CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011366	Salinicoccus halodurans strain H3B36 isolate soil chromosome, complete genome	2 crisprs	cas3,DEDDh,DinG,csa3	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011366_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011366_1

88079-88170

Orphan

Consensus_repeat	Method
TCTTCAGTCACTTGTGGAGCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011366_1

>merge|NZ_CP011366|1|88079-88170|CRISPRCasFinder
TCTTCAGTCACTTGTGGAGCTTCTTCAGTTACCTGAGGTGCCTCTTGTACTTGTTGCTGAGGTTGTGCTTCTTCAGTCACTTGTGGAGCTTC

>NZ_CP011366|1|1|88079-88170|CRISPRCasFinder
TCTTCAGTCACTTGTGGAGCTTC	TTCAGTTACCTGAGGTGCCTCTTGTACTTGTTGCTGAGGTTGTGCT
TCTTCAGTCACTTGTGGAGCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011366.1\|WP_046789007.1\|80872_82075_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NZ_CP011366.1\|WP_046789021.1\|97075_97639_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_CP011366.1\|WP_052749793.1\|85166_85574_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011366.1\|WP_046789011.1\|86605_87343_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237191
NZ_CP011366.1\|WP_046789005.1\|78255_79005_-\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|181517
NZ_CP011366.1\|WP_046789019.1\|95882_96554_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP011366.1\|WP_046789006.1\|80178_80868_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP011366.1\|WP_046789015.1\|90980_92477_-\|epidermal-surface-antigen	unknown	unknown	gnl\|CDD\|225177
NZ_CP011366.1\|WP_143544915.1\|88604_88934_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011366.1\|WP_052749792.1\|84740_85166_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270916
NZ_CP011366.1\|WP_046789009.1\|83891_84515_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187554
NZ_CP011366.1\|WP_046789020.1\|96610_96886_-\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NZ_CP011366.1\|WP_052749791.1\|79374_79854_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|181084
NZ_CP011366.1\|WP_046789017.1\|93286_94420_-\|NADH-dependent-flavin-oxidoreductase	unknown	unknown	gnl\|CDD\|240086
NZ_CP011366.1\|WP_046789010.1\|86103_86526_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NZ_CP011366.1\|WP_046789014.1\|89717_90788_-\|choloylglycine-hydrolase	unknown	unknown	gnl\|CDD\|227264
NZ_CP011366.1\|WP_046789016.1\|92805_93222_+\|NAD(+)--rifampin-ADP-ribosyltransferase	unknown	unknown	gnl\|CDD\|378815
NZ_CP011366.1\|WP_046789013.1\|88943_89690_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP011366.1\|WP_046789008.1\|82231_83854_-\|FMN-binding-glutamate-synthase-family-protein	unknown	unknown	gnl\|CDD\|223147
NZ_CP011366.1\|WP_046789018.1\|94588_95668_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381317

Protein	Function_ID	Function_description	E-value
NZ_CP011366.1\|WP_046789007.1\|80872_82075_+\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.29831e-144
NZ_CP011366.1\|WP_046789021.1\|97075_97639_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	1.07034e-14
NZ_CP011366.1\|WP_046789011.1\|86605_87343_-\|hypothetical-protein	gnl\|CDD\|237191	PRK12757, PRK12757, cell division protein FtsN; Provisional.	0.000464558
NZ_CP011366.1\|WP_046789005.1\|78255_79005_-\|3-oxoacyl-ACP-reductase	gnl\|CDD\|181517	PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	3.47093e-146
NZ_CP011366.1\|WP_046789019.1\|95882_96554_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	7.12203e-56
NZ_CP011366.1\|WP_046789006.1\|80178_80868_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	6.51731e-47
NZ_CP011366.1\|WP_046789015.1\|90980_92477_-\|epidermal-surface-antigen	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.69195e-63
NZ_CP011366.1\|WP_052749792.1\|84740_85166_-\|hypothetical-protein	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.92747e-18
NZ_CP011366.1\|WP_046789009.1\|83891_84515_-\|NAD(P)H-binding-protein	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	5.20671e-27
NZ_CP011366.1\|WP_046789020.1\|96610_96886_-\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	1.00802e-23
NZ_CP011366.1\|WP_052749791.1\|79374_79854_+\|hypothetical-protein	gnl\|CDD\|181084	PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated.	8.18309e-18
NZ_CP011366.1\|WP_046789017.1\|93286_94420_-\|NADH-dependent-flavin-oxidoreductase	gnl\|CDD\|240086	cd04735, OYE_like_4_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 4. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.	3.75869e-176
NZ_CP011366.1\|WP_046789013.1\|88943_89690_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.50433e-18
NZ_CP011366.1\|WP_046789014.1\|89717_90788_-\|choloylglycine-hydrolase	gnl\|CDD\|227264	COG4927, COG4927, Predicted choloylglycine hydrolase [General function prediction only].	2.4037e-68
NZ_CP011366.1\|WP_046789016.1\|92805_93222_+\|NAD(+)--rifampin-ADP-ribosyltransferase	gnl\|CDD\|378815	pfam12120, Arr-ms, Rifampin ADP-ribosyl transferase. This protein is found in bacteria. Proteins in this family are typically between 136 to 150 amino acids in length. The opportunistic pathogen Mycobacterium smegmatis is resistant to rifampin because of the presence of a chromosomally encoded rifampin ADP-ribosyltransferase (Arr-ms). Arr-ms is a small enzyme whose activity thus renders rifamycin antibiotics ineffective.	2.0402e-62
NZ_CP011366.1\|WP_046789010.1\|86103_86526_+\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	5.73977e-15
NZ_CP011366.1\|WP_046789008.1\|82231_83854_-\|FMN-binding-glutamate-synthase-family-protein	gnl\|CDD\|223147	COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism].	2.20424e-140
NZ_CP011366.1\|WP_046789018.1\|94588_95668_-\|aldo/keto-reductase	gnl\|CDD\|381317	cd19091, AKR_PsAKR, Polaromonas Sp. aldo-keto reductase and similar proteins. The prototype of this family is an uncharacterized aldo-keto reductase from Polaromonas sp.	1.43058e-137

>NZ_CP011366.1|WP_046789011.1|86605_87343_-|hypothetical-protein
MKKTILTTTLALGLGVTGVSADQNAEASEINKGELAQMAQADSNELNNAPIHEGEYNYNFTVDGVNYNFESDGTYYTWSYGGYSNETPQNEVTETAQQEDAPQVTEESNEQTQQVAPNTEQQESAPQVTEETQQQPEQNTQQSEDVQAAAPEQNTESSEATGGSTKEQFLAAGGTEAMWQNIVMPESSGDPNAVNELGYKGLGQTKESWGTGSVEEQTEGMINYAQERYGSIDAAMEFRAANNWW
>NZ_CP011366.1|WP_046789010.1|86103_86526_+|universal-stress-protein
MYNNILLPYDFANTFDNVPEELAKLTENSENAVITVFNVVTEGEMSSDVRFNGKSFSANTKERVEKLKPFTNRLDEKGLKYEVRFEAGRVISELLKEIKENEYDIVVMSNRRSKRDIKHVLGHVTHKVAKRVNTPVMIIK
>NZ_CP011366.1|WP_052749793.1|85166_85574_-|hypothetical-protein
MQRANKSRKNEKLISKINKFFTLESTKRNIIHEAPPISVKDIFKHFWPYTPQKCLKYGLSQHLHLSSPYVLQKETAGKILVREGEIITMSHPNLIRGYELHSKPQPVVIQETLTGKTISHLVRQIYKRGDELSLI
>NZ_CP011366.1|WP_052749792.1|84740_85166_-|hypothetical-protein
MAYFGKQIASVVNYLHQNNLLHLDIKPSNIISQPPLAKLFDLNLVTTPGTIRKGTGTSFGRTLTYSADVRGVGVELFFMATGERPFKTYDDKRYVQLEHSTEDGNILFEMIDSCLDPVAENRPATVDVFRICEKFIILQSQ
>NZ_CP011366.1|WP_046789009.1|83891_84515_-|NAD(P)H-binding-protein
MKVFVFGGNEGAGEHVLKKLAAKGHEAVTIAETENRAEELEMLGAADVIISKDGHFTNAIDGSEAIIYMAGSSLGAGEDQETLVDYGTVRKSLEEAQRHKIERLVYLSPVRTDESPESKETGEKDEPEEWIKKSQLAYTVIRTTKRVSKPGKEMITAKETIADSNGEIPYEDVAAVLVEALDNQNTFRKAFEITAGDTSIEEALDSL
>NZ_CP011366.1|WP_046789008.1|82231_83854_-|FMN-binding-glutamate-synthase-family-protein
MGKITKYLPSAIMGTSIAAPLAYMAYMYQKDDRQKQHAILRNFPLLGRVRYMTEHVGPELRQYLFADDNEGQPFSRLQYQDVVKAGKYNERLLGFGSNRDFEEDGYYIRNTLFPKLSTEMKLDNTEKTNTYTYVVDNEGLFSRKEHHEEAQIDPYFLRDEDAVVLGEGNCRQPFHIKGQVGMSAMSYGALGERAITALSKGLAAAGGTWMNTGEGGISDYHLAGNADLMMQIGPGLFGVRTTAGEFSWEAFKEKSEIEQVKAFEVKLAQGAKTRGGHLEGQKVTEEIARIRLIEPGKTVNSPNRFVDYESFSDLFDFIEQLREVGGKPVGMKIVVGDIEKLEEMVQIMRDSNKGPDFITIDGSEGGTGATYQELADSVGLPIMTALPIVDELLREFDIRDRVKLIASGKLVTPDKAAIALGMGADLINIARGFMISVGCIMAEVCHTNTCPVGVATTDPELQTGLIVDEKRHRVTNYVTSLRAGLFNVAAAAGVDSPTKLERRHLIYKDYRGRISSVGSMLQRIEQAEDKEQDVESLPDK
>NZ_CP011366.1|WP_046789007.1|80872_82075_+|MFS-transporter
MGNERTAGSFDINTKKSWLLIIGVILVSTNLRGPFTSVGALIPFIRDDLAISNALAGSITTLPLLAFALLSPFAPKIANRIGMEWTITLSLVLLIIGIVIRSFGEIVFLFTGTFFIGLAIAIGNVLIPGIIKMNFPLKIGLMTGMYAIFMNLFGALGSGISVPLASIGNFGWQGALGVWGILAVISLLIWLPQLTSQRNQQASVETEKKSSLWRSPLAWKITIFMGSQSLIFYTLITWLPDILYANGLNSNTAGWMLFLMQFSIIPFTFIIPVIAEKMKSQVVLSVATGFLFIIGLSGLLQGNLTLAPLYVILLGIAGGSAFSLSMMFFTLRTRNGKEAAELSGMAQSFGYLLAAVGPVLVGALQDLTAGWTIPLSLLILISVIFLIVGMSSGKERQVTD
>NZ_CP011366.1|WP_046789006.1|80178_80868_+|FadR-family-transcriptional-regulator
MIRKTNRTQLVEQVASQIEKLIEAGYWTVGEKIPPEMELVDKFDVSRNTLREAIRALVHAGLLETRQGSGTIVRSANSLGAALRRYIKKTALLETLDVRLALENQAAQLAAEHRSETDLLTLEECIKNCRKAVKNHNREKFIASDIRFHQTVVQSSKNQLLIDLYEPMVEIIYTFVEDLMAMDVPFKYEEELHLELFAAIQSHDKNAAAAYVDSYMEVLRKDVVEMMED
>NZ_CP011366.1|WP_052749791.1|79374_79854_+|hypothetical-protein
MLGESCAINGVLPPVISLIASMEVSEVIRYLSGKGFSKQLITVDTFKIGFQTINIDELKNEDCVVCKNRIYEQLNKNMLATVQSNCGSVYTLRFDESDFNQELPGKTIRASAFVKLLTYKKYKLTLFKDGRMNVHGISRKEEANALYHEMIEKLSEYPV
>NZ_CP011366.1|WP_046789005.1|78255_79005_-|3-oxoacyl-ACP-reductase
MTRTVLVTGSGRGLGSYIVKALSEKGFNVIINYNNSKEESEKLKKEIGSQAIAIQADITDREAVEQLVKKGTEHFGQIDVVVNNALVNFKFDPTTQKAFKDLTYKDYEQQLDGTLKAAFNVSQSVIPQFLERKDGAIISIGTNLYQNPVVPYHEYTTAKAALIGFTRNVAAELGQHGIRANVVSGGLLKTTDASAVTTPEVFDLIAQSTPLRKVTTPQDVANMVVYLCSEAADGITGQNITVDGGLTMN
>NZ_CP011366.1|WP_143544915.1|88604_88934_+|hypothetical-protein
MKLQNPVTYVILIYSCIIPVLFLKILLYKGCFVSFICLITENLLISGRGIKIETAGYGYPAFDHIGEIDMHLEEQKRVYDDGKALIGSDKEWMFPVRPAYQYDDSKQME
>NZ_CP011366.1|WP_046789013.1|88943_89690_+|sulfite-exporter-TauE/SafE-family-protein
MEILPVIAVLFVGIIVGFVNIVSAGGSMLTLPLLIFFGLPSNVANGTNRIAIMVQNVFALYQFQKKGLLNWRLGLLLAVPATVASIYGAEIAVNIAHGTLDTLLATFMIIFVILLIIKPQRYIEGKINSKVSLVLLFFAFILIGIYGGALQAGVGFFIILTLMVLVPRIPMADMHGIKILVVTIYISVSTFVFIANDLVNWKFAAALSVGSAIGGFMGGKYASILPDKLLQRILIIAIIFFAILLFIR
>NZ_CP011366.1|WP_046789014.1|89717_90788_-|choloylglycine-hydrolase
MKQFYSDVIQFRGTHYDFGYYQGKLLKDSPILPNREKQWGPKKDRHFMIDPERYLEIIKNIAPAILDEIQGLADALDMDMDKAFRSFGGYYLEFKRSGCSIFTDTEYMVRNYDSHPRGYEGRYLFYAPSDEGYAFIAPSMQITGRIDGMNEKGLVTGYNFTHSKMAGDGFMCSMVARLILETCANTAEAISLLKTIPHRHSFSYVLLDTDGHSYVVEASPRRVAVRQSNVCTNHFHLLNEENRYRQEETRQREKTIQIRQKSSTNPYQAFKVMNSPEQGVFSEKYDASAGTIHTSVYFPNELKAWFVIGPDRAPVIFDFGKWLRGNNVNITQIKGELKYHRPFVNMEMPRTKKDHH
>NZ_CP011366.1|WP_046789015.1|90980_92477_-|epidermal-surface-antigen
MFEVTGTLLAVLFIIGVIIVAGIIWYLFMKARYRTVPSNEALIVTGPNLGDESKETNIYKDDQGRYMKVIRGGGHRLKLFQTGTRVSLKSFQLQISTPKVYTLEGVGIYGEAVATVKVADDLDGIVKYAEQFLGKDQKDIEHEISEVLNSNLRAILSKMTVEQINKDRESFNEQVREIAQDQLNRMGFKITSLGLSDLRDDENYLENLGRPQIARVKKEAEIAESENRRETEIQQAKDNEDISNEQYKREMNIAESRKEKDIKDAKILAETEKENAAARAAGQLEEEERRLEVERQRLEIREQEKQNELKLRQMERENDVQLEKQQVEVRRQQAEADYYAQTKDAEARAESRMAEGKAEAEVIREKSMAEAEAIERRAKAMAEHKDVIILEKLIEIMPEFAKAVSDSMSNVESIRVLDSGSGDQLQSLPNTVTGTMAKLQESMGQMTGFDLENFLGNLSSSEEADFSEVGEKGDAEAEKETEQDSRDDEPTAENDEQQ
>NZ_CP011366.1|WP_046789016.1|92805_93222_+|NAD(+)--rifampin-ADP-ribosyltransferase
MTHDKNVLDKGPFLHGTKAELEIGDLLEPQFESNYQDKKSNYIYFTATLDAAKWGAELASGNLKERIYLVEPVGGFENDPNVTDKRFPGNPTRSYRSKSALRIVGELGKWERHSDEELKGMLDGLQKLREEGRDIIYD
>NZ_CP011366.1|WP_046789017.1|93286_94420_-|NADH-dependent-flavin-oxidoreductase
MNKKYAPLFETVQLPNGIELRNRFVLAPMTHVSSNDDGTASDMEIDYIGKMSKDVGLAISAASNVTDLGKAFPGQPSVVRDSDIEGLKKVADAMKENGAKAILQIHHGGAQALPRLTPGADSAAPSPITLQSFDETEKHDAREITETEIGKTVRAFGEATRRAVEAGFDGVEIHGANHYLIHQFVSPHFNKRTDEWGEDRYLFAAEIVDEVVKAKNEYAGDEFILGYRFSPEEPETPGINMEITKELINRLIDKPLDYLHASLGDVHSKTREGRYEGTERIELLHKWIDGRMPLVGIGSVFNPDAALGAIEGGNVELIALGRALLLDYNFISKIKEGKEDDIVNAFDPDREDKYGLPEPLWKQLYNGFYPLPRTDEQ
>NZ_CP011366.1|WP_046789018.1|94588_95668_-|aldo/keto-reductase
MDYKLLGDSGLNISKYALGTIPFSGTNGFEPAGSMDQETANALVDHALDHGINHFDTANLYAKGDAEIVLGKAIRNKRKDMVIASKTGFQLTDNPNDVGATRINIEASIDETLDRLGTDYLDLYYVHVWDGQVSVTETVLAMNDLIRKGKIRYWGVSNYSGWALAKTHTFAVENNLMPPIAHQIYYTPESREAEFELLPAGKELGVGNTIWSPLGEGLLTGKISRNQKAQPGTRQGEDWPEPYIKDRKLFYDLVELLQDVADGHNATVPQVVLAWLRDRPNVDSIIIGARNKDQWYENVASYDLQLTDKDLSQINDLTLPEPIYPLWHRAMNTRDRASEAEKPYLEAFNAHMEKQEKDI
>NZ_CP011366.1|WP_046789019.1|95882_96554_+|RluA-family-pseudouridine-synthase
MHINVLYEDNHLLIVEKPVNIPVQGDSSKDRDLLNILKQYIKEKYNKPGDVYLGLIHRLDRPVGGAMVFAKTSKAASRLSDELRRHQIYRKYLAVTRGFLPKKKGRLTDYLWKDRRKNIVSAVSPDNKDAKKAVLDYKVLQSSTEGSLVEVELKTGRSHQIRVQFANQGSPLYGDQKYGQHVNKPGQQIALWASRLSIKHPTKGEMITVDCPPPDKHPWSEFA
>NZ_CP011366.1|WP_046789020.1|96610_96886_-|4a-hydroxytetrahydrobiopterin-dehydratase
MADVKAEVEKLDGWSIDNETISKKFKFDKYLDGISFVEKIGTYAEGVQHHPGISINYTTVAVSWTTHSKKELTEKDIAAAKACNNLYQLFS
>NZ_CP011366.1|WP_046789021.1|97075_97639_-|helix-turn-helix-transcriptional-regulator
MNISSQIRKYRNQLEYSQEELAHKLYVSRQTISNWENGHSYPDIQTLLMLSVLFDVSLDTLVKGDIEIMKTEISGQNKNMNRWAWVMVLSYFGASVLVGPILNFMNIWWMILPGIIMAVATYAAHKVEQIKKIYNLDTYEKIVAFSEGRSTEKLRAGKSWKDIMSLVGVPAAFILIMLISSYVFSLI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011366_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011366_2

545971-546078

Orphan

Consensus_repeat	Method
CAAAGGGGTTATCTGTCCTTCGCGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011366_2

>merge|NZ_CP011366|2|545971-546078|CRISPRCasFinder
CAAAGGGGTTATCTGTCCTTCGCGGATATCGCGACGTCCAGCAAAGGGGTTATCTGTCCTTCGCGGATATCACGACGTCCATCAAAGGGATTATCTGTCCTTCGCGGA

>NZ_CP011366|2|2|545971-546078|CRISPRCasFinder
CAAAGGGGTTATCTGTCCTTCGCGGA	TATCGCGACGTCCAGCAAAGGGGTTATCTGTCCTTCGCGGATATCACGACGTCCAT
CAAAGGGATTATCTGTCCTTCGCGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011366.1\|WP_046789425.1\|539922_540927_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|273675
NZ_CP011366.1\|WP_046789433.1\|549599_550064_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|376590
NZ_CP011366.1\|WP_046789428.1\|543006_544533_+\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
NZ_CP011366.1\|WP_046789435.1\|551630_551975_-\|DUF488-family-protein	unknown	unknown	gnl\|CDD\|225730
NZ_CP011366.1\|WP_046791411.1\|552942_553260_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP011366.1\|WP_046789421.1\|536344_536941_-\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	unknown	unknown	gnl\|CDD\|178955
NZ_CP011366.1\|WP_046789432.1\|547271_549593_+\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NZ_CP011366.1\|WP_046789431.1\|546511_547255_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224561
NZ_CP011366.1\|WP_046789427.1\|542254_543010_+\|triose-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234589
NZ_CP011366.1\|WP_046789426.1\|541030_542218_+\|phosphoglycerate-kinase	unknown	unknown	gnl\|CDD\|234613
NZ_CP011366.1\|WP_046789434.1\|550664_551528_+\|cation-transporter	unknown	unknown	gnl\|CDD\|223131
NZ_CP011366.1\|WP_046789424.1\|538871_539891_+\|HTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|225263
NZ_CP011366.1\|WP_046789430.1\|546188_546419_+\|preprotein-translocase-subunit-SecG	unknown	unknown	gnl\|CDD\|224233
NZ_CP011366.1\|WP_046789423.1\|538480_538741_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|368604
NZ_CP011366.1\|WP_046789436.1\|552116_552869_+\|type-I-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|235036
NZ_CP011366.1\|WP_082103631.1\|537227_538013_+\|threonine/serine-exporter-family-protein	unknown	unknown	gnl\|CDD\|377697
NZ_CP011366.1\|WP_046789438.1\|553838_554219_+\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP011366.1\|WP_046789422.1\|538025_538478_+\|threonine/serine-exporter	unknown	unknown	gnl\|CDD\|378960
NZ_CP011366.1\|WP_046789437.1\|553414_553771_+\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP011366.1\|WP_046789429.1\|544600_545902_+\|phosphopyruvate-hydratase	unknown	unknown	gnl\|CDD\|234617

Protein	Function_ID	Function_description	E-value
NZ_CP011366.1\|WP_046789425.1\|539922_540927_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|273675	TIGR01534, Glyceraldehyde-3-phosphate_dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, type I. This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis].	6.07361e-174
NZ_CP011366.1\|WP_046789433.1\|549599_550064_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	4.59167e-83
NZ_CP011366.1\|WP_046789428.1\|543006_544533_+\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
NZ_CP011366.1\|WP_046789435.1\|551630_551975_-\|DUF488-family-protein	gnl\|CDD\|225730	COG3189, COG3189, Uncharacterized conserved protein [Function unknown].	4.0712e-45
NZ_CP011366.1\|WP_046791411.1\|552942_553260_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	5.34858e-24
NZ_CP011366.1\|WP_046789421.1\|536344_536941_-\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	gnl\|CDD\|178955	PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed.	3.12924e-149
NZ_CP011366.1\|WP_046789432.1\|547271_549593_+\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NZ_CP011366.1\|WP_046789431.1\|546511_547255_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|224561	COG1647, COG1647, Esterase/lipase [General function prediction only].	5.58853e-97
NZ_CP011366.1\|WP_046789427.1\|542254_543010_+\|triose-phosphate-isomerase	gnl\|CDD\|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	1.3116e-141
NZ_CP011366.1\|WP_046789426.1\|541030_542218_+\|phosphoglycerate-kinase	gnl\|CDD\|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
NZ_CP011366.1\|WP_046789434.1\|550664_551528_+\|cation-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	1.61231e-94
NZ_CP011366.1\|WP_046789424.1\|538871_539891_+\|HTH-domain-containing-protein	gnl\|CDD\|225263	COG2390, DeoR, Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription].	1.10073e-60
NZ_CP011366.1\|WP_046789430.1\|546188_546419_+\|preprotein-translocase-subunit-SecG	gnl\|CDD\|224233	COG1314, SecG, Preprotein translocase subunit SecG [Intracellular trafficking and secretion].	1.13047e-12
NZ_CP011366.1\|WP_046789423.1\|538480_538741_+\|thioredoxin-family-protein	gnl\|CDD\|368604	pfam05768, DUF836, Glutaredoxin-like domain (DUF836). These proteins are related to the pfam00462 family.	4.92555e-06
NZ_CP011366.1\|WP_046789436.1\|552116_552869_+\|type-I-3-dehydroquinate-dehydratase	gnl\|CDD\|235036	PRK02412, aroD, type I 3-dehydroquinate dehydratase.	1.2706e-72
NZ_CP011366.1\|WP_082103631.1\|537227_538013_+\|threonine/serine-exporter-family-protein	gnl\|CDD\|377697	pfam06738, ThrE, Putative threonine/serine exporter. ThrE is a family of bacterial and Archaeal proteins that catalyze the export of L-threonine from the cell. UniProtKB:Q79VD1 has been characterized as being necessary for this export. The domain exhibits 10 putative TMs and catalyzes the proton-motive-force-dependent efflux of threonine and serine.	7.30541e-66
NZ_CP011366.1\|WP_046789438.1\|553838_554219_+\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	2.02109e-69
NZ_CP011366.1\|WP_046789422.1\|538025_538478_+\|threonine/serine-exporter	gnl\|CDD\|378960	pfam12821, ThrE_2, Threonine/Serine exporter, ThrE. ThrE_2 is a family of membrane proteins involved in the export of threonine and serine. L-threonine, L-serine are both substrates for the exporter. The exporter exhibits nine-ten predicted transmembrane-spanning helices with long charged C and N termini and an amphipathic helix present within the N-terminus. L-Threonine can be made by the amino acid-producing bacterium Corynebacterium glutamicum, but the potential for amino acid formation can be considerably improved by reducing its intracellular degradation into glycine and increasing its export by this exporter. Members of the family are found in Bacteria, Archaea, and the fungal kingdoms, and the family can exist either as a single long polypeptide chain or as two short polypeptides. All family members show an extended hydrophilic N-terminal domain with weak sequence similarity to portions of hydrolases (proteases, peptidases, and glycosidases); this suggests that since this region is cytoplasmic to the membrane it may be generating the transport substrate, so may imply that threonine may not be the primary substrate and the ThrE has a subsidiary function.	1.91987e-35
NZ_CP011366.1\|WP_046789437.1\|553414_553771_+\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	4.17266e-44
NZ_CP011366.1\|WP_046789429.1\|544600_545902_+\|phosphopyruvate-hydratase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0

>NZ_CP011366.1|WP_046789429.1|544600_545902_+|phosphopyruvate-hydratase
MPLITDVYAREVLDSRGNPTIEVEVLTESGAFGRALVPSGASTGEYEAVELRDGDDTRYLGKGVEKAVENVNEKIGPELVDGDFSVLEQVSIDKMMIALDGTDNKGELGANAILGVSMAVAKAAADFLGMPLYKYLGGFNAVQLPVPMMNIINGGEHADNNVDIQEFMIMPVGAESFKEALRMGAEIFHNLKKVLNEKGYNTGVGDEGGFAPNLGSNEEALSTIIEAVEKAGYKPGEQIRLAMDAASSEFYDKDTDKYELKGEGKSYSSEEMVNWYAEMIEKYPIISIEDGLDENDWEGTRLLTEKLGSKVQLVGDDLFVTNTAKLAHAIEEGVGNSILIKVNQIGTLTETFEAIEMAKRAGYTAVISHRSGETEDTTIADIAVAVNAGQIKTGAPSRTDRVAKYNQLLRIEDELFETAKYDGLSSFYNLDEK
>NZ_CP011366.1|WP_046789428.1|543006_544533_+|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MTGPVGLIILDGFANRDEVKGNAVKAADKPNFDRFFNKYPHNELSACGLDVGLPEGQMGNSEVGHLNIGAGRVVYQSLTRINKSIEDGDFFENDTLLNAMDHVNANDSALHVMGLLSDGGVHSHYEHMFAILKMAKEKGLKNVYVHAFLDGRDVNQESALNYVKESEKRFAEIGIGEFATVSGRYYAMDRDQRWDRQEAAYQTISNGVGTRFKTAEEGIQASYDEGISDEFVKPFVVFGHDDDYDHGVMNNDAVIFYNFRPDRAAQLSEVYTNEEFMGFEIDKKYSDLKFVTFTKYSDNVRADVVFEKEDIVNTIGEVAAKAGKKQLRIAETEKYPHVTYFMSGGRHKEFDGERRALIDSPKVPTYDLKPEMSAYEVRDRCMEELSKKDLDLILLNFANPDMVGHSGKLEPTVKAIEAVDECLGPIVDEIIAQGGTAIITADHGNSDEVTSMDGDPMTAHTTNPVPVIVTKEGADVRDGGKLADLAPTLLDLMGVEKPEEMTGESLIR
>NZ_CP011366.1|WP_046789427.1|542254_543010_+|triose-phosphate-isomerase
MRTPFIAGNWKMNKTVSEGDAFIDALGSLPKKDEVESAICAPFIHLPSLVAKTKDSELGIGAENSHFEDSGAFTGEVSPAMLEDLGVAYVIVGHSERREHFAETDETVNKKAHALHAKGLVPIICCGETDEEREGGEAESRVKDQVTKALDGLSPDQVKTSVIAYEPIWAIGTGKSATSDDANEMCGVIRNTVASLYDEETSEAIRIQYGGSVKPANIEEYMAQEHIDGALVGGASLEPESFTALLEGAKK
>NZ_CP011366.1|WP_046789426.1|541030_542218_+|phosphoglycerate-kinase
MKKTVEDVELKGKKVLLRADLNVPMSDGTITNDNRIVQALPTIEYVLDQGGRVILFSHLGKVKSEEDKKELTLQPVAESLSEKLGKEVVFVPHTRGEELEQAVDALKDGEILLFENTRFEDLDGKKESGNDEELGRYWASLGDIFVNDAFGTAHRSHASNVGVGSNIETVSGYLMQKEIDFVGGAIDAPERPFVAILGGAKVSDKIGVIENVLSKADKVIIGGGMAYTFLKSQGKEIGKSLLEEDKVELAGSLLEKAGDKIVLPVDVVAADDFAEDAAHETVSVDEIPADKECLDIGEGSIKRFKEVLDGAKTVVWNGPMGVFEMEAFAKGTIGVCKAIAELEDATTIIGGGDSAAAAMDLGYADDFSHISTGGGASLEYLEGKELPGLTVIDDK
>NZ_CP011366.1|WP_046789425.1|539922_540927_+|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MMVRVAINGFGRIGRLAARVIQNYDDIQVVAVNDLTDDDFLAHLMKYDTTQGRFEGELEQIEGGFKINGQEVKSFNQKDPAQLPWGDLDIDIVLECTGFFTDEEGARKHIEAGAKKVLVSAPGKGNMKTIVFGVNEDVLDGSEEIVSAASCTTNCLAPVVKVLNDKFGLNHGLMTTIHAYTGDQNTLDAPHPKGDYRRARAAAMNIVPNSTGAAKAIGQVIPELDGKLDGGAQRVPVATGSLTEVTAVLDKNVTVDEVNEAMKAANNPSFGYNEDEIVSADIIGITQGSLFDATQTRVMDVDGKQLVRAVAWYDNEMSYTSQLVRTLHHMVTSK
>NZ_CP011366.1|WP_046789424.1|538871_539891_+|HTH-domain-containing-protein
MWQRLLDIQRRIAPEAIDELLKRFELLKRIEANQPIGRRTLAKKLELSERILRREVDRLQSLGLILIDKRGIAVSPAGIEVMEELSPYITTIDRRSDLARGLREKFGLKDFFIVRGDADGNPELQKELSKRMAEELQKMFFNGAVISVAGGSTMANVGNYLKPTEQELLFVPARGGLGEEVGNQANSIASRLAVATGSAHKVLYAPDNVGESVLESLKLEPAVKEVAKLNQASDFVIHGIGEAFTMARRRNVGQDVLEQLEQKGAVGETFGYYFDADGDILRKVKTIGLQLEDLESKQAVFAVAGGSSKKEAVRAYMKIAPKNTLLFIDETIAEYLLNS
>NZ_CP011366.1|WP_046789423.1|538480_538741_+|thioredoxin-family-protein
MLELVYYTRKNCKLCEDGREQIKLALSELRYNKVKLTPVDIDEDDALQEEYMVRVPVLVHEEEVVQEGLIDFVQVYDYLKEYLGKR
>NZ_CP011366.1|WP_046789422.1|538025_538478_+|threonine/serine-exporter
MIYVYQLIASFFASAGFGILFNAPRRALISCGVNGALGWLVFYLFREGGTDPVLASYAGAILLTAMALFNSRRMKMPVIIFITCGIIPLVPGGTAYEAMRHVVMDQYMEAQGFAFEAALVSGAIALGIISTEMADSVIQSIKKKFNEKEA
>NZ_CP011366.1|WP_082103631.1|537227_538013_+|threonine/serine-exporter-family-protein
MSGELEIIEAPDKVYSDDFVRDVFYIAINSGKILLENGAETYRIEDTMARIASSYGIENAQVFVTPTVIIFSMNDYALTQTVRIEERANNLEKVAGINNLSRRISEGLPLKRAINQLETIHEARMFPFWLVILSGGVIGVMFLYLFEGVFVDLPAAFIGGAGGVLILEGILRYTKLKFFIEFFAALFIGIVGIVYVEYGPGQMLDTIVIASVMPLVPGVLITNAIREMLRGHLLAGIVKGAEAALTAIAIGAGVGLVFMLS
>NZ_CP011366.1|WP_046789421.1|536344_536941_-|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMIGTGIDDNVANSVVSQLLFLQAQDAEKDIYLYINSPGGSVTAGMAIYDTIQHIKPDVQTICLGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAAKHILRTREKLNKILAERTGQPYDKIEKDTDRDNFMTAEEAKEYGLVDEVMEPEKLDNK
>NZ_CP011366.1|WP_046789430.1|546188_546419_+|preprotein-translocase-subunit-SecG
MQTLLVVLLIIVCISLIAVVLLQSGKSAGLSGAIGGGAEQLFGKQKARGMDLVLHRATVILSLLFFMIMLLLTYLG
>NZ_CP011366.1|WP_046789431.1|546511_547255_+|alpha/beta-fold-hydrolase
MKIQLPKPFFFEEGEKAVLLLHGFTGNSSDVRQLGRYLQKQGITSYAPHYEGHAEPPENLLQSSPHVWWSQVLEAYDFLKEKGYEKIFVAGLSLGGVYALRLAAERDVIGVSTICSPMYLKDRETMYEGVLEYARGFKEMEGKGAETIEREMSRFEPTGMLDEIRDMISLVNGKLDDVFDPIFVAQSEKDEMINPDSANIIYDETSTDEDEKKLKWYPESGHVLTIDVEKKELFEDLHHFINQLDWN
>NZ_CP011366.1|WP_046789432.1|547271_549593_+|ribonuclease-R
MGSYREKILEIIQSGDYKPMTMDDFQKELSAYDSDDFKEMVKDMVSLEETGEVFRTKKDKYMKTSETNLVKGKLSMHKRGFGFLRPEDSELEDVFIPPNEINGALDGDTVLVEVHKSTRAGDDSDKQEGSVSSILTRGITRVVGEYKPSKNFGFVVPDSKKIIDDIFIPKNQNLGAVDGHKVLVEITKYREGEDNPEGHVIQILGHKNDPGVDILSIIFQHGIEIEFPEEVLKEAEHVPETIEPAELEGRTDLRDEFTITIDGADAKDLDDAVAVKKLGNGNHELTVSIADVSYYVKEDSALDMEAYDRATSVYLVDRVIPMIPHRLSNGICSLNPDVDRLTMSCRMEIDSSGKVVSHDVFQSVIHSDRRMTYDAVNKILVDGDQALISEFSDVYPMLQDAEDLAQILRNRREARGAIDFDFNEAQVLVNEDGSASDIVLRTRSVGEKMIEEFMLAANETVAEHFHWMEVPFLYRVHEDPKEEKLRQFFEFITNFGIVVKGKGNEIHPRALQEIIEEVEGRPEEMVISTLMLRSMQQARYSEENLGHFGLSAEFYTHFTSPIRRYPDLIVHRLIRKYLIEGRTDRKTVDKMAEFLPDAAEHTSDRERRAQDAERDTDDLKKAEYMLEHIGETFEGVISGVMNFGMFVELPNTIEGLVHVSNMTDDHYQYHERHLAIIGDRTGKVYRIGDPVEIEVKDVNLAEKLIDFKVVGMPERAPRQRRDRPVEIKAKTKSEGKGKGSKQDSKKHFDKGKSNKKPFYKGAKHAAKKRKGKK
>NZ_CP011366.1|WP_046789433.1|549599_550064_+|SsrA-binding-protein-SmpB
MKKTHDKPLAQNRKASHDYTIEETVEAGIELKGTEIKSIRRGSANLKDAYARVYRGEMYVYNMHIAPYEEGNRFNHDPLRTRKLLLKRKQIDKLYGISKETGYALIPLKLYIKNGFCKVLLGVAKGKKKYDKRESLKQKQMKRDIDRAIKDRMQ
>NZ_CP011366.1|WP_046789434.1|550664_551528_+|cation-transporter
MESNLKRAQKGAYLSLITYIILSIAKFTAGVQFNSAALRADAFNNMTDILVSIAVLVGLKISLKPADKNHPYGHMKSENISTLLVSFIIMFVGLQVIMDNFPKLTEGDYTTPNPLTLWISFISGFIMLMVYFYNNSLAKKTKSSSLKSAAVDNLSDGLVSFGTGFGLIFTQIGFPIADPILAVILGLLIVYTGFKICREAIFTLSDGFHEKDLEFYVNDVMRVDGVKGVSSVKGRYHGDSVFLDVTIFVDKTITLDEAHDICDQVEKSLSEEGVYSSYVHPEPYEED
>NZ_CP011366.1|WP_046789435.1|551630_551975_-|DUF488-family-protein
MLKIKRVYDDESQQDGKRYLVDGVWPRGVKKEDLNHDEWYKELSPSSDLRKWFDHDADKWDEFRKKYFKELDAHKELLKEIKKDSDGHNVTLLYGAKDEKHNQAVAIKEYIEKM
>NZ_CP011366.1|WP_046789436.1|552116_552869_+|type-I-3-dehydroquinate-dehydratase
MKIKNVTIGEGQPKVVVSFTGHSAEEVQAEIEEAKKNNDKFDIVEIRSDSFDAMNHEDHFRLVDNIIEEMADCPIIYTYRTNGEGGSGTKSAAEYQSLVSHAIGNCDIDIVDIEFFMYEDIVNQLIDEAKEKGVAVLLSQHDFRDTPHFEEMMATYENMYERGGDILKLAYQPAGGRDVLSVLSAVHDARRKFNCQVVGISMGETGKITRVAGGVFGSCMTYGHLVNQAAPGQIGAGILKEYLNIFEEDR
>NZ_CP011366.1|WP_046791411.1|552942_553260_-|thioredoxin-family-protein
MEPITEYEDFKAKTQSDDKIIVKFFAGWCPDCTAMNMFIDPIMEEYNTVDWYELNRDDIPEAAEENDVMGIPSLLVFQNGEKLAHLHSANAKTPESVTEFLKENV
>NZ_CP011366.1|WP_046789437.1|553414_553771_+|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein
MITLYEYPKCTTCRKGRKFLEENDVEFQAHDMVKVPPSEETLKEIISKSDREIDDFFNKRGKNFKELDLKNRLSAMSDEEKIETLSGDGMLIRRPLAYDGQQVLLGFKADDWQKAFLG
>NZ_CP011366.1|WP_046789438.1|553838_554219_+|glycine-cleavage-system-protein-GcvH
MSTPKDLKYSEDHEWVKQEDGKVRLGITEFAQSELGDIVFVELPSEGDEITKGESFGSVESVKTVSELYAPLSGTVVEINEELEDSPELVNESPYEGAWMVVIELSDESQLDSLMDADAYDEMVDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

485660 : 499150

uncultured_Caudovirales_phage(44.44%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046789379.1\|485660_487451_+	DNA helicase RecQ	G5CQD7	Megavirus	5.0e-77	35.4
WP_046789380.1\|487505_488360_-	DMT family transporter	NA	NA	NA	NA
WP_046789381.1\|488721_489129_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	1.1e-32	53.3
WP_046789382.1\|489091_491197_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A2H4J2N6	uncultured_Caudovirales_phage	0.0e+00	77.6
WP_046789383.1\|491229_492204_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A2H4J4P3	uncultured_Caudovirales_phage	1.3e-148	78.3
WP_052749807.1\|492641_493664_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.6e-67	40.0
WP_046789385.1\|493669_494275_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.2e-34	41.0
WP_046789386.1\|494267_495440_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.1e-124	56.8
WP_046789387.1\|495454_495922_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.8e-42	65.3
WP_046789388.1\|496825_497242_+	FixH family protein	NA	NA	NA	NA
WP_046789389.1\|497345_498023_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_046789390.1\|498181_499150_+	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.6e-96	56.4

DBSCAN-SWA_2

1007050 : 1016901

Synechococcus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046789817.1\|1007050_1007533_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.2e-20	42.7
WP_046789818.1\|1007519_1008644_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_143544880.1\|1008643_1009345_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.5e-40	41.0
WP_046789820.1\|1009344_1009602_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_046789821.1\|1009601_1010270_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_046789822.1\|1010262_1012443_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.0e-136	39.6
WP_046789823.1\|1012421_1013840_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.5e-52	34.1
WP_046789824.1\|1013841_1014864_+	phosphoribosylformylglycinamidine cyclo-ligase	M4QRQ6	Synechococcus_phage	8.1e-64	43.1
WP_046789825.1\|1014853_1015423_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	8.9e-28	41.9
WP_046789826.1\|1015422_1016901_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.2e-72	48.5

DBSCAN-SWA_3

1285406 : 1300901

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046790074.1\|1285406_1286426_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.6e-09	28.7
WP_046790075.1\|1286429_1287464_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_046790076.1\|1287463_1288609_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	8.4e-86	45.9
WP_046790077.1\|1288630_1288894_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_074924527.1\|1288998_1291278_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.6e-27	33.2
WP_046790079.1\|1291326_1293570_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	5.7e-70	29.9
WP_046790080.1\|1293582_1294101_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	4.7e-28	42.4
WP_046790081.1\|1294208_1296386_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	5.3e-12	40.4
WP_046790082.1\|1296395_1296848_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_046790083.1\|1296847_1297570_+	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	5.4e-06	33.6
WP_046790084.1\|1297878_1299141_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_046790085.1\|1299143_1300901_+\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	2.7e-22	24.0

DBSCAN-SWA_4

1805170 : 1838595

Staphylococcus_phage(33.33%)

portal,capsid,protease,terminase,integrase

attL 1797794:1797813|attR 1838649:1838668

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1797794:1797813	attL	NA	NA	NA	NA
WP_046790538.1\|1805170_1807018_-	hypothetical protein	A0A0U2A0V1	Staphylococcus_phage	5.8e-60	32.5
WP_046790539.1\|1807091_1807313_-	hypothetical protein	A0A2I7RDL3	Vibrio_phage	6.9e-05	34.6
WP_046790540.1\|1807330_1808170_-	hypothetical protein	NA	NA	NA	NA
WP_046790541.1\|1808162_1811912_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1W6JPL0	Staphylococcus_phage	3.1e-68	36.3
WP_046790542.1\|1812136_1812487_-	hypothetical protein	A0A2H4JH57	uncultured_Caudovirales_phage	2.7e-27	50.8
WP_046790543.1\|1812506_1812707_-	hypothetical protein	NA	NA	NA	NA
WP_046790544.1\|1812736_1813645_-	hypothetical protein	A0A0P0IJL6	Lactobacillus_phage	1.9e-85	53.1
WP_046790545.1\|1813644_1814277_-	hypothetical protein	A0A2H4J4E0	uncultured_Caudovirales_phage	7.5e-52	53.0
WP_046790546.1\|1814295_1814703_-	hypothetical protein	G4KNQ6	Staphylococcus_phage	3.7e-20	38.1
WP_046790547.1\|1814704_1815097_-	hypothetical protein	A0A2H4JF04	uncultured_Caudovirales_phage	6.5e-30	50.8
WP_052749874.1\|1815080_1815452_-	hypothetical protein	NA	NA	NA	NA
WP_046790549.1\|1815420_1815723_-	hypothetical protein	A0A2H4J447	uncultured_Caudovirales_phage	5.7e-18	52.2
WP_046790550.1\|1815731_1816055_-	hypothetical protein	NA	NA	NA	NA
WP_046790551.1\|1816097_1817318_-\|capsid	phage major capsid protein	Q4ZD74	Staphylococcus_phage	6.6e-89	47.2
WP_046790552.1\|1817341_1818106_-\|protease	Clp protease ClpP	A0A2H4J8Y7	uncultured_Caudovirales_phage	8.8e-55	50.6
WP_046790553.1\|1818102_1819242_-\|portal	phage portal protein	A0A059T6F0	Listeria_phage	7.6e-95	46.2
WP_046790554.1\|1819257_1820946_-\|terminase	terminase large subunit	A0A2H4JDH7	uncultured_Caudovirales_phage	2.5e-171	51.6
WP_052749875.1\|1820942_1821278_-	hypothetical protein	D2XR14	Bacillus_phage	5.2e-12	41.7
WP_046790555.1\|1821427_1821739_-	HNH endonuclease	A8ATF8	Listeria_phage	5.0e-33	69.6
WP_046790556.1\|1821982_1822417_-	hypothetical protein	A0A2H4JC92	uncultured_Caudovirales_phage	8.0e-37	61.1
WP_046790557.1\|1822556_1822961_-	hypothetical protein	NA	NA	NA	NA
WP_046790558.1\|1822963_1823410_-	DUF1064 domain-containing protein	A0A0A7RTV9	Clostridium_phage	6.5e-26	46.4
WP_046790559.1\|1823409_1823709_-	hypothetical protein	D2IZY1	Enterococcus_phage	2.8e-33	73.7
WP_158462232.1\|1823696_1823867_-	hypothetical protein	NA	NA	NA	NA
WP_046790560.1\|1823880_1824090_-	hypothetical protein	NA	NA	NA	NA
WP_046790561.1\|1824082_1824754_-	hypothetical protein	NA	NA	NA	NA
WP_158462233.1\|1824765_1824936_-	hypothetical protein	NA	NA	NA	NA
WP_046790562.1\|1824932_1825250_-	hypothetical protein	NA	NA	NA	NA
WP_046790563.1\|1825261_1826539_-	hypothetical protein	H9A0S1	Staphylococcus_phage	1.4e-68	40.7
WP_046790564.1\|1826513_1826885_-	hypothetical protein	NA	NA	NA	NA
WP_052749876.1\|1826881_1827730_-	DnaD domain protein	A6M985	Geobacillus_virus	2.9e-43	45.4
WP_046790565.1\|1827737_1827983_-	hypothetical protein	NA	NA	NA	NA
WP_046790566.1\|1827963_1828245_-	hypothetical protein	NA	NA	NA	NA
WP_046790567.1\|1828392_1828620_-	hypothetical protein	NA	NA	NA	NA
WP_046790568.1\|1828622_1828835_-	hypothetical protein	NA	NA	NA	NA
WP_046790570.1\|1829039_1829246_-	hypothetical protein	NA	NA	NA	NA
WP_046790571.1\|1829246_1829432_-	hypothetical protein	Q77PS1	Streptococcus_phage	2.6e-05	48.9
WP_052749934.1\|1829432_1830068_-	hypothetical protein	A0A1Q1PVV0	Staphylococcus_phage	1.6e-57	51.8
WP_046790572.1\|1830148_1831075_-	recombinase	A0A1Q1PVZ0	Staphylococcus_phage	1.2e-106	73.7
WP_046790573.1\|1831074_1831290_-	hypothetical protein	NA	NA	NA	NA
WP_046791520.1\|1831293_1831506_-	helix-turn-helix transcriptional regulator	A0A2H4J5M4	uncultured_Caudovirales_phage	2.1e-06	43.5
WP_052749878.1\|1831679_1833635_-	AAA family ATPase	A0A2H4J753	uncultured_Caudovirales_phage	3.0e-115	36.1
WP_046790574.1\|1833709_1833943_-	hypothetical protein	NA	NA	NA	NA
WP_046790575.1\|1833948_1834161_-	hypothetical protein	NA	NA	NA	NA
WP_158462234.1\|1834144_1834321_-	hypothetical protein	NA	NA	NA	NA
WP_046790576.1\|1834321_1834546_-	hypothetical protein	NA	NA	NA	NA
WP_046790577.1\|1834545_1834788_-	hypothetical protein	NA	NA	NA	NA
WP_046790578.1\|1834784_1835126_-	hypothetical protein	A0A0M7RFF0	Escherichia_phage	3.2e-09	41.2
WP_046790579.1\|1835122_1835305_-	hypothetical protein	NA	NA	NA	NA
WP_046790580.1\|1835308_1835584_-	hypothetical protein	NA	NA	NA	NA
WP_052749879.1\|1835584_1836523_-	helix-turn-helix domain-containing protein	R9ZYD0	Cellulophaga_phage	4.4e-16	69.5
WP_046790581.1\|1836524_1836773_-	helix-turn-helix transcriptional regulator	Q4ZBN5	Staphylococcus_phage	4.3e-19	54.9
WP_143544957.1\|1836956_1837556_+	helix-turn-helix domain-containing protein	A0A1Q1PVT4	Staphylococcus_phage	4.9e-53	52.3
WP_046790583.1\|1837569_1838595_+\|integrase	site-specific integrase	W5R968	Staphylococcus_phage	4.0e-63	39.5
1838649:1838668	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011366

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection