	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56593-56611	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56599-56617	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56605-56623	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	56611-56629	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP053710	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed2, complete sequence	242909-242927	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_011991	Agrobacterium vitis S4 plasmid pAtS4b, complete sequence	72651-72669	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_011991	Agrobacterium vitis S4 plasmid pAtS4b, complete sequence	72657-72675	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_011991	Agrobacterium vitis S4 plasmid pAtS4b, complete sequence	72663-72681	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NC_011991	Agrobacterium vitis S4 plasmid pAtS4b, complete sequence	72669-72687	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP007257	Rhodococcus erythropolis R138 plasmid pLRE138, complete sequence	197238-197256	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	256488-256506	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	256494-256512	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	88271-88289	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	47217-47235	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	52614-52632	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	58029-58047	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	63444-63462	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	68841-68859	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	83508-83526	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	97390-97408	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	103106-103124	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	109466-109484	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	114881-114899	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	125858-125876	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	131269-131287	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	137632-137650	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	143062-143080	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	148477-148495	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP041077	Bacillus tropicus strain LM1212-W3 plasmid p4, complete sequence	5572-5590	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_MF600313	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence	133627-133645	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_MF600313	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence	133633-133651	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	202453-202471	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	KT820175	Ruegeria phage 45A6, complete genome	35492-35510	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	KT820175	Ruegeria phage 45A6, complete genome	35498-35516	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	KT820175	Ruegeria phage 45A6, complete genome	35504-35522	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MH513970	Mycobacterium phage Hangman, complete genome	52077-52095	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT936332	Streptomyces phage phiRKBJ001, complete genome	68478-68496	1.0
NZ_CP009793_1	1.4\|1602711\|19\|NZ_CP009793\|CRISPRCasFinder	1602711-1602729	19	MT936332	Streptomyces phage phiRKBJ001, complete genome	68484-68502	1.0
NZ_CP009793_2	2.2\|1604158\|19\|NZ_CP009793\|CRISPRCasFinder	1604158-1604176	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518232-518250	1.0
NZ_CP009793_2	2.2\|1604158\|19\|NZ_CP009793\|CRISPRCasFinder	1604158-1604176	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	529001-529019	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528971-528989	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528977-528995	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528983-529001	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528989-529007	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528995-529013	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386541-1386559	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525709-525727	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4658-4676	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4664-4682	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4670-4688	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	MN693281	Marine virus AFVG_25M371, complete genome	15151-15169	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518238-518256	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518244-518262	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518250-518268	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518256-518274	1.0
NZ_CP009793_2	2.3\|1604200\|19\|NZ_CP009793\|CRISPRCasFinder	1604200-1604218	19	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518262-518280	1.0

1. spacer 1.1|1602585|19|NZ_CP009793|CRISPRCasFinder matches to MF140398 (Mycobacterium phage Amohnition, complete genome) position: , mismatch: 0, identity: 1.0

gccgactccgacgccgacg	CRISPR spacer
gccgactccgacgccgacg	Protospacer
*******************

2. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP014515 (Frondihabitans sp. PAMC 28766 strain SR6 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

3. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

4. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049749 (Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

5. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

6. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP009804 (Streptomyces sp. FR-008 plasmid pSSFR2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

7. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP009804 (Streptomyces sp. FR-008 plasmid pSSFR2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

8. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

9. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_012521 (Rhodococcus opacus B4 plasmid pROB02, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

10. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP011248 (Agrobacterium tumefaciens strain Ach5 plasmid pAt, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

11. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

12. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

13. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

14. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

15. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

16. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

17. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

18. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP053858 (Rhizobium pusense strain 76 plasmid pR76, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

19. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP053858 (Rhizobium pusense strain 76 plasmid pR76, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

20. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP010991 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

21. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP010991 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

22. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP010991 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

23. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP010991 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

24. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP010991 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

25. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

26. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

27. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP040720 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

28. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

29. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

30. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

31. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

32. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

33. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

34. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

35. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

36. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

37. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023496 (Staphylococcus simulans strain FDAARGOS_383 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

38. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP031267 (Staphylococcus warneri strain 16A plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

39. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP031267 (Staphylococcus warneri strain 16A plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

40. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP031267 (Staphylococcus warneri strain 16A plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

41. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP031267 (Staphylococcus warneri strain 16A plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

42. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

43. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

44. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

45. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

46. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

47. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

48. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

49. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP033029 (Agrobacterium tumefaciens strain A6 plasmid pAtA6, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

50. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

51. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

52. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

53. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

54. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP044078 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

55. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

56. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

57. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

58. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

59. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP043960 (Streptomyces tendae strain 139 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

60. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

61. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510993 (Pseudomonas phage BR201, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

62. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510993 (Pseudomonas phage BR201, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

63. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510962 (Pseudomonas phage CF3, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

64. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510962 (Pseudomonas phage CF3, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

65. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510984 (Pseudomonas phage BR200, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

66. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510984 (Pseudomonas phage BR200, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

67. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510971 (Pseudomonas phage CF79, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

68. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510971 (Pseudomonas phage CF79, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

69. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510965 (Pseudomonas phage CF34, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

70. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510965 (Pseudomonas phage CF34, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

71. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MH744418 (Streptomyces phage JustBecause, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

72. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MH744418 (Streptomyces phage JustBecause, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

73. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MH744418 (Streptomyces phage JustBecause, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

74. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510970 (Pseudomonas phage CF67, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

75. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510970 (Pseudomonas phage CF67, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

76. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510992 (Pseudomonas phage BR144, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

77. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510992 (Pseudomonas phage BR144, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

78. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510990 (Pseudomonas phage BR133, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

79. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510990 (Pseudomonas phage BR133, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

80. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510968 (Pseudomonas phage CF55, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

81. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510968 (Pseudomonas phage CF55, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

82. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510969 (Pseudomonas phage CF60, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

83. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK510969 (Pseudomonas phage CF60, partial genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

84. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MN694766 (Marine virus AFVG_250M151, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

85. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MT310898 (Streptomyces phage Kela, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

86. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MT310898 (Streptomyces phage Kela, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

87. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

88. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

89. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

90. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

91. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

92. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

93. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP024924 (Sphingomonas sp. Cra20 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

94. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

95. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

96. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

97. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

98. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

99. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

100. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP047175 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

101. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP047175 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

102. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

103. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

104. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

105. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

106. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

107. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

108. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

109. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

110. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

111. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

112. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

113. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

114. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

115. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

116. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

117. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

118. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

119. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

120. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

121. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

122. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

123. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

124. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

125. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

126. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020813 (Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

127. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP037915 (Sphingomonas sp. AAP5 plasmid p150, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

128. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP037915 (Sphingomonas sp. AAP5 plasmid p150, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

129. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

130. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

131. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to KJ538722 (Mycobacterium phage HH92, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

132. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to KT222940 (Mycobacterium phage Kinbote, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

133. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MH727549 (Mycobacterium phage Gancho, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

134. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK919482 (Mycobacterium phage DeepSoil15, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

135. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MN062704 (Gordonia phage JuJu, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

136. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MN062704 (Gordonia phage JuJu, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

137. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MT657330 (Mycobacterium phage Webster2, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

138. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MF919517 (Mycobacterium phage LilHazelnut, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

139. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to EU203571 (Mycobacterium phage Giles, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

140. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK494095 (Mycobacterium phage Daegal, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

141. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MT818421 (Mycobacterium phage Luke, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

142. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MK937606 (Microbacterium phage Margaery, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

143. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MH697577 (Mycobacterium phage Amochick, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

144. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MT684594 (Mycobacterium phage Hadrien, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

145. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to MT114159 (Mycobacterium phage Ein37, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

146. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to GU169904 (Staphylococcus phage SA1, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

147. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to KT246485 (Mycobacterium phage OBUpride, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

148. spacer 1.2|1602627|19|NZ_CP009793|CRISPRCasFinder matches to KT454972 (Mycobacterium phage Evanesce, complete genome) position: , mismatch: 0, identity: 1.0

gccgacgccgacgccgacg	CRISPR spacer
gccgacgccgacgccgacg	Protospacer
*******************

149. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

150. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

151. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

152. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

153. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

154. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

155. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

156. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

157. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

158. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

159. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to MN693281 (Marine virus AFVG_25M371, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

160. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

161. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

162. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

163. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

164. spacer 1.3|1602669|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

165. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP018759 (Pseudomonas psychrotolerans strain PRS08-11306 plasmid pPRS08-11306, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

166. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP018759 (Pseudomonas psychrotolerans strain PRS08-11306 plasmid pPRS08-11306, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

167. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

168. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

169. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP052758 (Cellulosimicrobium sp. BI34T plasmid pCPRO01, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

170. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP024775 (Bacillus thuringiensis LM1212 plasmid pLM4, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

171. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

172. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

173. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

174. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

175. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

176. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

177. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

178. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

179. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

180. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

181. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

182. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

183. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_MF398271 (Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

184. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP032156 (Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

185. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MK878901 (Gordonia phage HannahD, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

186. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

187. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

188. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

189. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

190. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

191. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

192. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

193. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT843275 (Serratia phage vB_SspM_BZS1, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

194. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MH479915 (Gordonia phage GEazy, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

195. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

196. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

197. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

198. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

199. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

200. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

201. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

202. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

203. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

204. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

205. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

206. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

207. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

208. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

209. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

210. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

211. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_005916 (Mycobacterium ulcerans Agy99 plasmid pMUM001, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

212. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

213. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

214. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

215. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

216. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

217. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

218. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

219. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

220. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

221. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

222. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

223. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

224. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

225. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

226. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

227. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

228. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

229. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP053710 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

230. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_011991 (Agrobacterium vitis S4 plasmid pAtS4b, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

231. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_011991 (Agrobacterium vitis S4 plasmid pAtS4b, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

232. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_011991 (Agrobacterium vitis S4 plasmid pAtS4b, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

233. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NC_011991 (Agrobacterium vitis S4 plasmid pAtS4b, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

234. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP007257 (Rhodococcus erythropolis R138 plasmid pLRE138, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

235. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

236. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

237. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

238. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

239. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

240. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

241. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

242. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

243. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

244. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

245. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

246. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

247. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

248. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

249. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

250. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

251. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

252. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

253. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP041077 (Bacillus tropicus strain LM1212-W3 plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

254. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_MF600313 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

255. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_MF600313 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

256. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

257. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to KT820175 (Ruegeria phage 45A6, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

258. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to KT820175 (Ruegeria phage 45A6, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

259. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to KT820175 (Ruegeria phage 45A6, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

260. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MH513970 (Mycobacterium phage Hangman, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

261. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT936332 (Streptomyces phage phiRKBJ001, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

262. spacer 1.4|1602711|19|NZ_CP009793|CRISPRCasFinder matches to MT936332 (Streptomyces phage phiRKBJ001, complete genome) position: , mismatch: 0, identity: 1.0

accgacaccgacaccgaca	CRISPR spacer
accgacaccgacaccgaca	Protospacer
*******************

263. spacer 2.2|1604158|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

accgactccgactccgact	CRISPR spacer
accgactccgactccgact	Protospacer
*******************

264. spacer 2.2|1604158|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

accgactccgactccgact	CRISPR spacer
accgactccgactccgact	Protospacer
*******************

265. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

266. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

267. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

268. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

269. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

270. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

271. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

272. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

273. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

274. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

275. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to MN693281 (Marine virus AFVG_25M371, complete genome) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

276. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

277. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

278. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

279. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

280. spacer 2.3|1604200|19|NZ_CP009793|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tccgactccgactccgact	CRISPR spacer
tccgactccgactccgact	Protospacer
*******************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009794

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009795

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

3. NZ_CP009793

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection