CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011309	[Brevibacterium] flavum strain ATCC 15168, complete genome	4 crisprs	csa3,cas3,cas9,DEDDh,WYL,PrimPol,DinG	0	3	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011309_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011309_1

357521-357616

Orphan

Consensus_repeat	Method
TGCGTGGGCAGTGTGGTTTGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011309_1

>merge|NZ_CP011309|1|357521-357616|CRISPRCasFinder
TGCGTGGGCAGTGTGGTTTGGTTTTGGGGGCTCGGAACCGGTCACAGATGCCCACGATTGCGGTTTTTCCGTTGCGTGGGCAGTGTGGTTTGGTCT

>NZ_CP011309|1|1|357521-357616|CRISPRCasFinder
TGCGTGGGCAGTGTGGTTTGGTTT	TGGGGGCTCGGAACCGGTCACAGATGCCCACGATTGCGGTTTTTCCGT
TGCGTGGGCAGTGTGGTTTGGTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011309.1\|WP_003863298.1\|356272_357469_+\|MarP-family-serine-protease	unknown	unknown	gnl\|CDD\|367140
NZ_CP011309.1\|WP_003863288.1\|363189_363966_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP011309.1\|WP_003863293.1\|359690_360533_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP011309.1\|WP_003863300.1\|355438_356182_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP011309.1\|WP_003863310.1\|350210_351407_+\|glutaryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
NZ_CP011309.1\|WP_003863295.1\|357964_358960_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP011309.1\|WP_003863311.1\|349273_350218_+\|4-hydroxyphenyl-beta-ketoacyl-CoA-hydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP011309.1\|WP_003863285.1\|364765_365086_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863303.1\|354095_354878_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
NZ_CP011309.1\|WP_003863307.1\|351998_352844_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP011309.1\|WP_003863306.1\|353864_354050_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863292.1\|361013_362075_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274798
NZ_CP011309.1\|WP_003855817.1\|358974_359526_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
NZ_CP011309.1\|WP_003855810.1\|352919_353603_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP011309.1\|WP_003855829.1\|365108_365408_+\|flp-pilus-assembly-TadE/G-like-family-protein	unknown	unknown	gnl\|CDD\|274799
NZ_CP011309.1\|WP_003863309.1\|351428_351902_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NZ_CP011309.1\|WP_003863289.1\|362071_363205_+\|TadA-family-conjugal-transfer-associated-ATPase	unknown	unknown	gnl\|CDD\|200328
NZ_CP011309.1\|WP_003855827.1\|364561_364762_+\|DUF4244-domain-containing-protein	unknown	unknown	gnl\|CDD\|379429
NZ_CP011309.1\|WP_003863286.1\|363962_364538_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP011309.1\|WP_003863302.1\|354885_355446_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264

Protein	Function_ID	Function_description	E-value
NZ_CP011309.1\|WP_003863298.1\|356272_357469_+\|MarP-family-serine-protease	gnl\|CDD\|367140	pfam02674, Colicin_V, Colicin V production protein. Colicin V production protein is required in E. Coli for colicin V production from plasmid pColV-K30. This protein is coded for in the purF operon.	2.02474e-18
NZ_CP011309.1\|WP_003863288.1\|363189_363966_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	1.94792e-64
NZ_CP011309.1\|WP_003863293.1\|359690_360533_-\|HAD-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.05942e-74
NZ_CP011309.1\|WP_003863300.1\|355438_356182_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	7.37024e-53
NZ_CP011309.1\|WP_003863310.1\|350210_351407_+\|glutaryl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	5.95888e-108
NZ_CP011309.1\|WP_003863295.1\|357964_358960_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.10411e-22
NZ_CP011309.1\|WP_003863311.1\|349273_350218_+\|4-hydroxyphenyl-beta-ketoacyl-CoA-hydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	1.29818e-86
NZ_CP011309.1\|WP_003863303.1\|354095_354878_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	8.05558e-106
NZ_CP011309.1\|WP_003863307.1\|351998_352844_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.93171e-64
NZ_CP011309.1\|WP_003855829.1\|365108_365408_+\|flp-pilus-assembly-TadE/G-like-family-protein	gnl\|CDD\|274799	TIGR03816, tadE_like_DECH, helicase/secretion neighborhood TadE-like protein. Members of this small, highly hydrophobic protein family occur in a pilus/secretion-like region that usually is next to an uncharacterized DEAH-box helicase, in Actinobacteria. Members show sequence similarity to the TadE-like family described by pfam07811. The function is unknown. [Unknown function, General].	9.82352e-08
NZ_CP011309.1\|WP_003863292.1\|361013_362075_+\|hypothetical-protein	gnl\|CDD\|274798	TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein. Members of this protein family belong to the MinD/ParA family of P-loop NTPases, and in particular show homology to the CpaE family of pilus assembly proteins (see ). Nearly all members are found, not only in a gene context consistent with pilus biogenesis or a pilus-like secretion apparatus, but also near a DEAD/DEAH-box helicase, suggesting an involvement in DNA transfer activity. The model describes a clade restricted to the Actinobacteria.	8.10917e-91
NZ_CP011309.1\|WP_003855817.1\|358974_359526_-\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	1.12452e-31
NZ_CP011309.1\|WP_003855810.1\|352919_353603_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.34158e-55
NZ_CP011309.1\|WP_003863309.1\|351428_351902_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	1.47997e-80
NZ_CP011309.1\|WP_003863289.1\|362071_363205_+\|TadA-family-conjugal-transfer-associated-ATPase	gnl\|CDD\|200328	TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.	1.36342e-154
NZ_CP011309.1\|WP_003855827.1\|364561_364762_+\|DUF4244-domain-containing-protein	gnl\|CDD\|379429	pfam14029, DUF4244, Protein of unknown function (DUF4244). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 66 and 95 amino acids in length. There is a conserved EYA sequence motif.	1.21917e-15
NZ_CP011309.1\|WP_003863286.1\|363962_364538_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	5.22011e-14
NZ_CP011309.1\|WP_003863302.1\|354885_355446_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	3.43582e-22

>NZ_CP011309.1|WP_003863298.1|356272_357469_+|MarP-family-serine-protease
MLSPSLVVDAVIVLVMAFALWGGWRQGAFTSLLSTVGVVSGLVVGAAAAPFVMGLTDSTALRFLLAIGTVVLLVGLGNLIGAHLGAAIRDNIKFRSSRTLDSGLGAIFQVLATLIVVWLVAIPLATGLPGTVASGIRDSRILGFVDKYTPQGLDTLPSKIAAMLSESGLPPLISPFTGGSSVEVDAPEINVTNVDLVEAMRPSVIHVMGDAQECSRRLMGSGFVASPDYVVTNAHVVAGTSTVSLDTMIGTRSAEVVFYDPNLDIAVLYSPDLGLDPLPWASTPLDTGDEAIVMGFPQSGPFNASPARVRERIMITGSNIYANGQHEREAYSVRGSIQSGNSGGPMANEMGEVVGVVFGAAIDGSDTGYVLTAEEVQERIGDITALTQPVDTMQCAVS
>NZ_CP011309.1|WP_003863300.1|355438_356182_+|CoA-pyrophosphatase
MRNYPDLPHDFPGQNTELTPAKAPVWMHRLLDRIHTGRMVNPLDGAETLGDTDSEKRAAVLMLFSGSETSFDLPNDASVLLTHRTPTMRSHAGQIAFPGGRIDPTDTNAVDCAFREAWEETGLDRRTATPLAQLNEVHIRATGYPVYPILGHWHTPSPVAVASPHETDEVFDAPLYDLIDPKNRLMVGWREWHGPAFRINDYIIWGFTGGLLSAILDTAGWATEWDTDRIFDLENTLSTSRNNERMR
>NZ_CP011309.1|WP_003863302.1|354885_355446_+|TlpA-family-protein-disulfide-reductase
MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKITTRPDCVASGAAGVDLPCLGGANGVGNELATVVNLWAWWCEPCRAELPIFDEFATTHPELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGTLGLPGVVPITVVVSPEGEVVGTFPQPFETIDDLETAVAGALQNA
>NZ_CP011309.1|WP_003863303.1|354095_354878_+|endonuclease-III
MGSITPQKRPRVGSHIANKGQETDIGRKRRARRINRTLTVAYPDAHCELDFTNPLELTVATILSAQCTDVRVNQVTPALFKRYPTAADYANADRTEVEEFIRPTGFYRNKATSLIGLGEALISLHDGQVPGTLEKLVELPGVGRKTANVVLGNAFGVPGITVDTHFGRLVRRLKLTDEEDPVKVEKVMNELIEKPEWTMFSHRLIFHGRRICHSRRAACGACMLAADCPSFGLEGPSDPFEAQKLIKSDDREHLLKMAGM
>NZ_CP011309.1|WP_003863306.1|353864_354050_-|hypothetical-protein
MTGLLVVIIPLLLMLFAFAMERIESSFLHSNAPQNTEVKLAKDAVGAENLNEDDVQEASAA
>NZ_CP011309.1|WP_003855810.1|352919_353603_-|Crp/Fnr-family-transcriptional-regulator
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
>NZ_CP011309.1|WP_003863307.1|351998_352844_+|MBL-fold-metallo-hydrolase
MTKLERMEHPAYSQLRPVTPSASVVLCPNPGYSSLEGTNSWVIRAPEDPRSIVIDPGPEDEGHLNVLHSKAEEVGLILLTHRHYDHADGAQRFRQLTNAPVRAMDPSYCAGAEEIHDGEIITIDGVTPQIEVVATPGHTRDSVSYFIWSGVPHESTLEGIVSGDTIAGRHTTMISETDGDLGEYLNSLAILEERGKDIPLLPGHGPDGQDVASFARKYIERRELRLNQIREVWETRGRDVSMKDLIDAIYDDVDPVLRGAAEQSTHVAIRYLQAQEASASN
>NZ_CP011309.1|WP_003863309.1|351428_351902_+|MaoC-family-dehydratase
MTTSTTPNTIVSFEDAPTLTGQDLGFSQWRTVTQEMVNTFADATDDQQWIHTDPERAKDGPFGGAIAHGFLTLSMIIPFWGELLDVTGVTTKVNYGLDKVRFTSPVKVGSRIRMGAVVREISEVKGNGLHLVADGTIEIEGQERPAVVATFLTRFYA
>NZ_CP011309.1|WP_003863310.1|350210_351407_+|glutaryl-CoA-dehydrogenase
MRDPIQGAVIPSDLFGFAEVLTEAERAVLLETRRVLEEEVKPYINEAWDKAVFPDEIVQPLQDLQLLDPPALREAGESVRDIFTGFRNFELARCDINVGTYYNASAGLFRTACMVGGSPEQAQRLDAQIKSGEVKGVFALTEPDHGSDIAGGLATTATKDADTGEWIINGEKRWIGGASTADLIATFARDTADNQVKCFLVAPKAEGVSMEIIDRKASLRIMQNAHITYNNVRVSEDARLHNINSFKDVSECLRRMRSDVAWMAVGAQAGAYEAAVKYVRSREQFGRPIAGFQLIQEKLALMLGNLTASLGMMVKLTEQQQAGIFKEENSALAKMFTSLKLRETTSWAREICGGNGIILDNDVARFHADAEAVYSYEGTHEINALIVGRAITGVSAFI
>NZ_CP011309.1|WP_003863311.1|349273_350218_+|4-hydroxyphenyl-beta-ketoacyl-CoA-hydrolase
MSNNVVKYECAVDADNIVAVDMHVHLEVDSCGHESMPADIMEASSKYFKAAERTPSADAIADIYREHKMAAVVFTIDARTQMGHLPNSIDDLVASCARNNDVLIPFGSVDPRTGEDALVEARRQVEELGVRGFKFHPSVQGFDPSAPEFYPLWELLESFGLPCVFHTGQNGMGAGLPGGRGIKLRFSNPMLLDDVAADFPNLTIIMAHPSVPWQDEANSIATHKANVFIDLSGWSPKYFPESLVRQSNNVLSKKVLFGTDFPLITPEKWLAAFANLPLKDEVRPGILKDNAVKVLGLAASTERGYQAEKAVQHA
>NZ_CP011309.1|WP_003863295.1|357964_358960_-|alpha/beta-hydrolase
MAFFSFSTSPLTRLIPGSRSKATGAKRRLSSTIASIERSPGIIALDGPFTHDHVSVRGIRLHLAEAGSPTNPLVLLIHGAFGGWYDYREVIGPLADAGFHVAAIDLRGYGMSDKPPTGYDLRHAAGELSSVIAALGHDDALLVGSDTGASIAWAIASMYPERVRGLISLGAIHPLDMRRAIRRKPHLHVSDLSRLAPFRLPSFLHNLFHFGITSEARREIVNNTSSSYQRSNAFTETVLLRKKALSIDHTITPIIRTNRYLVGSIPSKTVSAPVWLLRTNTRRWEHLANTARTRTTGPFTTIAIPGGYELPYLENPSEFAATIAEFARTTF
>NZ_CP011309.1|WP_003855817.1|358974_359526_-|phage-holin-family-protein
MSNKDGLFTDGSSTFAPKVDSIPLSDVDTSVSGEASIGTLISNATSQMSSLFRAEVELAKTELAGEAKKAAIGGGAFSVAGVIALYSSFFFFFFVAALLSEWIKPWAAFLIVFLFMLVIAAALALFGWRKVKKMGAPKNTIQSVNQLKNLVPGQASEKLEKANKRGLYTSASFHSPGAITGDH
>NZ_CP011309.1|WP_003863293.1|359690_360533_-|HAD-family-hydrolase
MKHPDPAQKVEGTTATTPTKVAAFFDLDKTIIAMSSTYAYGREFMNSGLISPVEALQLSLAQATYMFAGHTSEQMDNTRDQLTAMIRGWEVQQVRSIAEETMHSVVTPTIYAEARELIEHHQELGHDVIIISASVKELVEPIARELGVHKTVTTVLEAHDGMYTGEVLFYCKGDAKAQSILDLAEANNYDLSLSFAYSDSFTDLPMLEAVGNPAAVNPDRALKKIALEQGWKILSFKNPEPLFQMPSTRDVGIGTGVVAGIAAVAAGSIWWMKRARRGSA
>NZ_CP011309.1|WP_003863292.1|361013_362075_+|hypothetical-protein
MNTTTHQAILIAVEDPVLHPEAMHVAAATGRPVIETTNLMDISRHFHRASAVLIDTSMASQLSPGKRRDRVFLLDSDPGPSDWKTAMKIHAEQAILLPAQAGELLSALGRDDNKLPVASGHVIGVAGVVGGTGASTFAAALAKRRAESATTVLIDADPSSGGIDLLLGIEDVPGARWPDVGLRRGTVQAADVLKALPSTPDEVVVLSTARANILDPFALSESDVSAAIDCFLSADRSVDVVVDLPHARVHPDIAERLSHLVLVIPAEVRAVAAARARYMELQQLHVSITCVLRHRGWSGLDVAEVEEILGADITAEIGSIQRLAKSVEMHGLTGSLPRVLSSACDAVLGEVAA
>NZ_CP011309.1|WP_003863289.1|362071_363205_+|TadA-family-conjugal-transfer-associated-ATPase
MTDIDLVVENVQRIIATKETPPTSAEIASLIREQAGVISNEDIVMVLRRLRSDSVGVGPLESLLALPGVTDVLVNAHDSVWIDRGQGVEKVDMDLGSEEAVRRLATRLALTCGRRLDDAQPFADGRITRDDGSVLRIHAVLAPLAESGTCISVRVLRQARLSLDDLINSGTVPEDIAPALRNIINQRRSFLVVGGTGTGKTTLLSAMLTEVPADQRIICIEDTAELHPGHPSIINLVSRQANVEGAGAVSMADLLKQSLRMRPDRIVVGEIRGAEVVDLLAAMNTGHDGGAGTIHANSISEVPARMEALAATGGLDRMALHSQLAAAVDIVLVMKHTPFGRRLAQLGVLRGNPVTTQVVWDLDHGMHEGSEEAWFMS
>NZ_CP011309.1|WP_003863288.1|363189_363966_+|type-II-secretion-system-F-family-protein
MVYVLGLLSAAVLISGSRGPGARTRPPTPGNGVHLFALIALFCLATVLFIVVDAYTMIAGIIIATTLFWYLRQTHAAAQRTKQSLQLASFLSLCAGNLRAGVTMVDAMDYALDNTTPDKLLSPTLQTAARQARSGGSGPRVLIDASLPDLQRLGHLWETSERHGIPLVALIDQMRSRISSKQRHGESTRAALQGPQATAVILTVLPLAGLLMGTAMGANPVGLLTGGGIGGLLLVIGVGLDAAGFVVTHKILQSASPS
>NZ_CP011309.1|WP_003863286.1|363962_364538_+|type-II-secretion-system-F-family-protein
MITALVIAAVAMFIGSPNPGVRGGLISPKSGKSLRIRAGPKKLGNADPVDVSADIELFSACLDAGLNTRDAAQVVAHVAAITHRELWTHVVALLSIGVSAPQAFALMAGVDGLDELANLATVSHRSGSALSDGCRNISTSLLASAGDKRTAAAERAGVFIAMPLALCFLPAFMIVGLAPVVLSLGTQLINF
>NZ_CP011309.1|WP_003855827.1|364561_364762_+|DUF4244-domain-containing-protein
MSNNLELLRLRTRAILAQDDGLTTVEYALGTLAAAALAAVLYMVVNSDAVSSAFESIISDALSARP
>NZ_CP011309.1|WP_003863285.1|364765_365086_+|hypothetical-protein
MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLAAYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVFPVEN
>NZ_CP011309.1|WP_003855829.1|365108_365408_+|flp-pilus-assembly-TadE/G-like-family-protein
MTIASAGVASILISLLVVLAWQAGNLVAREQAQVAADVSAVAGAYAFARGELPDAACATAKHTAEANNAQLENCATEGEDLTLTVTVRGQEAHAKAGPL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011309_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011309_2

900562-900714

Orphan

Consensus_repeat	Method
AGAAGAGTGTCACCCACGGGCGCAAGGCACGTAT	PILER-CR
GTGTCACCCACGGGCGCAAGGCACGTAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP011309_2

>merge|NZ_CP011309|2|900562-900714|PILER-CR,CRISPRCasFinder
AGTGTGTCACCCACGGGCGCAAGGCACGTATACTATTTAAAAGTTTTAAATAGCGACAAGAAAAGTGTCACCCACGGGCGCAAGGCACGTATCTGTGGGCAAAATGCGGACGGTTGCCCAGGAGCGTGTCACCCACGGGCGCAAGGCACGTAT

>NZ_CP011309|2|1|900562-900714|PILER-CR
AGTGTGTCACCCACGGGCGCAAGGCACGTATACT	ATTTAAAAGTTTTAAATAGCGACAAGA
AAAGTGTCACCCACGGGCGCAAGGCACGTATCTG	TGGGCAAAATGCGGACGGTTGCCCAGG
AGCGTGTCACCCACGGGCGCAAGGCACGTAT

>NZ_CP011309|2|2|900565-900714|CRISPRCasFinder
GTGTCACCCACGGGCGCAAGGCACGTAT	ACTATTTAAAAGTTTTAAATAGCGACAAGAAAA
GTGTCACCCACGGGCGCAAGGCACGTAT	CTGTGGGCAAAATGCGGACGGTTGCCCAGGAGC
GTGTCACCCACGGGCGCAAGGCACGTAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011309.1\|WP_003863497.1\|899032_899251_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863486.1\|905017_905938_-\|iron-siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238566
NZ_CP011309.1\|WP_003863492.1\|903249_903414_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003858084.1\|892765_893260_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|376590
NZ_CP011309.1\|WP_003863496.1\|902064_902277_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863500.1\|896053_896446_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863504.1\|893260_893614_+\|DUF488-domain-containing-protein	unknown	unknown	gnl\|CDD\|225730
NZ_CP011309.1\|WP_003863503.1\|894243_895539_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP011309.1\|WP_003863493.1\|902922_903246_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863498.1\|897317_898736_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379041
NZ_CP011309.1\|WP_003858089.1\|891123_891813_+\|cell-division-ATP-binding-protein-FtsE	unknown	unknown	gnl\|CDD\|225438
NZ_CP011309.1\|WP_003863499.1\|896438_897317_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240129
NZ_CP011309.1\|WP_003863501.1\|895841_896051_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP011309.1\|WP_003858086.1\|891826_892729_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|225088
NZ_CP011309.1\|WP_155268198.1\|902273_902642_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003863480.1\|908311_909313_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226965
NZ_CP011309.1\|WP_003863482.1\|907044_908061_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226966
NZ_CP011309.1\|WP_003863478.1\|909305_910421_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226964
NZ_CP011309.1\|WP_003863489.1\|904190_905018_-\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|225250
NZ_CP011309.1\|WP_003858024.1\|906103_906694_-\|vitamin-K-epoxide-reductase-family-protein	unknown	unknown	gnl\|CDD\|240605

Protein	Function_ID	Function_description	E-value
NZ_CP011309.1\|WP_003863486.1\|905017_905938_-\|iron-siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	2.2942e-68
NZ_CP011309.1\|WP_003863489.1\|904190_905018_-\|siderophore-interacting-protein	gnl\|CDD\|225250	COG2375, ViuB, Siderophore-interacting protein [Inorganic ion transport and metabolism].	7.80736e-87
NZ_CP011309.1\|WP_003858084.1\|892765_893260_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	9.95536e-83
NZ_CP011309.1\|WP_003863504.1\|893260_893614_+\|DUF488-domain-containing-protein	gnl\|CDD\|225730	COG3189, COG3189, Uncharacterized conserved protein [Function unknown].	9.52447e-57
NZ_CP011309.1\|WP_003863503.1\|894243_895539_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.30277e-15
NZ_CP011309.1\|WP_003863498.1\|897317_898736_+\|hypothetical-protein	gnl\|CDD\|379041	pfam13148, DUF3987, Protein of unknown function (DUF3987). A family of uncharacterized proteins found by clustering human gut metagenomic sequences.	0.0033613
NZ_CP011309.1\|WP_003858089.1\|891123_891813_+\|cell-division-ATP-binding-protein-FtsE	gnl\|CDD\|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	4.3761e-130
NZ_CP011309.1\|WP_003863499.1\|896438_897317_+\|hypothetical-protein	gnl\|CDD\|240129	cd04859, Prim_Pol, Prim_Pol: Primase-polymerase (primpol) domain of the type found in bifunctional replicases from archaeal plasmids, including ORF904 protein of the crenarchaeal plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol). These primpol domains belong to the archaeal/eukaryal primase (AEP) superfamily. This group includes archaeal plasmids and bacteriophage AEPs. The ORF904 protein is a multifunctional protein having ATPase, primase and DNA polymerase activity, and may play a role in the replication of the archaeal plasmid. The pRN1 primpol domain exhibits DNA polymerase and primase activities; a cluster of active site residues (three acidic residues, and a histidine) is required for both these activities. For pRN1 primpol, the primase activity prefers dNTPs to rNTPs; incorporation of dNTPs requires rNTP as cofactor. The pRN1 primpol contains an unusual zinc-binding stem, which is not conserved in other members of this group.	4.66606e-39
NZ_CP011309.1\|WP_003863501.1\|895841_896051_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	5.88454e-06
NZ_CP011309.1\|WP_003858086.1\|891826_892729_+\|ABC-transporter-permease	gnl\|CDD\|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	2.46303e-77
NZ_CP011309.1\|WP_003863480.1\|908311_909313_+\|ABC-transporter-permease	gnl\|CDD\|226965	COG4606, CeuB, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	2.65465e-139
NZ_CP011309.1\|WP_003863482.1\|907044_908061_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226966	COG4607, CeuA, ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism].	5.22155e-110
NZ_CP011309.1\|WP_003863478.1\|909305_910421_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226964	COG4605, CeuC, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	6.99928e-137
NZ_CP011309.1\|WP_003858024.1\|906103_906694_-\|vitamin-K-epoxide-reductase-family-protein	gnl\|CDD\|240605	cd12922, VKOR_5, Vitamin K epoxide reductase family in bacteria. This family includes vitamin K epoxide reductase (VKOR) mostly present in actinobacteria. VKOR (also named VKORC1) is an integral membrane protein that catalyzes the reduction of vitamin K 2,3-epoxide and vitamin K to vitamin K hydroquinone, an essential co-factor subsequently used in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes. All homologs of VKOR contain an active site CXXC motif, which is switched between reduced and disulfide-bonded states during the reaction cycle. In some bacterial homologs, the VKOR domain is fused with domains of the thioredoxin family of oxidoreductases which may function as redox partners in initiating the reduction cascade.	1.06919e-56

>NZ_CP011309.1|WP_003863497.1|899032_899251_+|hypothetical-protein
MNDNNGMDFYTTSPDYNTTPLERLTAYLTADLQRHYPQEEFHAYRLAQSLAHVLAEHATTINLSDYPARHVV
>NZ_CP011309.1|WP_003863498.1|897317_898736_+|hypothetical-protein
MAMFDEVKLAPAPVEGVAYVERAEVKEQAPTTLESALTVKEWEQLEQDVFSGAGAAVTAIRDYARENSLAPIPFLIASALYVSTCLPGNATFNAGVGRGSPNLFIAVVAKPGGGKDLLMTAVSKALSVSTVEVQRKPKHLPLGSGEGIYTTLRPEKEQTVSDPVLFGMSEVNQLGALMGRTGSTLRGAIVNMYSGNALGATNKSETIYVEANSYTAGLWVGVQPDSAGVLLNGGDDGLKHRFVWTETVNPSMDVSDECIDNLVSAYTGKLDSHMQAASCLPVVIPQQLLGGKGFTFHEDIVRATILARRLRVKTGQIGEFAGHRNQTRLKLACGLALLSSRAHVSLDDWGRAGALMDYSDKVQSYCQRHLTDRRVDEQVDRLDVQEQAKDTLESKRQGRMEGKIIDSLKDSKRAQWRGRGGFLQGVKSNVRGAANSALMALIHRDIVAPIYVADEKGESVLDSLERGDKYPR
>NZ_CP011309.1|WP_003863499.1|896438_897317_+|hypothetical-protein
MSKAPTTHMGAVSQQEVHPNNNPCSPNSAPQEVWRTWAGEIETIPQHQWLHVAANRYARHGLKVGILNGKIPMTPHGFKDFTTNLEQINAWWGTYPGANIGATPPKGVVVIDIDPRNGGHETWEALTRYRELPETLLVRTGSGGHHFWYRLPHEGAIRGELGKGIDLKTHTGYLVMPPSIHPTTGERYTISWWADIAVLPTWLNEYVYKPTPRPTQSMQARREGNNTGGGLVETVERAPEGQRNSTLYWAACRNAEEGLGLDEELVAAALVCGLSEREARQAIASAQRKDVA
>NZ_CP011309.1|WP_003863500.1|896053_896446_+|hypothetical-protein
MGTKYTPQDALTYTREQLRNTLDWVHEHLAESYGLEMIDGEEYLPDPLNDVMSALYGIAGELTTMCAEVGAYHYQDGELMRPVYYSNGNCVYVERAIGSPGDWYLTTELDKPNGDPRRGMHVVKGGGSNE
>NZ_CP011309.1|WP_003863501.1|895841_896051_+|helix-turn-helix-domain-containing-protein
MNKTANRSKWLTVANAALHMDCSTKTIRRLIATGDLQATYLTPRAMRVSVESLDALIKANSTNQWGGAA
>NZ_CP011309.1|WP_003863503.1|894243_895539_+|tyrosine-type-recombinase/integrase
MARKRKPALKRRFGSIRQKGARFTVAFTAPDGKRHSPGKSFATAKQAELWLAKEEALIEQHNLGYVVWVPPQQRNAQDIQSSVTVAQWLDTFHENLEHRPKPPRPSTMQNYRRVTSNRITDPLAPGDKEADVTRLADIQLVKLTKNDVYRWWDGLQRAYPTAHTINQQAYKRLKAACDEATRREMIPFNPVEIREAGKKVTPKEKYLPSDEELNAIYAHVPEQYRVLTSLMLFHGLRIGEAIALEQRHVHVEEQPGESVPRVVVQVEQNAQRVRDDDGKIYMMVQPPKTEAGYRDVPIMPQHVPDFLRHLKEFAPTTTTTVETLDRPREVKLLTATRNGKMVMDTSYREVLVRAETRAGVTTEIDPHCGRNWLITRLAEQGAHLKEIGQLLGQDDVQTILNVYMKVRAGRTTSLMDKVNSSLAPGAPGNVQ
>NZ_CP011309.1|WP_003863504.1|893260_893614_+|DUF488-domain-containing-protein
MSIHIAKVHDVLKGEKTYGTTILVDRLWPRGVKKDDLEPDLWLKGVAPTTELRKWFGHDPAKFSEFSTRYTEELNASNDKDLETLVDATSRHPVTLLYGAADRDHNHAIVLAKWLKK
>NZ_CP011309.1|WP_003858084.1|892765_893260_+|SsrA-binding-protein-SmpB
MAKKKKKVDENNSVLATNRKARHDYHIIDTWEAGVVLLGTEIKSLREGKVSLVDSFATIDNGEIWLQHLHIPQYSMGSWTNHTPKRTRKLLLHRNEIDSLMGKVRDGNRTLVPLKLYLKNGRVKLELGLAQGKQDYDKRQDIKRRTEEREVTRELGRRIKGINA
>NZ_CP011309.1|WP_003858086.1|891826_892729_+|ABC-transporter-permease
MAFGYVLREAVRGMGRNVTMTIALIITTSISLALLATGFLVTNMTDRTKDIYLDRVEVMIQLDEDTSANDPECTAESCTEVRDVLEGLDGIDSITYRSREASYERFVEVFKDTDPVLVAETSPDALPAAFHVRLEDPLAVEILDPVRDLPQVSNVIDQVDDLRGATENLDSIRNATFLIAAVQVLASIFLIANMVQIAAFNRREETEIMRIVGASRFYTQGPFVFEAILSTLIGAVFAVGALFLGKELVIDKALRGLYDSQLIAPVTTTDIWLVAPIISGIGVVIAGIIAQLTLRFYVRK
>NZ_CP011309.1|WP_003858089.1|891123_891813_+|cell-division-ATP-binding-protein-FtsE
MITFENVTKNYKTSTRPALDNVSLHIEKGEFVFLIGPSGSGKSTFLRLMTREENVSSGSLTLADFQVNKLRGTQVNKLRQRIGYVFQDFRLLKNKNVYDNVAFALEVIGKKKDKIQELVPETLEMVGLAGKANRMPNELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSDEIMILLNRINRLGTTVVMSTHNARTVDDMRRRVIELQLGKLVRDDAHGVYGEMR
>NZ_CP011309.1|WP_003863496.1|902064_902277_-|hypothetical-protein
MSKTIRCERCNRRYRNQGDWNVELKGGLPVFYLCPACQTPEENTQAVIHEATLNYHHTAGGLIYGTPKVD
>NZ_CP011309.1|WP_155268198.1|902273_902642_-|hypothetical-protein
MDPWNLIAHLWIPNDKRAGNFYVGTYCTGGNYRDLVDLKGFKLHGDLKGFIVGSNTGFTVGALNTRGHALTLNGDPLELCPACMTMALTQAEMQGQNKYPIKGLIAAMDQQPANTIVERENK
>NZ_CP011309.1|WP_003863493.1|902922_903246_-|hypothetical-protein
MSTLHAPAPYRLTPIGWIVANEHAPVDYVPTDLTDTLKVTDTITGKSFTCTPGSFMQAAEQLPTPWFNEWHNVRELQELLTTNPTDPRIEDLCWLLCVEIAPVEVNQ
>NZ_CP011309.1|WP_003863492.1|903249_903414_-|hypothetical-protein
MPNITPQPNPHPRGSREWIEHEDAYFRQWRESGEFDQFLHTIAAVARDEAKRGA
>NZ_CP011309.1|WP_003863489.1|904190_905018_-|siderophore-interacting-protein
MSTALPDQLKWEYSAFPVQISQKQRLSPGFMRITVTGDKLRFFGQWGLDQRIKLIIPSPAGNIPDFGILDEPTPPPTTWLPRAKSFPADQRPILRTYTPSAVRPELCEVDIDIYLHNPSGPVSRWAKNCSVDDELIITGPDVRAGETCYGITYHPTSAIDRLCLIGDCASAPAIANIVNQSKVPTTVFLHVDSLEDDVLIADSSTKLTFEDIDAYKAKVFQWASANAADPSVHFWIAGETSMVRFIRKELINSYRVDSSRITFLGYWKYGRRTVD
>NZ_CP011309.1|WP_003863486.1|905017_905938_-|iron-siderophore-ABC-transporter-substrate-binding-protein
MSSRRKLSSALIVLLAAALPLTACSSSSEEETSTSSATREFTDVHGTTEVPENPQRVVVLEPLELDTAIALGITPVGAAVANNVTGIPAYLGVDGIEPVGTVSEPNIEAIAALEPDLILGTDSRHAEIYDRLESIAPTVFMTTHVDPWKDNVVFIGDALGKKQESEDLIQGFNDKCEEIKSEHDVEGKTVNMIRPRDEQTMSLYGPTSFAGSSLECAGLTIPDQEWKDGLQADIAPENFMLATADYVFVTATDVTDENELPEVIRENREQFPSLTLVDTSYWVSGVGPLGGSKVLEDIDAFLDAQQ
>NZ_CP011309.1|WP_003858024.1|906103_906694_-|vitamin-K-epoxide-reductase-family-protein
MSTEIHNAPPKAPTWLGWVLMIGGIIGLILSVIIMAEKLAILEDPGHITSCDFNAVLACGDVMRSGQANAFGIPNPLIGIAGFAAVAIIGAGILAGGRFRGWFWFGAQAGLTFAMMFCHWLAYQSMSVIRALCPYCMGVWTVSIIMFVLVTAWNVKTFSGSDSTFVNALYKYKWVIAIVWLLLIAAAAVWSFRYMF
>NZ_CP011309.1|WP_003863482.1|907044_908061_+|ABC-transporter-substrate-binding-protein
MVKNRFKLVSIATVAALALVGCSSTDSTSSESSSAAESTAAASTLTIEDNHGTEEISLPIEGVAATDNRAFELLDRWGVELVAAPLQLVPFTVTGYTEEGGVANLGSHREPDLEALAAAQPSLIINGQRFAQYYDDIVALNPDATVVELDPRDGEPLDQELIRQAEILGEIFGEEEDAAKIVADFESALERAKTAYAAISDQTVMAVNVSGGNIGYIAPSVGRTYGPIFDLVGLTPALEVDNASSDHEGDDINVEAIAAANPDLILVMDRDGGTSTRNEADYVPAEQIVSDNEALANVKAVTDGYVYYAPADTYTNENIITYTEILNGMADMFEKAAQ
>NZ_CP011309.1|WP_003863480.1|908311_909313_+|ABC-transporter-permease
MATPASAPTSEPRLKRTRAKLFDWKLLIGIIFVAGLVVLSLLTGQYDIFGGDDGQLMFEAVRIPRTVSLILSGAAMAMCGLVMQLLTQNKFVEPSTTGTTEWAGLGLLFVIYFVPAATVLDRMLGAVVFSFIGTMVFFLFLRRVTLRSSLIVPIIGIMLGAVVSSISSFFALQFDMLQQLGTWFAGSFNTVFRGQYEVLWIVVIVVIAVFFFADRLTVAGLGEEIATNVGLNYNRMVLIGTGLIAIATGVVTVVVGSLPFLGLIVPNVVSMFRGDDLRSNLPWVCLTGIAIVTICDLISRTIIAPFEIPVSVILGIIGAVVFVIMIVRQRGRG
>NZ_CP011309.1|WP_003863478.1|909305_910421_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MDKDIENRTSDLSRWETMEESATVEGRTDVELASAPSKRRTSGAFQTARAKRRYWIIMAALLVTALAFTWGLIWYKNPMPVGHPAFALIAERRMESVFVMLIVAVCQGFATVAFQTVTNNRIITPSIMGFESLYTLIHTSTVFFFGATALLATRNLEMFVGQLVIMVLLTLVLYTWLLSGKRGDMHAMLLVGIIIGGGLGSISTFMQRILTPSEFDILSARLFGSVNNAETEYFPIAVPLVVVASVLLLLSSRRLNVVGLGKDAATNLGINHRRSSIYTLVLVSVLMAVSTALVGPMTFLGFLVATLAYQFADTYDHRYILPMSALIGFVVLSGAYFVMNHVFRAQGVVSIIIEMVGGTVFLIVILRKGRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011309_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011309_3

3131191-3131281

Orphan

Consensus_repeat	Method
CAGGCTGCCGCGTGCACCGGGGCCAACCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011309_3

>merge|NZ_CP011309|3|3131191-3131281|CRISPRCasFinder
CAGGCTGCCGCGTGCACCGGGGCCAACCCCGCCAGACATCTCCTCCGGAAAAATACGATGCCAGGCTGCCGCGTGCACCGGGGCCAACCCC

>NZ_CP011309|3|3|3131191-3131281|CRISPRCasFinder
CAGGCTGCCGCGTGCACCGGGGCCAACCCC	GCCAGACATCTCCTCCGGAAAAATACGATGC
CAGGCTGCCGCGTGCACCGGGGCCAACCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011309.1\|WP_144290627.1\|3145442_3145652_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003855053.1\|3139286_3140162_-\|PspA/IM30-family-protein	unknown	unknown	gnl\|CDD\|224755
NZ_CP011309.1\|WP_003862528.1\|3127041_3127305_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP011309.1\|WP_003862537.1\|3121925_3123260_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP011309.1\|WP_040073063.1\|3128825_3129815_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274646
NZ_CP011309.1\|WP_034983240.1\|3123966_3124791_-\|sortase	unknown	unknown	gnl\|CDD\|226287
NZ_CP011309.1\|WP_003862532.1\|3125022_3126291_+\|membrane-protein-insertase-YidC	unknown	unknown	gnl\|CDD\|178945
NZ_CP011309.1\|WP_003859107.1\|3143045_3143474_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380352
NZ_CP011309.1\|WP_034983244.1\|3126217_3126859_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP011309.1\|WP_074496061.1\|3137249_3137615_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224639
NZ_CP011309.1\|WP_003862062.1\|3146571_3146808_-\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|225328
NZ_CP011309.1\|WP_003862525.1\|3127783_3128689_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP011309.1\|WP_046552204.1\|3143531_3145406_-\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319774
NZ_CP011309.1\|WP_003859104.1\|3142074_3142989_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP011309.1\|WP_003862535.1\|3123258_3123810_+\|DUF2020-domain-containing-protein	unknown	unknown	gnl\|CDD\|370500
NZ_CP011309.1\|WP_003862519.1\|3129993_3130962_+\|23S-rRNA-pseudouridylate-synthase	unknown	unknown	gnl\|CDD\|211332
NZ_CP011309.1\|WP_003863732.1\|3137823_3139227_+\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|224349
NZ_CP011309.1\|WP_003858985.1\|3123813_3123966_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_074496066.1\|3141840_3142023_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003862060.1\|3146049_3146367_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP011309.1\|WP_003855053.1\|3139286_3140162_-\|PspA/IM30-family-protein	gnl\|CDD\|224755	COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms].	1.82375e-35
NZ_CP011309.1\|WP_003862528.1\|3127041_3127305_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	3.37221e-13
NZ_CP011309.1\|WP_003862537.1\|3121925_3123260_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	1.49246e-73
NZ_CP011309.1\|WP_040073063.1\|3128825_3129815_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274646	TIGR03558, oxido_grp_1, luciferase family oxidoreductase, group 1. The Pfam domain family pfam00296 is named for luciferase-like monooxygenases, but the family also contains several coenzyme F420-dependent enzymes. This protein family represents a well-resolved clade within family pfam00296 and shows no restriction to coenzyme F420-positive species, unlike some other clades within pfam00296. [Unknown function, Enzymes of unknown specificity].	2.8268e-149
NZ_CP011309.1\|WP_034983240.1\|3123966_3124791_-\|sortase	gnl\|CDD\|226287	COG3764, SrtA, Sortase (surface protein transpeptidase) [Cell envelope biogenesis, outer membrane].	2.31419e-66
NZ_CP011309.1\|WP_003862532.1\|3125022_3126291_+\|membrane-protein-insertase-YidC	gnl\|CDD\|178945	PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated.	0
NZ_CP011309.1\|WP_003859107.1\|3143045_3143474_-\|cupin-domain-containing-protein	gnl\|CDD\|380352	cd02223, cupin_Bh2720-like, Bacillus halodurans Bh2720 and related proteins, cupin domain. This family includes bacterial, archaeal, and eukaryotic proteins similar to Bh2720, a Bacillus halodurans protein of unknown function with a cupin beta-barrel fold.	1.75609e-48
NZ_CP011309.1\|WP_034983244.1\|3126217_3126859_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.42457e-12
NZ_CP011309.1\|WP_074496061.1\|3137249_3137615_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224639	COG1725, COG1725, Predicted transcriptional regulators [Transcription].	1.33243e-38
NZ_CP011309.1\|WP_003862525.1\|3127783_3128689_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.07909e-30
NZ_CP011309.1\|WP_046552204.1\|3143531_3145406_-\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP011309.1\|WP_003859104.1\|3142074_3142989_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	5.55306e-75
NZ_CP011309.1\|WP_003862535.1\|3123258_3123810_+\|DUF2020-domain-containing-protein	gnl\|CDD\|370500	pfam09449, DUF2020, Domain of unknown function (DUF2020). Protein of unknown function found in bacteria.	1.07008e-86
NZ_CP011309.1\|WP_003862519.1\|3129993_3130962_+\|23S-rRNA-pseudouridylate-synthase	gnl\|CDD\|211332	cd02558, PSRA_1, Pseudouridine synthase, a subgroup of the RluA family. This group is comprised of bacterial proteins assigned to the RluA family of pseudouridine synthases. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. The RluA family is comprised of proteins related to Escherichia coli RluA.	1.48932e-126
NZ_CP011309.1\|WP_003863732.1\|3137823_3139227_+\|NYN-domain-containing-protein	gnl\|CDD\|224349	COG1432, COG1432, Uncharacterized conserved protein [Function unknown].	3.72455e-26
NZ_CP011309.1\|WP_003862062.1\|3146571_3146808_-\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	7.50297e-16

>NZ_CP011309.1|WP_003862519.1|3129993_3130962_+|23S-rRNA-pseudouridylate-synthase
MKAPLPIRDGLNPSRVRLPLDAAPIRAIDFVEYLISTQRHRNPADNAEALQARFDANLVVNHYGEPYAPDTMVQPDDDIWFYRMPAAERPIPYKIHVIHEDDDILVIDKPPYLATMPRGRHITETALVKMRVLTGNNDLTPAHRLDRLTSGVLVMVKKPELRGAYQTLFARREASKTYEAIAEFVPGLLDDGPAIWESRIEKERGIVQAFVVEGPVNARTELVSVTPVDDAEQSILEEMHGPLPRQARYVLAPSTGKTHQLRIHMRDFAAPILGDPLYPILHAVDDEDYTTPMHLIARTLTFVDPQTNEERTFVSNRPTGSL
>NZ_CP011309.1|WP_040073063.1|3128825_3129815_-|LLM-class-flavin-dependent-oxidoreductase
MSSVVGEGPKPRLSVLDLVALSEGMTAGEAIAHSVRAAQIAEEHNYARFWVAEHHNSEGLASSATTLLMGHIAGHTSRIRVGSGGIMMPNHSALHVAEELGTLEAIYPGRIEAGLGRAPGTDPMTARELGRASSLVDDVLSTIVSLQNYLDPPEGRPSIIAHPGINSCVPLFMLGSSLNGAAMAAKLDLPFAFASHFAPFQMGPAIASYRERAANPYVMAAANVLVCDTEEEAEFQISTLHQMFAGIVTNSRGKLAPPVRNLKDKLDPMIWKHIEDSLEMTFIGTAESVVLQLQEFADRYKLDEIITVTYSYDPEVRFRSIAALGTAWN
>NZ_CP011309.1|WP_003862525.1|3127783_3128689_-|universal-stress-protein
MSTEDIVVVAVDGSDASKQAVRWAANTANKRGIPLRLASSYTMPQFLYAEGMVPPQELFDDLQAEALEKINEARDIAHEVAPEIKIGHTIAEGSPIDMLLEMSPDATMIVMGSRGLGGLSGMVMGSVSGAVVSHAKCPVVVVREDSAVNEDSKYGPVVVGVDGSEVSQQATEYAFAEAEARGAELVAVHTWMDMQVQASLAGLAAAQQQWDEVERQQTDMLIERLAPLVEKYPSVTVKKIITRDRPVRALAEASENAQLLVVGSHGRGGFKGMLLGSTSRALLQSAPCPMMVVRSPEKIKK
>NZ_CP011309.1|WP_003862528.1|3127041_3127305_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MLALGWITWIIIGGLAGWIASKIKGTDAQQGILLNIVVGIIGGLLGGWLLGVFGVDVAGGGLIFSFITCLIGAVILLTIVQFFTRKK
>NZ_CP011309.1|WP_034983244.1|3126217_3126859_-|TetR/AcrR-family-transcriptional-regulator
MAASASGKSKTSAGANRRRNRPSPRQRLLDSATNLFTTEGIRVIGIDRILREADVAKASLYSLFGSKDALVIAYLENLDQLWREAWRERTVGMKDPEDKIIAFFDQCIEEEPEKDFRGSHFQNAASEYPRPETDSEKGIVAAVLEHREWCHKTLTDLLTEKNGYPGSTQANQLLVFLDGGLAGSRLVHNISPLETARDLARQLLSAPPADYSI
>NZ_CP011309.1|WP_003862532.1|3125022_3126291_+|membrane-protein-insertase-YidC
MLDILIYPVSGVMKLWHLLLHNVAGLDDSLAWFFSLFGLVITIRAIIAPFTWQMYKSGRTAAHIRPHRAALREEYKGKYDEASIRELQKRQNDLNKEYGINPLAGCVPGLIQIPIVLGLYWALLRMARPEGGLENPVFQSIGFLTPEEVESFLAGRVSNVPLPAYVSMPTEQLEYLSTTQAEVLNFVLPLFITAAILTAINMAMSMYRSFQTNDYASGFSNGMLKFMIVMSILAPIFPLSLGLTGPFPTAIALYWVSNNLWTLLQTIIMMVILERKYPLTDDFKVHHLEQRDIYRAKQKEKRIFLWTRRKNRALMILTPWNASTLHATNVELTKTRTAEINEAKQARKEIANKRRETQREMNRAAMQRLKQRRAEVKAKKKGLIDASPNEDTPSENEETKLSSPQVEPTTTAEPNREPSQED
>NZ_CP011309.1|WP_034983240.1|3123966_3124791_-|sortase
MTATLSAESSRNGRKPRPRVSVSQVVGEILLTVGILALLFAYYEAYWTNVESGKLQESAGQKLDEDWNEARVNPRQKLTPELGEAFARMYVPAFGSDFNFAVIEGTDEEDLLAGPGRYVDSQMPGEAGNFAVAGHRVGKGAPFNDLGNLEVCDAIVVETYNSWDVYRVMPMSTNGADRAAEAADCFNETQVSRMAEGDYVNVSGRSITTPDRIDATYPTPGVFDTAVREGSEALLTLTTCHPQFSNAERMIVHAMLVEEIDKSSGERPAALEEN
>NZ_CP011309.1|WP_003858985.1|3123813_3123966_-|hypothetical-protein
MYSLLWHYLPGPWFVKLLIVLALIVLVFFLLMDVVFPWVSTLMPYNDVAF
>NZ_CP011309.1|WP_003862535.1|3123258_3123810_+|DUF2020-domain-containing-protein
MRRTLPTILAASIMLTACTPAEPEATPETTTEATPEVITDGLPIDAMPAVERTVQTACPYLNTDWVADTNGQRVTGYGTDERFSTPSCVFYSYPEEPQLTVIVRDMSTTDNAIAVVDWAAPIDSTEPAEEPAGWSGGRRGGNDTSGALYAVQNGPTAVIVFTNQDQSLKAQLIAEEVIQNLGL
>NZ_CP011309.1|WP_003862537.1|3121925_3123260_-|sensor-histidine-kinase
MQSSLDRVSETGRNELDVETLVKKGNQPGATSYRNSIHILTASLLVVGLGASARLTLPMFALSCVLLFVWGFLYFYGSTKRVDLRHGMQLGWLFVLTLVWIFMVPIVPVSIYLLFPLFFLYLQVMPDVRGIIAILGATAIAIASQYSVGLTFGGVMGPVVSAIVTVAIDYAFRTLWRVNNEKQELIDQLIETRSQLAVTERNAGIAAERQRIAHEIHDTVAQGLSSIQMLLHVSEQEILVAEMEEKPKEAIVKKMRLARQTASDNLSEARAMIAALQPAALSKTSLEAALHRVTEPLLGINFVISVDGDVRQLPMKTEATLLRIAQGAIGNVAKHSEAKNCHVTLTYEDTEVRLDVVDDGVGFEPSEVSSTPAGLGHIGLTALQQRAMELHGEVIVESAYGQGTAVSAALPVEPPEGFVGAPVLADSDSSATGEVELSSPTDDE
>NZ_CP011309.1|WP_074496061.1|3137249_3137615_-|GntR-family-transcriptional-regulator
MTAPLYKQIASLIEDSIVDGTLSVDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRGLYK
>NZ_CP011309.1|WP_003863732.1|3137823_3139227_+|NYN-domain-containing-protein
MLERTQVFVDTSYLLASFYNSWETGARAQLEIDLPEVVGVLGRMIEQQLKQPVQRQMWYDGIPDSGPHRYQRALRTCDGVQLRAGQLIEWGERRTQKAVDTRLVADLVLAGVRGQCSDIVLVSGDADMIPGVQEAANAGLRVHLYGFGWDSMSSQLRHCCDTTTILDPREDFAECMQLQVLEGPLPPVVRVKPINDAEPIEDLDFTPVPGVASPFEEVSAKDEKFSPHPGEPAEALSEQVCEAQNEISKHEGQTADSVEITESFEAAEIKVTEFFGEPAAPVAESGVEAPTVPEAAKPTPAKPKTPKAEPQKQESPKPGTPKPKAPSPADIPPKAPADTEEHSEVEAEIEDSRPKIPSPSMMAPRRKLRSRYVPLPNEVWATAGFQTPYDVGQQYASWWFENAATSTQRDQAHLLSGGGLPPEIDRPLLQFACETLHEYTLTEAQRVALRDGFHSGIRGVLLNQRDS
>NZ_CP011309.1|WP_003855053.1|3139286_3140162_-|PspA/IM30-family-protein
MANPLSKGWKYLMASFDNKIDENADPKIQIQQATEAAQKQHQQIMQHASQIIGQQKQLEMKLNRLVTDRDKLQEQARQAIQLADKSANEGDSVKAQEFNNTAEVFASQLVAVEQQLEQTTALHQQAEVAAKDAVAKSKESEMRLKEQMSQIDALRAQADQAKMQESVTKSMDSLNQFGTQDSSVPTLDAVREKIERRYADALGAQELTQNTVSDRMAEIAQSGTDMRASARLAELRAEALGTSATPKGQLEAGVEDAEELIDETSTPSATPETASPEADAPEASADESEKK
>NZ_CP011309.1|WP_074496066.1|3141840_3142023_+|hypothetical-protein
MTTGEDTHGCDYFTSIFLLPQLCNSTVLSLLARVKTGVFSPEHWGGAGHAPPGLPRYRRG
>NZ_CP011309.1|WP_003859104.1|3142074_3142989_-|NADP-dependent-oxidoreductase
MSKVYAFHIFDRPDTQKLIDRPAPQPGPGELAVNVRAAGVNPVDWKIRSGALGTDLALPAPMGQEVAGVITAVGAGVEEFTVGQEILGPVVPGYGGFAEDTLVAAVDAVVKPEEISFTDAATIPVAAATAYDVTHQIELDPGQVLLIVGAGGGVGLMAAQIGRVHKFTVLGVASEAKRQVVEATGATFIPSGDAVAGRVRHLAPDGVDLIVDLVGGQALREVAGLVTDPSHLISAVDPATAAELGGVGLERTPEAMAKITDVIKYGLVDPQVTSRYPLDRAGEALAVVEDGHATGKIVIDMTAA
>NZ_CP011309.1|WP_003859107.1|3143045_3143474_-|cupin-domain-containing-protein
MVSSKNFHIGDNIKHFTIADIATDNPDFRRVLWTGHHAQTVVMTIPPGEEIGEEVHDTTDQILTFVAGTGKADLDGETHLIGPGDQCAVSAGARHNFRNTGDEPLVLYTIYAPPEHAVDSAHATRTEAEAAEAEGRDTPPES
>NZ_CP011309.1|WP_046552204.1|3143531_3145406_-|cadmium-translocating-P-type-ATPase
MKTWKTWGIVAVSGLLIILSWLTPTGWLSDGFMIAAAVVAGWQIALSAYQALRIKMISIDLLVIVAAIGALFINNYWESAAVTFLFALGKALEKATMNRTRQALSDLVDAAPETATVLRDGEPETVEIWELAPGDVVLVKNGEQIPVDGRVLSGHGGVDEATITGESVPAEKAADSEVFAGTWLRSGVLRIEAIGIGSDSTLAKIIHRVEDAQDDKAKTQTFLEKFSKYYTPGVMIAALAVGLITLNVELALTLLVIACPGALVISIPVSIVAGIGRSAKDGVLIKGGEYLETSAKVDTIVVDKTGTLTNGRPELTNVDVLDPAYSDDEVLTLAARAETASEHPLAEAIIRGAENRGLTVAMVEKAEPVAGRGIRADVDGATVAVGSADLLDHTPDNTRILELNEQGRTAMYVGVNGKAVGIVAVADTIRDDAPAAIRSLHDKGIRVVMATGDAERVARNVAAELGVDEVRAELMPEDKLEIVKELQAQGRVVAMVGDGVNDTPALATADIGVAMGAAGSPAAIETADIALMADKLPRLPYALGLAQRTVRTMRVNIGIALLTVTILLAGVLLGGVTMSIGMLVHEASVLLVIAIAMLLLRPTLKEPQAAAKKAAADTHQTATT
>NZ_CP011309.1|WP_144290627.1|3145442_3145652_+|hypothetical-protein
MTLIKLGQFRRNFLDLDQLPTHLRPDEVEQKSMPRGLSTLGTHQHRAVLVGSWRGDDVASIMLLSRVLG
>NZ_CP011309.1|WP_003862060.1|3146049_3146367_-|hypothetical-protein
MAEVTFASLHEKMNFLLKDHGVENFDESDLDLESVSSLHAKANALCAAHGGDPSRMANDTLAQLHPKLDFLMKGHGVDTDTARLDLSTLEAVDAKVNAIVNAHDH
>NZ_CP011309.1|WP_003862062.1|3146571_3146808_-|heavy-metal-associated-domain-containing-protein
MTAPTTLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFSSGRILVTHDPQKVSVRDLVTAVAEVGYTAKPSAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011309_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011309_4

3214681-3214851

Orphan

Consensus_repeat	Method
GCCTTGGTTTCCACCGAA	CRT

3 spacers

The CRISPR arrays of NZ_CP011309_4

>merge|NZ_CP011309|4|3214681-3214851|CRT
GTTTTGGTTTCCACCAAATCCGCCCTGGTTGCTTTGCTGCTGGTTGCCTTGGTTTCCACCGAAGCCGCCAGAGTTCTGGTTGCTGAATCCACCTTGCTGGTTGCCTTGGTTTCCACCGAAGCCACCACCTTGGTTGCCGCCACCGTAGTTTCCGCCAGAGTTTCCACCGCG

>NZ_CP011309|4|1|3214681-3214851|CRT
GTTTTGGTTTCCACCAAA	TCCGCCCTGGTTGCTTTGCTGCTGGTT
GCCTTGGTTTCCACCGAA	GCCGCCAGAGTTCTGGTTGCTGAATCCACCTTGCTGGTT
GCCTTGGTTTCCACCGAA	GCCACCACCTTGGTTGCCGCCACCGTAGTTTCC
GCCAGAGTTTCCACCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011309.1\|WP_003855083.1\|3220432_3220906_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP011309.1\|WP_003861174.1\|3208642_3209017_-\|thioredoxin	unknown	unknown	gnl\|CDD\|200072
NZ_CP011309.1\|WP_003861187.1\|3211890_3213423_-\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|180177
NZ_CP011309.1\|WP_003859529.1\|3205077_3205314_+\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|225328
NZ_CP011309.1\|WP_046552210.1\|3205557_3207435_+\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319774
NZ_CP011309.1\|WP_074492884.1\|3211081_3211684_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP011309.1\|WP_003859526.1\|3204588_3204918_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003861194.1\|3215900_3216092_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003855082.1\|3219848_3220241_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379953
NZ_CP011309.1\|WP_003861189.1\|3214030_3214483_-\|50S-ribosomal-protein-L9	unknown	unknown	gnl\|CDD\|234659
NZ_CP011309.1\|WP_003861176.1\|3209202_3209409_+\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|225328
NZ_CP011309.1\|WP_003855074.1\|3215253_3215541_-\|30S-ribosomal-protein-S6	unknown	unknown	gnl\|CDD\|179034
NZ_CP011309.1\|WP_003861180.1\|3210888_3211071_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011309.1\|WP_003861197.1\|3217594_3219757_-\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|223815
NZ_CP011309.1\|WP_011015549.1\|3220933_3221878_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP011309.1\|WP_011015541.1\|3209582_3210929_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|273327
NZ_CP011309.1\|WP_003855092.1\|3222818_3223757_-\|rhodanese-related-sulfurtransferase	unknown	unknown	gnl\|CDD\|234663
NZ_CP011309.1\|WP_003861205.1\|3222474_3222798_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NZ_CP011309.1\|WP_003861196.1\|3216088_3217549_-\|DUF2029-domain-containing-protein	unknown	unknown	gnl\|CDD\|227937
NZ_CP011309.1\|WP_003861203.1\|3221909_3222407_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP011309.1\|WP_003855083.1\|3220432_3220906_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.61895e-16
NZ_CP011309.1\|WP_003861174.1\|3208642_3209017_-\|thioredoxin	gnl\|CDD\|200072	TIGR01068, Thioredoxin-like_protein_slr0233, thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model. Any protein that hits once with a score greater than the second (per domain) trusted cutoff may be taken as thioredoxin. [Energy metabolism, Electron transport].	1.98121e-36
NZ_CP011309.1\|WP_003861187.1\|3211890_3213423_-\|replicative-DNA-helicase	gnl\|CDD\|180177	PRK05636, PRK05636, replicative DNA helicase; Provisional.	0
NZ_CP011309.1\|WP_003859529.1\|3205077_3205314_+\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	3.51328e-15
NZ_CP011309.1\|WP_046552210.1\|3205557_3207435_+\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP011309.1\|WP_074492884.1\|3211081_3211684_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	3.83449e-24
NZ_CP011309.1\|WP_003861205.1\|3222474_3222798_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	1.24651e-25
NZ_CP011309.1\|WP_003861189.1\|3214030_3214483_-\|50S-ribosomal-protein-L9	gnl\|CDD\|234659	PRK00137, rplI, 50S ribosomal protein L9; Reviewed.	9.34949e-54
NZ_CP011309.1\|WP_003861176.1\|3209202_3209409_+\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	9.07321e-13
NZ_CP011309.1\|WP_003855074.1\|3215253_3215541_-\|30S-ribosomal-protein-S6	gnl\|CDD\|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	2.78025e-37
NZ_CP011309.1\|WP_003855082.1\|3219848_3220241_-\|hypothetical-protein	gnl\|CDD\|379953	pfam17249, DUF5318, Family of unknown function (DUF5318). This family of unknown function is mostly found in Actinobacteria.	1.98003e-34
NZ_CP011309.1\|WP_003861197.1\|3217594_3219757_-\|penicillin-binding-protein	gnl\|CDD\|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	0
NZ_CP011309.1\|WP_011015549.1\|3220933_3221878_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.6173e-13
NZ_CP011309.1\|WP_011015541.1\|3209582_3210929_+\|MFS-transporter	gnl\|CDD\|273327	TIGR00895, transport_protein, benzoate transport. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.39123e-63
NZ_CP011309.1\|WP_003855092.1\|3222818_3223757_-\|rhodanese-related-sulfurtransferase	gnl\|CDD\|234663	PRK00142, PRK00142, rhodanese-related sulfurtransferase.	1.58272e-154
NZ_CP011309.1\|WP_003861196.1\|3216088_3217549_-\|DUF2029-domain-containing-protein	gnl\|CDD\|227937	COG5650, COG5650, Predicted integral membrane protein [Function unknown].	1.76703e-162

>NZ_CP011309.1|WP_003861189.1|3214030_3214483_-|50S-ribosomal-protein-L9
MKLILTAAVENLGVAGDIVEVKNGYGRNLLLPRGLAIVATPGAEKQIEGIKRAQEAREIRDLDHAREVKAALEALEGVTIAVRTSESGKLFGSVKADDIVDAVKAAGGPNLDKRAIVLPKNLVKTTGKYQVEAKLTDGIVSRVKFEVVAA
>NZ_CP011309.1|WP_003861187.1|3211890_3213423_-|replicative-DNA-helicase
MATDTHAASFDDDYVPPQEPSDSFADDAHVDVPAPAFEDFSPAQAFGQGTRGGDSQGFKKRGRKDETREYRDFRQPPYDNDAEMGVLGAMLLSPTTVIDILDILTPEDFYRPSHQLIFQAIIDLFSDNRDIDPVIVSGRLDRTNDLDRVGGGAYLHDLIQSVPTAANARYYAEIVSEKAVLRRLVDAGTRVVQLGYEGDEGAEIDAVIDRAQQEVFAVSQKNQSEDYAVLADILDETMAELEMLNDGGIATGIPTGFKDLDDLTNGLRGGQMIIVAARPGVGKSTIALDFMRSASIKNNMASAIFSLEMSKSEIVMRLLSAETEIRLADMRGGKMDETAWEKMVQKLDKVAQAPLFIDDSANLTMMEIRSKARKLKQKHDLKMIVVDYLQLMSSGKRVESRQQEVSEFSRQLKLLAKELDVPLIAISQLNRGPESRTDKRPQLADLRESGSLEQDADIVMLLYRPDSQDKDDERAGEADIILAKHRGGPIDTVQVAHQLHYSRFVDMARG
>NZ_CP011309.1|WP_074492884.1|3211081_3211684_-|PadR-family-transcriptional-regulator
MHFEELNNEPCGSRGSGEFRGRPGRRHAQRHAEGHGHGHGHGHDRGHHHGRRPGRGRGGRAGRGDLRNVILVLLEAESMHGYQIITTIGEQTEGNWTPSPGTIYPTLSMLEDEGLISISHEMGRKMARLTEEGAQEVAKNKDAWGSILEAYRNPESREVRVFNIRSEFHKVREAAKAAPDDKAEQIIEILRRAADDIKRL
>NZ_CP011309.1|WP_003861180.1|3210888_3211071_-|hypothetical-protein
MQLREDIVVTRTQGATVIANLPRNLEDFRQAQKRTIVGQVKNWWKDLTNQRETYPSAQAA
>NZ_CP011309.1|WP_011015541.1|3209582_3210929_+|MFS-transporter
MSQRVIFSGMNLTRNDRLDRLPVTSKHKKILGGSGIGWALDAMDVGLISFVMAALATHWGLSPTETSLLGSIGFVGMAIGASLGGLLADKLGRRQVFALSLLVYGVATGASALSVSLAMLMALRFVVGLGLGAELPVASTLISEFSPRKVRGRMVVILEAFWALGWIMAAIVGTFVVAGSDNGWRWALALGCVPAIYAVYVRLGLPESVRFLEKKGRHDEAEAIVVSFEEAAAAEGKAADATTAVVHDNAAEGSVSIWSAALRKRTVALWIVWFCINLSYYGAFIWIPSLLVADGFTLVKSFQFTLIITLAQLPGYAVAAWLIEKWGRRSTLATFLVGSAISAALYGLANVEWQILVAGCLLSFFNLGAWGALYAIGPELYPTNVRGTGTGAAAGFGRIASIIAPLIVPPVIAFGGPIALFALFATAFAIAAIAAFTLPEQKGKSLAD
>NZ_CP011309.1|WP_003861176.1|3209202_3209409_+|heavy-metal-associated-domain-containing-protein
MSTKNYHVEGLTCANGVASVEDEIGIVAGTQGVDIDFETGRVTVTGEGFTDEEIIEAVANAGYKVSER
>NZ_CP011309.1|WP_003861174.1|3208642_3209017_-|thioredoxin
MATIDVTEETFESTVTGDGIVLVDAWASWCGPCRQFAPTYEKVSETHTDATFAKLDTEANQGLAAALQIQSIPTLMVFRDGIMVYREAGTMPAPALDDLVNQVKALDMDDVRRQVAEQQGSAEA
>NZ_CP011309.1|WP_046552210.1|3205557_3207435_+|cadmium-translocating-P-type-ATPase
MKTWKTWGIVAVSGLLIILSWLTPAGWLSDGFMIAAAVVAGWQIALSAVQALRIRMISIDLLVIVAAIGALFINNYWESAAVTFLFALGKALEKATMNRTRKALSDLVDAAPETATVLRDGEPETVEIWELAPGDVVLVKNGEQIPVDGRVLSGHGGVDEATITGESVPAEKAADSEVFAGTWLRSGVLRIEAIGIGSDSTLAKIIHRVEDAQDDKAKTQTFLEKFSKYYTPGVMIAALAVGLITLNVELALTLLVIACPGALVISIPVSIVAGIGRSAKDGVLIKGGEYLETSAKVDTIVVDKTGTLTNGRPELTNVDVLDPAYSDDEVLTLAARAETASEHPLAEAIIRGAENRGLTVAMVEKAEPVAGRGIRADVDGATVAVGSADLLDHTPDNTRILELNEQGRTAMYVGVNGKAVGIVAVADTIRDDAPAAIRSLHDKGIRVVMATGDAERVARNVAAELGVDEVRAELMPEDKLEIVKELQAQGRVVAMVGDGVNDTPALATADIGVAMGAAGSPAAIETADIALMADKLPRLPYALGLAQRTVRTMRVNIGIALLTVTILLAGVLLGGVTMSIGMLVHEASVLLVIAIAMLLLRPTLKEDKDKADVSTADAAKETLSA
>NZ_CP011309.1|WP_003859529.1|3205077_3205314_+|heavy-metal-associated-domain-containing-protein
MTAPTTLKNTTLRSDEFTCPSCVAKIETKLGGLDGVESAEVKFSSGRILVSHDPHKVSVRDLVNAVSEVGYTAKPSAI
>NZ_CP011309.1|WP_003859526.1|3204588_3204918_+|hypothetical-protein
MAEVTFASLHEKLNFLLKDHGVHNFDESGLDLESVSSLHAKANALCSAHGGEPSSMPADTLAQLHPKLDLLIKGHGVDFNATDLDTLESVEAKVDVIIDAHEDTHDDQS
>NZ_CP011309.1|WP_003855074.1|3215253_3215541_-|30S-ribosomal-protein-S6
MRQYELMIILDPSQDERTVAPSLDKFLEVVRKDKGDVVKVDVWGKRRLAYPIDKKEEGVYAVVDLKCESATVLELDRVLNLNDGVLRTKVLRLDK
>NZ_CP011309.1|WP_003861194.1|3215900_3216092_-|hypothetical-protein
MSTTVLLVTMVSVFVGFLCFGGAFASFMYKKSNKQIWTLFSIAIVLITVIPVTIAVFWATTPA
>NZ_CP011309.1|WP_003861196.1|3216088_3217549_-|DUF2029-domain-containing-protein
MDQKLDQQKVDRVSPGDSEPVARDFINAIGGRFGRFAQVGTQRFWTPLRVLITTSLVFLAMGFLTKANCIQGSRGTDGVVSLNWSGSRQYTSACYNDIVPLYGGRGIDAPGFPYAFSWQEGDLTRYMEYPVLGGIFQWICGIITRFLYPVVDVIPFHTLPESGLYFIVTALALAFFWVLVIRMMVELTGNRVWDTVLVAASPLVAVHAFTNWDTPAIAAVIGAMLAVKRGNPLVAGVLIGAGTAFKLWPLYLLGAYLVLAVKNKNLKPFITMAAAAAVTWLVVNVPVMIAYPKAWNEFLRLNRERGAEWTTIYQVIDRNLPINLNDPVLLNVLSFGLFGASCVAILILGLRVQRTPRVAELAFLIVAAFLLFNKVWSPQYSLWLVPLAVLAFPQWKVLFPWMVTDTMVWPILMWHMLGTDNKGLPHEMLDLIVISRDAFIVVMIVGVIRQMLGRRADPVMDAHAGRDLLAGPFGAGERRKALKEVS
>NZ_CP011309.1|WP_003861197.1|3217594_3219757_-|penicillin-binding-protein
MTNSKNPPAKKSSGKRRLKSDSKGHAVRNTIIGAIVAVILIPVMVFMSAYIMVDVPEPEELVSPQVSQIYASDGETELARIVPPEGNRQMVTIDQVPDTVKNAVVAAEDREFYTNPGFSITGYARAALGVITGDSSAGGGSTITQQYVKKAVVGDERSLIRKAKELVYSAKMANEWSKDEVLEAYLNTVYFGRNAYGVQAAAHAFFDKPVEELTAAEGAVLAASIQLPSQLDPWTNPVEAETRWNYVMDGLVEIGAISAEERAVATYPETTDPASNSAYTEATGTNGLIKNQVMAELSELGITEDDVQTRGLQVTTTIDPKTQEGAVEAVQNQLDLLSENNRAAVVSIDPSNGAVRAYYGGEDATGWDFANAPLQTGSTFKIFGLAAALQQGIPLSQPYSSAPVTVGDAQIGNVGGSGCGSCSIEQALLHSYNTSFIRLQQDLENGSQDTADMAHALGIAKSLPTIPETLTENGETPYEGIILGQYESRPLDMASAMATIANEGVWHRPHFVSKVETVSGEVLYEFEDGDGERRVSEKVALNLLKAMGPIAAYSNGNALADGQVSASKTGTTQLGDTGANKDAWMLGAAPQLATAVWVGTDDNTALYNTWGGSMYGSNSPATIWKQTMDNALENSPLETWDIAPALGYGNPPVPEYVWTPSPNIATNDPEVETEEAPVEDPNAVIDTPAVDPTAPAEETGNGQVEILPGLTIPGDLLGIG
>NZ_CP011309.1|WP_003855082.1|3219848_3220241_-|hypothetical-protein
MVGLRLHFLIVVHYQNEISHQLARRQTLRQFRAGLVQKDTICDAEFILVTASKYHGHLADYPCPICGSEDLRVVLWVYGDEIGRAAGSARSEEEIEQLVKNGRQATVHTVEVCPTCKWNHLLKAETATAS
>NZ_CP011309.1|WP_003855083.1|3220432_3220906_+|MarR-family-transcriptional-regulator
MLAGMPNLNAEELAVRVRPALTKLYVLYFRRSVNSDLSGPQLTILSRLEENGPSRISRIAELEDIRMPTASNALHQLEQLNLVERIRDTKDRRGVQVQLTDHGREELERVNNERNAEMARLLEMLTPEQLERTEDLVDIITELAEVYGSWKETDSGS
>NZ_CP011309.1|WP_011015549.1|3220933_3221878_+|universal-stress-protein
MMKQPLRVLISCRPEENSGGKRSEQNDAVFEFAAWLARTSDINVRGITTFIRPWPSSSISKLGGKYHKWYKNLDSYYRSRTIKGLKEAGVEKSQWDDDVSVFVDGPSESTLLTHAAEEFEADLILLGSDATAPKGRFLASSTADALLHSSPVPLGLVPRGVKLSKKGVTRVNYAFTNESDDFEQGLRSSAELATNWNVPLRILAFSPTGITSAPTSRSLDISTELSSEWRELTLAMLDRARDGVLTDHPNLSVSSETGSGWGWSGAIDALRWKKGDLLCMGSHRTDTLSRVFVGSETMEIIRNSPVPTIIYPGL
>NZ_CP011309.1|WP_003861203.1|3221909_3222407_+|hypothetical-protein
MPAKEDNFMNTQPEHPENDLVDEADFSNRPRIYSDDPDSLADAPDPALEHEKNKKSSRQALIYLFAVPLVTFVSAYVLAWVSRLQGGPICDAGEAVWICSRAAELWWPITTSVIAFGGMLGSAWILYDKYRNYLRWRPWMGVLWILIPFSMLWGTSVLTLSILGH
>NZ_CP011309.1|WP_003861205.1|3222474_3222798_-|antibiotic-biosynthesis-monooxygenase
MSIVKINAISVPEGAGEELEKRFAARQNAVDSALGFEGFQLLRPVSGEDRYFVVTQWADEDSYNAWRDAEKAKGGHGQGAHGSDKKPVASGASLLEFEVVLGSTGAK
>NZ_CP011309.1|WP_003855092.1|3222818_3223757_-|rhodanese-related-sulfurtransferase
MATSKILLYYAFTPLSDPKAVQLWQRELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYPGFNRMQFKWSEGGADDFPKLSVKVRDEIVAFGAPDELKVDENGVVGGGVHLKPQQVNELVEARGDEVVFFDGRNAMEAQIGKFKDAVVPDVETTHDFIAEIESGKYDDLKDKPVVTYCTGGIRCEILSSLMINRGFKEVYQIDGGIVRYGEQFGNKGLWEGSLYVFDKRMHMEFGEDYKEVGHCIHCDTPTNKFEHCLNEDDCRELVLMCPDCFANVETRHCKRERCAAIAADFAEQGIDPLVTS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011309_2	2.1\|900596\|27\|NZ_CP011309\|PILER-CR	900596-900622	27	MN693154	Marine virus AFVG_25M214, complete genome	6224-6250	4	0.852
NZ_CP011309_2	2.1\|900596\|27\|NZ_CP011309\|PILER-CR	900596-900622	27	NC_014533	Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence	765585-765611	6	0.778
NZ_CP011309_4	4.1\|3214699\|27\|NZ_CP011309\|CRT	3214699-3214725	27	MN855869	Myoviridae sp. isolate 350, complete genome	6522-6548	6	0.778
NZ_CP011309_2	2.1\|900596\|27\|NZ_CP011309\|PILER-CR	900596-900622	27	NZ_CP014419	Staphylococcus aureus strain USA300-SUR15 plasmid pUSA08-1-SUR15, complete sequence	11542-11568	7	0.741
NZ_CP011309_4	4.3\|3214801\|33\|NZ_CP011309\|CRT	3214801-3214833	33	MT498064	Microbacterium phage Pabst, complete genome	41428-41460	7	0.788
NZ_CP011309_4	4.3\|3214801\|33\|NZ_CP011309\|CRT	3214801-3214833	33	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	126742-126774	9	0.727
NZ_CP011309_4	4.3\|3214801\|33\|NZ_CP011309\|CRT	3214801-3214833	33	NZ_CP028345	Vibrio parahaemolyticus isolate R13 plasmid pVpR13_55Kb, complete sequence	5601-5633	10	0.697
NZ_CP011309_4	4.3\|3214801\|33\|NZ_CP011309\|CRT	3214801-3214833	33	NZ_CP028144	Vibrio parahaemolyticus strain R14 plasmid pVpR14_56Kb, complete sequence	39135-39167	10	0.697

1. spacer 2.1|900596|27|NZ_CP011309|PILER-CR matches to MN693154 (Marine virus AFVG_25M214, complete genome) position: , mismatch: 4, identity: 0.852

actatttaaaagttttaaatagcgaca	CRISPR spacer
actatttaaaagatttaaaaagccgca	Protospacer
************ ****** *** .**

2. spacer 2.1|900596|27|NZ_CP011309|PILER-CR matches to NC_014533 (Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence) position: , mismatch: 6, identity: 0.778

actatttaaaagttttaaatagcgaca	CRISPR spacer
gctctttaaaagttgtaaatagcgcac	Protospacer
.** ********** *********

3. spacer 4.1|3214699|27|NZ_CP011309|CRT matches to MN855869 (Myoviridae sp. isolate 350, complete genome) position: , mismatch: 6, identity: 0.778

tccgccctggttgctttgctgctggtt	CRISPR spacer
accgccctgctttctttgctgctgcgg	Protospacer
 ******** ** ***********

4. spacer 2.1|900596|27|NZ_CP011309|PILER-CR matches to NZ_CP014419 (Staphylococcus aureus strain USA300-SUR15 plasmid pUSA08-1-SUR15, complete sequence) position: , mismatch: 7, identity: 0.741

actatttaaaagttttaaatagcgaca	CRISPR spacer
actatttaaaaattttaaatattccat	Protospacer
***********.********* .

5. spacer 4.3|3214801|33|NZ_CP011309|CRT matches to MT498064 (Microbacterium phage Pabst, complete genome) position: , mismatch: 7, identity: 0.788

gccaccaccttggttgccgccaccgtagtttcc	CRISPR spacer
gccaccaccggggttgccgccacccgagccacc	Protospacer
*********  *************  **.. **

6. spacer 4.3|3214801|33|NZ_CP011309|CRT matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.727

gccaccaccttggttgccgccaccgtagtttcc	CRISPR spacer
gccaccaccttgcctgccgccaccttgccccgc	Protospacer
************ .********** *. ... *

7. spacer 4.3|3214801|33|NZ_CP011309|CRT matches to NZ_CP028345 (Vibrio parahaemolyticus isolate R13 plasmid pVpR13_55Kb, complete sequence) position: , mismatch: 10, identity: 0.697

gccaccaccttggttgccgccaccgtagtttcc	CRISPR spacer
tccaccaccttggtggtcgccaccgacaaacgc	Protospacer
 ************* *.********  .  . *

8. spacer 4.3|3214801|33|NZ_CP011309|CRT matches to NZ_CP028144 (Vibrio parahaemolyticus strain R14 plasmid pVpR14_56Kb, complete sequence) position: , mismatch: 10, identity: 0.697

gccaccaccttggttgccgccaccgtagtttcc	CRISPR spacer
tccaccaccttggtggtcgccaccgacaaacgc	Protospacer
 ************* *.********  .  . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1083487 : 1095521

Gordonia_phage(62.5%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860128.1\|1083487_1084522_+	hypothetical protein	A0A1W6JRD2	Corynebacterium_phage	3.6e-43	38.1
WP_144290617.1\|1084855_1085467_+	hypothetical protein	A0A220NQT3	Corynebacterium_phage	2.2e-16	30.3
WP_003860134.1\|1086906_1087326_+	hypothetical protein	NA	NA	NA	NA
WP_034983645.1\|1087279_1088872_+	hypothetical protein	A0A0U4JCX9	Gordonia_phage	6.5e-76	37.3
WP_003860137.1\|1088886_1090185_+	DUF935 family protein	A0A142K8P5	Gordonia_phage	2.4e-105	47.8
WP_003860139.1\|1090177_1091464_+	hypothetical protein	A0A142K9Z2	Gordonia_phage	7.3e-62	38.6
WP_003860140.1\|1091466_1091859_+	hypothetical protein	NA	NA	NA	NA
WP_003860142.1\|1091868_1092798_+	hypothetical protein	A0A142K9H0	Gordonia_phage	1.4e-54	37.1
WP_144290616.1\|1092770_1093208_+	hypothetical protein	NA	NA	NA	NA
WP_003860145.1\|1093218_1093653_+	hypothetical protein	NA	NA	NA	NA
WP_003860147.1\|1093671_1093899_+	hypothetical protein	NA	NA	NA	NA
WP_003860149.1\|1093912_1094236_+	hypothetical protein	NA	NA	NA	NA
WP_051665812.1\|1094235_1094514_+	hypothetical protein	A0A1L6BZF3	Pasteurella_phage	3.2e-07	42.9
WP_003860153.1\|1094506_1094920_+	hypothetical protein	NA	NA	NA	NA
WP_003860155.1\|1094912_1095521_+	hypothetical protein	A0A2H4PA04	Gordonia_phage	3.0e-21	41.1

DBSCAN-SWA_2

2016501 : 2034947

Mycobacterium_phage(23.08%)

portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861785.1\|2016501_2016921_-	DUF2744 domain-containing protein	A0A2D1G9P8	Mycobacterium_phage	1.0e-09	36.0
WP_144290595.1\|2016921_2018571_-\|tail	phage tail protein	A0A220NQQ5	Corynebacterium_phage	3.5e-186	55.4
WP_003861788.1\|2018616_2019474_-	hypothetical protein	A0A220NQR1	Corynebacterium_phage	9.2e-61	41.6
WP_003861790.1\|2019475_2024332_-	tape measure protein	D4P802	Rhodococcus_phage	7.0e-65	42.8
WP_003861792.1\|2024405_2024762_-	hypothetical protein	NA	NA	NA	NA
WP_003861794.1\|2024785_2025271_-	hypothetical protein	NA	NA	NA	NA
WP_003861795.1\|2025476_2026085_-	hypothetical protein	A0A2H4JC28	uncultured_Caudovirales_phage	3.2e-60	60.1
WP_003861797.1\|2026133_2026496_-	hypothetical protein	NA	NA	NA	NA
WP_144290593.1\|2026498_2026729_-	hypothetical protein	NA	NA	NA	NA
WP_003861802.1\|2026709_2026925_-	hypothetical protein	NA	NA	NA	NA
WP_034983993.1\|2026921_2027239_-	hypothetical protein	A0A2H4J5S1	uncultured_Caudovirales_phage	6.7e-17	52.6
WP_003861808.1\|2027610_2027820_-	hypothetical protein	NA	NA	NA	NA
WP_003861809.1\|2027819_2028842_-	hypothetical protein	A0A166XYQ6	Gordonia_phage	7.1e-60	37.9
WP_003861811.1\|2028844_2029216_-	hypothetical protein	A0A159B6N5	Tsukamurella_phage	4.9e-11	35.5
WP_144290594.1\|2029233_2029812_-	hypothetical protein	NA	NA	NA	NA
WP_003861816.1\|2029917_2030712_-	hypothetical protein	A0A2D1G9V3	Mycobacterium_phage	1.5e-12	30.6
WP_003861818.1\|2030712_2032290_-\|portal	phage portal protein	A0A161HSN6	Gordonia_phage	2.0e-69	36.3
WP_003861820.1\|2032286_2033903_-	hypothetical protein	A0A2K9VEL9	Gordonia_phage	2.9e-148	48.7
WP_034983800.1\|2033921_2034407_-	hypothetical protein	A0A2P1CID7	Actinomyces_phage	3.9e-32	56.3
WP_003861824.1\|2034656_2034947_-	HNH endonuclease	A0A1S6L2F2	Mycobacterium_phage	6.8e-08	40.8

DBSCAN-SWA_3

2039324 : 2052495

Corynebacterium_phage(73.33%)

integrase

attL 2035575:2035588|attR 2054417:2054430

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2035575:2035588	attL	NA	NA	NA	NA
WP_003861834.1\|2039324_2039723_-	hypothetical protein	M4W8N6	Mycobacterium_phage	3.3e-29	55.7
WP_040072814.1\|2039715_2040012_-	hypothetical protein	NA	NA	NA	NA
WP_003861838.1\|2040008_2040320_-	hypothetical protein	NA	NA	NA	NA
WP_003861839.1\|2040322_2040655_-	hypothetical protein	A0A1P8D5U2	Corynebacterium_phage	1.7e-07	46.2
WP_003861841.1\|2040647_2041097_-	hypothetical protein	A0A1P8D5W3	Corynebacterium_phage	9.8e-06	31.0
WP_003861842.1\|2041093_2041333_-	hypothetical protein	NA	NA	NA	NA
WP_003861844.1\|2041329_2041989_-	hypothetical protein	A0A1P8D5X1	Corynebacterium_phage	3.5e-28	41.8
WP_003861846.1\|2041985_2042237_-	hypothetical protein	NA	NA	NA	NA
WP_044394284.1\|2042493_2042715_-	hypothetical protein	A0A1P8D5S3	Corynebacterium_phage	2.4e-21	72.5
WP_003861851.1\|2042813_2043332_-	single-stranded DNA-binding protein	A0A1P8D5R5	Corynebacterium_phage	3.4e-58	67.2
WP_144290596.1\|2043318_2043762_-	hypothetical protein	NA	NA	NA	NA
WP_003861855.1\|2043812_2044640_-	helix-turn-helix domain-containing protein	A0A2K9VGL5	Pontimonas_phage	1.5e-15	50.7
WP_003861857.1\|2044636_2044777_-	hypothetical protein	NA	NA	NA	NA
WP_003861861.1\|2045207_2045543_-	hypothetical protein	A0A1P8D5R3	Corynebacterium_phage	7.7e-40	75.0
WP_003861863.1\|2045539_2045932_-	hypothetical protein	A0A1P8D5Q5	Corynebacterium_phage	7.2e-21	50.4
WP_003861865.1\|2045938_2046148_-	hypothetical protein	NA	NA	NA	NA
WP_034983802.1\|2046281_2046500_-	hypothetical protein	NA	NA	NA	NA
WP_003861871.1\|2046585_2046786_-	hypothetical protein	NA	NA	NA	NA
WP_003861875.1\|2047443_2047662_-	hypothetical protein	NA	NA	NA	NA
WP_034983804.1\|2048185_2048983_-	antirepressor	A0A0C5AEJ9	Bacteriophage	2.6e-73	56.5
WP_003861878.1\|2048979_2049213_-	hypothetical protein	A0A1P8D5P3	Corynebacterium_phage	1.0e-06	45.7
WP_003861879.1\|2049240_2049477_-	hypothetical protein	A0A1W6JQ99	Corynebacterium_phage	9.1e-11	54.0
WP_003861880.1\|2049628_2050099_+	hypothetical protein	A0A1W6JQ81	Corynebacterium_phage	2.7e-30	59.6
WP_003861883.1\|2050107_2050485_+	ImmA/IrrE family metallo-endopeptidase	A0A1P8D5N3	Corynebacterium_phage	4.8e-54	82.8
WP_034983805.1\|2050686_2051190_+	hypothetical protein	NA	NA	NA	NA
WP_003861888.1\|2051307_2052495_+\|integrase	site-specific integrase	A0A1L6BZH2	Pasteurella_phage	1.6e-50	33.1
2054417:2054430	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2470414 : 2520283

Corynebacterium_phage(92.06%)

integrase

attL 2469784:2469801|attR 2516988:2517005

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2469784:2469801	attL	NA	NA	NA	NA
WP_003859208.1\|2470414_2470846_-	hypothetical protein	A0A220NQQ7	Corynebacterium_phage	1.3e-15	37.3
WP_003859207.1\|2470848_2471190_-	hypothetical protein	NA	NA	NA	NA
WP_080708844.1\|2471189_2472554_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8D5Q3	Corynebacterium_phage	4.6e-123	52.5
WP_003859205.1\|2472599_2472875_-	hypothetical protein	A0A1P8D5Q2	Corynebacterium_phage	1.2e-33	75.8
WP_003859203.1\|2473310_2474495_-	hypothetical protein	A0A1P8D5M9	Corynebacterium_phage	1.3e-142	89.8
WP_003859202.1\|2474506_2475346_-	hypothetical protein	A0A1P8D5M2	Corynebacterium_phage	7.4e-140	95.3
WP_003859201.1\|2475347_2476232_-	hypothetical protein	A0A1P8D5L4	Corynebacterium_phage	8.9e-168	97.6
WP_003859200.1\|2476235_2477003_-	hypothetical protein	A0A1P8D5L6	Corynebacterium_phage	2.8e-141	94.9
WP_003859199.1\|2477012_2483447_-	tape measure protein	A0A1P8D5L8	Corynebacterium_phage	0.0e+00	92.3
WP_144290600.1\|2483493_2483748_-	hypothetical protein	A0A1P8D5M6	Corynebacterium_phage	9.1e-25	77.9
WP_003859197.1\|2483855_2484224_-	hypothetical protein	A0A1P8D5N6	Corynebacterium_phage	2.1e-54	94.9
WP_003859196.1\|2484351_2485047_-	hypothetical protein	A0A1P8D5L5	Corynebacterium_phage	9.9e-98	76.6
WP_144290601.1\|2485036_2485405_-	hypothetical protein	A0A1P8D5P6	Corynebacterium_phage	8.0e-38	64.2
WP_003859194.1\|2485443_2485743_-	hypothetical protein	A0A1P8D5P7	Corynebacterium_phage	5.7e-26	62.6
WP_003859193.1\|2485742_2486075_-	hypothetical protein	A0A1P8D5M1	Corynebacterium_phage	3.1e-25	53.2
WP_003859192.1\|2486071_2486509_-	hypothetical protein	A0A1P8D5L3	Corynebacterium_phage	1.4e-33	52.5
WP_003859191.1\|2486518_2486902_-	hypothetical protein	NA	NA	NA	NA
WP_003859190.1\|2486901_2487825_-	hypothetical protein	G9FH31	Rhodococcus_phage	4.0e-38	31.9
WP_003859189.1\|2487907_2488312_-	hypothetical protein	NA	NA	NA	NA
WP_003859188.1\|2488325_2489513_-	peptidase S14 ClpP	A0A1P8D5M0	Corynebacterium_phage	1.6e-92	52.5
WP_003859187.1\|2489487_2490771_-	hypothetical protein	A0A1P8D5N1	Corynebacterium_phage	1.1e-99	51.2
WP_144290602.1\|2490780_2492328_-	hypothetical protein	A0A0U4JCX9	Gordonia_phage	1.4e-91	42.9
WP_003859185.1\|2492281_2492653_-	hypothetical protein	A0A142K8P3	Gordonia_phage	2.4e-10	34.4
WP_003859184.1\|2492785_2494051_-	AAA family ATPase	A0A1P8D5W0	Corynebacterium_phage	5.9e-56	36.0
WP_003859183.1\|2494071_2494254_-	hypothetical protein	NA	NA	NA	NA
WP_003859182.1\|2494352_2494679_-	hypothetical protein	NA	NA	NA	NA
WP_003859181.1\|2495463_2495709_-	hypothetical protein	A0A1P8D5W9	Corynebacterium_phage	2.7e-34	88.9
WP_003859180.1\|2495698_2496307_-	hypothetical protein	NA	NA	NA	NA
WP_003859179.1\|2496310_2496553_-	hypothetical protein	A0A1P8D5T7	Corynebacterium_phage	1.9e-32	90.0
WP_003859178.1\|2496757_2497396_-	hypothetical protein	A0A1P8D5X1	Corynebacterium_phage	1.2e-100	87.7
WP_003859177.1\|2497392_2497701_-	hypothetical protein	A0A1P8D5W8	Corynebacterium_phage	3.2e-24	55.8
WP_003859176.1\|2497693_2497903_-	hypothetical protein	A0A1P8D5U6	Corynebacterium_phage	3.8e-29	97.1
WP_003859175.1\|2498177_2498453_-	hypothetical protein	A0A1P8D5U7	Corynebacterium_phage	2.1e-11	48.3
WP_003859173.1\|2498422_2498803_-	hypothetical protein	A0A1P8D5T6	Corynebacterium_phage	2.2e-51	81.4
WP_003859172.1\|2498799_2499180_-	hypothetical protein	NA	NA	NA	NA
WP_003859170.1\|2499172_2499349_-	hypothetical protein	A0A1P8D5V4	Corynebacterium_phage	2.2e-22	86.2
WP_144290603.1\|2499345_2499636_-	hypothetical protein	W0LPX9	Mycobacterium_phage	2.1e-09	41.8
WP_046552194.1\|2499755_2500019_-	hypothetical protein	A0A1P8D5U4	Corynebacterium_phage	2.9e-42	92.9
WP_003859163.1\|2499990_2500194_-	hypothetical protein	A0A1P8D5V7	Corynebacterium_phage	2.0e-27	92.5
WP_003859161.1\|2500193_2500637_-	hypothetical protein	A0A1P8D5S0	Corynebacterium_phage	1.8e-23	71.1
WP_144290606.1\|2500853_2501252_-	hypothetical protein	A0A1P8D5R7	Corynebacterium_phage	9.4e-69	99.2
WP_080708845.1\|2501268_2501637_-	DUF4406 domain-containing protein	A0A1P8D5R6	Corynebacterium_phage	1.1e-63	98.3
WP_003859151.1\|2501608_2502319_-	hypothetical protein	A0A1P8D5S1	Corynebacterium_phage	1.4e-67	65.0
WP_003859149.1\|2502318_2502618_-	hypothetical protein	A0A1P8D5U3	Corynebacterium_phage	6.7e-35	69.4
WP_003859147.1\|2502614_2503133_-	hypothetical protein	NA	NA	NA	NA
WP_003859145.1\|2503125_2503413_-	hypothetical protein	A0A1P8D5R2	Corynebacterium_phage	8.4e-35	76.1
WP_044394324.1\|2503409_2503844_-	class I SAM-dependent methyltransferase	A0A1P8D5V0	Corynebacterium_phage	1.1e-78	93.1
WP_003859142.1\|2503903_2504377_-	hypothetical protein	A0A1P8D5U9	Corynebacterium_phage	5.6e-76	82.8
WP_144290607.1\|2504376_2504598_-	hypothetical protein	A0A1P8D5S3	Corynebacterium_phage	1.0e-32	97.2
WP_003859139.1\|2504632_2505025_-	hypothetical protein	A0A1P8D5R9	Corynebacterium_phage	4.1e-48	74.0
WP_003859137.1\|2505085_2505412_-	hypothetical protein	A0A1P8D5R1	Corynebacterium_phage	8.9e-57	90.7
WP_003859136.1\|2505408_2505675_-	hypothetical protein	A0A1P8D5Q8	Corynebacterium_phage	2.8e-40	87.5
WP_003859134.1\|2505684_2506245_-	single-stranded DNA-binding protein	A0A1P8D5R5	Corynebacterium_phage	2.9e-87	88.7
WP_003859132.1\|2506245_2506755_-	hypothetical protein	A0A1P8D5S4	Corynebacterium_phage	6.6e-91	98.8
WP_074495295.1\|2506764_2507622_-	helix-turn-helix domain-containing protein	A0A1P8D5T4	Corynebacterium_phage	9.9e-140	99.3
WP_144290604.1\|2507638_2507971_-	hypothetical protein	A0A1P8D5Q6	Corynebacterium_phage	2.5e-59	98.2
WP_144290605.1\|2508109_2508565_-	hypothetical protein	A0A1P8D5U0	Corynebacterium_phage	3.7e-61	86.0
WP_040072904.1\|2508883_2509261_-	hypothetical protein	A0A1P8D5Q5	Corynebacterium_phage	4.0e-61	96.0
WP_040072906.1\|2509420_2510290_-	DUF2303 family protein	A0A1P8D5Q0	Corynebacterium_phage	5.6e-106	67.9
WP_044394326.1\|2510307_2510667_-	hypothetical protein	A0A1P8D5Q7	Corynebacterium_phage	6.6e-37	65.8
WP_040072907.1\|2510690_2510870_-	helix-turn-helix domain-containing protein	A0A1P8D5R4	Corynebacterium_phage	8.6e-22	86.4
WP_040072908.1\|2510862_2511063_-	hypothetical protein	A0A1P8D5S2	Corynebacterium_phage	1.0e-18	66.7
WP_155392850.1\|2511059_2511200_-	hypothetical protein	A0A1P8D5P9	Corynebacterium_phage	2.6e-13	82.6
WP_040072909.1\|2511470_2511995_-	hypothetical protein	NA	NA	NA	NA
WP_040072910.1\|2511978_2512920_-	hypothetical protein	A0A1P8D5P5	Corynebacterium_phage	1.2e-82	62.0
WP_040072911.1\|2512936_2513185_-	hypothetical protein	A0A1P8D5N7	Corynebacterium_phage	3.5e-37	96.3
WP_040072913.1\|2513454_2513700_-	hypothetical protein	A0A1P8D5P3	Corynebacterium_phage	2.4e-38	100.0
WP_040072914.1\|2513732_2513978_-	hypothetical protein	A0A1P8D5P8	Corynebacterium_phage	1.5e-37	98.8
WP_046552195.1\|2514669_2515044_+	ImmA/IrrE family metallo-endopeptidase	A0A1P8D5N3	Corynebacterium_phage	8.0e-70	100.0
WP_094244271.1\|2515089_2515599_+	hypothetical protein	A0A1P8D5Q9	Corynebacterium_phage	7.6e-55	100.0
WP_046552196.1\|2515716_2516958_+\|integrase	site-specific integrase	A0A1P8D5R0	Corynebacterium_phage	3.1e-235	99.5
WP_040072918.1\|2516954_2517566_-	DSBA oxidoreductase	NA	NA	NA	NA
2516988:2517005	attR	NA	NA	NA	NA
WP_046552197.1\|2517679_2520283_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	6.0e-47	30.1

DBSCAN-SWA_5

3148034 : 3176752

Burkholderia_virus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862068.1\|3148034_3148694_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.5e-47	55.6
WP_003862069.1\|3149251_3149518_+	hypothetical protein	NA	NA	NA	NA
WP_003862070.1\|3149514_3151008_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_003862071.1\|3150974_3152276_+	APC family permease	NA	NA	NA	NA
WP_003862072.1\|3152512_3152755_+	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_003862073.1\|3152751_3153063_+	hypothetical protein	NA	NA	NA	NA
WP_003862074.1\|3153166_3153877_+\|transposase	IS6-like element ISCef5 family transposase	A0A077SL39	Escherichia_phage	2.8e-79	59.8
WP_003859021.1\|3154367_3154757_-	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_003859023.1\|3154855_3156277_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-44	30.0
WP_046552205.1\|3156536_3157133_-	cadmium transporter	NA	NA	NA	NA
WP_011013963.1\|3157132_3157492_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003860174.1\|3157841_3158468_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.9e-23	36.4
WP_034983343.1\|3158929_3159970_+	hypothetical protein	NA	NA	NA	NA
WP_010889963.1\|3159992_3160703_-\|transposase	IS6-like element IS1628 family transposase	A0A077SL39	Escherichia_phage	6.8e-78	58.5
WP_144290614.1\|3161370_3161973_-	vitamin K epoxide reductase family protein	NA	NA	NA	NA
WP_003860228.1\|3162028_3162712_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_074495768.1\|3162753_3163086_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034983345.1\|3163230_3163980_-	M23 family metallopeptidase	O03937	Lactobacillus_phage	2.1e-21	46.6
WP_046552218.1\|3165262_3167323_-	bifunctional copper resistance protein CopD/cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_003860216.1\|3167581_3168166_+	copper resistance protein C	NA	NA	NA	NA
WP_003860214.1\|3168342_3168708_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034983874.1\|3168740_3170675_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.8e-89	36.8
WP_003860209.1\|3170738_3171779_+	SURF1 family protein	NA	NA	NA	NA
WP_003860207.1\|3171902_3173990_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.7e-114	39.5
WP_015453112.1\|3174278_3175370_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_080506389.1\|3175797_3176142_-\|transposase	transposase	Q8W6R2	Burkholderia_virus	2.9e-18	49.0
WP_003860196.1\|3176104_3176752_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	6.3e-30	41.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011309

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection