CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP011479	Hoeflea sp. IMCC20628, complete genome	1 crisprs	csa3,DEDDh,WYL,cas3,RT,PrimPol	8
NZ_CP011480	Hoeflea sp. IMCC20628 plasmid, complete sequence	0 crisprs	csa3	12
NZ_CP011481	Hoeflea sp. IMCC20628 plasmid, complete sequence	0 crisprs	DEDDh	9

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011479_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011479_1

4748940-4749040

Orphan

Consensus_repeat	Method
CGTCGCCACATAAGTTCGGATTC	CRISPRCasFinder

1 spacers

PrimPol,DEDDh

The CRISPR arrays of NZ_CP011479_1

>merge|NZ_CP011479|1|4748940-4749040|CRISPRCasFinder
CGTCGCCACATAAGTTCGGATTCGGCTTCGTTGATTTCATTGGCAAAAATCGGCGTCGCCACTTTTCGTATTCGGACTCGTCGCCACACAAGTTCGGATTC

>NZ_CP011479|1|1|4748940-4749040|CRISPRCasFinder
CGTCGCCACATAAGTTCGGATTC	GGCTTCGTTGATTTCATTGGCAAAAATCGGCGTCGCCACTTTTCGTATTCGGACT
CGTCGCCACACAAGTTCGGATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011479.1\|WP_052766591.1\|4760258_4761257_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011479.1\|WP_047032035.1\|4745670_4746555_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP011479.1\|WP_047032034.1\|4744416_4745628_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|235472
NZ_CP011479.1\|WP_047032032.1\|4741165_4743514_+\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
NZ_CP011479.1\|WP_156174618.1\|4759643_4760249_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011479.1\|WP_156174614.1\|4740972_4741128_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011479.1\|WP_047028619.1\|4754673_4755951_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP011479.1\|WP_047032033.1\|4743532_4744333_+\|xanthine-dehydrogenase-family-protein-subunit-M	unknown	unknown	gnl\|CDD\|224238
NZ_CP011479.1\|WP_156174616.1\|4754117_4754621_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011479.1\|WP_156174615.1\|4749198_4750551_+\|hypothetical-protein	PrimPol	COG4951_PrimPol_CAS-I:CAS-III	gnl\|CDD\|227287
NZ_CP011479.1\|WP_047032037.1\|4747687_4748908_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_CP011479.1\|WP_047032029.1\|4738153_4738684_-\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|377284
NZ_CP011479.1\|WP_047032042.1\|4756371_4756893_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011479.1\|WP_156174617.1\|4758315_4759125_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011479.1\|WP_082128373.1\|4757062_4757620_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|335247
NZ_CP011479.1\|WP_047032039.1\|4752830_4753709_+\|hypothetical-protein	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|99834
NZ_CP011479.1\|WP_047032031.1\|4740487_4740979_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|224991
NZ_CP011479.1\|WP_156174386.1\|4750607_4751746_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP011479.1\|WP_047032036.1\|4746729_4747491_-\|SapC-family-protein	unknown	unknown	gnl\|CDD\|377801
NZ_CP011479.1\|WP_047032030.1\|4738962_4740012_-\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270383

Protein	Function_ID	Function_description	E-value
NZ_CP011479.1\|WP_047032035.1\|4745670_4746555_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	2.69932e-91
NZ_CP011479.1\|WP_047032034.1\|4744416_4745628_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|235472	PRK05447, PRK05447, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NZ_CP011479.1\|WP_047032032.1\|4741165_4743514_+\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	0
NZ_CP011479.1\|WP_047028619.1\|4754673_4755951_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	9.33934e-27
NZ_CP011479.1\|WP_047032033.1\|4743532_4744333_+\|xanthine-dehydrogenase-family-protein-subunit-M	gnl\|CDD\|224238	COG1319, CoxM, Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion].	2.94755e-83
NZ_CP011479.1\|WP_156174615.1\|4749198_4750551_+\|hypothetical-protein	gnl\|CDD\|227287	COG4951, COG4951, Uncharacterized protein conserved in bacteria [Function unknown].	1.43203e-89
NZ_CP011479.1\|WP_047032037.1\|4747687_4748908_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.68813e-58
NZ_CP011479.1\|WP_047032029.1\|4738153_4738684_-\|TRAP-transporter-small-permease	gnl\|CDD\|377284	pfam04290, DctQ, Tripartite ATP-independent periplasmic transporters, DctQ component. The function of the members of this family is unknown, but DctQ homologs are invariably found in the tripartite ATP-independent periplasmic transporters.	1.76372e-08
NZ_CP011479.1\|WP_082128373.1\|4757062_4757620_-\|hypothetical-protein	gnl\|CDD\|335247	pfam03167, UDG, Uracil DNA glycosylase superfamily.	0.000567082
NZ_CP011479.1\|WP_047032039.1\|4752830_4753709_+\|hypothetical-protein	gnl\|CDD\|99834	cd06130, DNA_pol_III_epsilon_like, an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III. This subfamily is composed of uncharacterized bacterial proteins with similarity to the epsilon subunit of DNA polymerase III (Pol III), a multisubunit polymerase which is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. The Pol III holoenzyme is a complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of Pol III also functions as a stabilizer of the holoenzyme complex.	2.30955e-52
NZ_CP011479.1\|WP_047032031.1\|4740487_4740979_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|224991	COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion].	6.59961e-77
NZ_CP011479.1\|WP_156174386.1\|4750607_4751746_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.70249e-65
NZ_CP011479.1\|WP_047032036.1\|4746729_4747491_-\|SapC-family-protein	gnl\|CDD\|377801	pfam07277, SapC, SapC. This family contains a number of bacterial SapC proteins approximately 250 residues long. In Campylobacter fetus, SapC forms part of a paracrystalline surface layer (S-layer) that confers serum resistance.	2.77163e-75
NZ_CP011479.1\|WP_047032030.1\|4738962_4740012_-\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270383	cd13665, PBP2_TRAP_Dctp3_4, Periplasmic substrate-binding component of TRAP-type C4-dicarboxylate transport system DctP3 and DctP4; the type 2 periplasmic-binding protein fold. This group includes uncharacterized DctP3 and DctP 4 subfamilies of TRAP Transporters specific to C4-dicarboxylates such as succinate, malate and fumarate. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. This CD also included some eukaryotic homologs that have not been functionally characterized. TRAP transporters are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.95926e-134

>NZ_CP011479.1|WP_047032037.1|4747687_4748908_+|MFS-transporter
MCESDILDSRYSWMRLAATLAIAVLGNVGMWAIIVIMPAVQSEFGIDRADASLPYTLTMVGFALGNLVIGRAVDRYGVTVALIGSAIAMATGFALAAVSNSIVMLSAMQFIIGFGSAAGFGPLIADISHWFHRRRGIAVAITASGNYLSGAIWPLLLSGVLTDYGWRTAYVILAIVPVALIIPLTFLLRRRVPDDATAHANRLSLANAQSVSFSPTSLQWMLVLAGIGCCVAMSMPQVHIVSYCTDLGYGPTVGAEMLSLMLMGGVVSRLISGLIADRLGGVKTLLIGSTLQCIALFLYLPFDAMVPLYVVSLIFGLSQGGIVPSYALIVREYLPAREAGARVGFVIMATIIGMALGGWMSGWIYDLTGSYRAAFLNGIAWNFLNIAIMVLLLFKSRARRGQAVPA
>NZ_CP011479.1|WP_047032036.1|4746729_4747491_-|SapC-family-protein
MAGSTDNSPNTLPLFYKAPEAVSPERHGKNGLALTGDYGFAANAIVIPLMAAEMPAAMRSYPIVFSGPDFMPMVVTGIKEGENLFIDAKGKWAEPHYVPAYVRRYPFILAGGETDERLTLCIENDPARLVSLGAKAKPDVKPLFEDGKQGEVITSALAFCEQYQGMFVKTRQIMKVIAESGLLAERTSKITLGDGQSFNITGFHLVDEAKLLSMSDEDFLKLRKADALATIYCHLASMNSWTSLLHQAGLRKS
>NZ_CP011479.1|WP_047032035.1|4745670_4746555_-|NAD(P)-dependent-oxidoreductase
MTTSIALLGVGLMGLPMARRLLGAGFKLTVWNRDPSKSAPLANESARIAGSAADAVAGATHIITMLTDGATVEHVLFTTGAAKAISPGATLIDMSSIRPSEARSHAARLSKLGIRHLDAPVSGGTKGAEAGTLAIMAGGDQQVFDDAVDLFKAMGRPVRVGPSGSGQLAKLANQAIVGIAIGAVSEATLLVSAGGGDLAAFRTALSGGFADSTILQLHGERMQNGDFESRGRVSVQIKDLNNVLSEAQELGIQLPLVQAIRDRFVRLQDDLDGGNLDHSALFIELLDLNGRTGL
>NZ_CP011479.1|WP_047032034.1|4744416_4745628_-|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MTHAPASLPVSPPQTERRRISILGATGSIGCNTLEVMSHLGGREAFAVPAITGMGNIGLLAQQARQTGAGFAVTADPDRYHELKSALAGTGIEVGAGPAALVEAGERDTDLVMAGIVGIAGLAPTLAAVARGADIGLANKECLVSAGDLFTAAITKGGGKLLPVDSEHNAIFQVLEENQRHAIQRIILTASGGPFRNYTRAQMAAVTPEIAAAHPNYSMGLKISIDSASMFNKALEMIEARHLFGIEPEQIEVIVHPQSIIHSMVGYCDGSVLAQLGVPDMRHAIGYAISHPRRANLPVERLDFAALARLDFSAPDEERFPALTLARTAMQRGGLQGAVLNGAKEAALEAFIAGQIGFLGMADIVAATMDRLDDGRVAQSIEDVYAADKDARAVAASLLRKSA
>NZ_CP011479.1|WP_047032033.1|4743532_4744333_+|xanthine-dehydrogenase-family-protein-subunit-M
MYATNYHRASSVEDAVNLVSANDEAKFLSGGQTLLPTMKQRLAAPSDLVDLRHVAGMKGISVNGSSIRIGAATTHAEVAGSSEIAAACPGLSHLAAHIGDPHVRHMGTIGGSIANNDPAADYPAGLLALNATIVTNTRSISADDFFTGMFDTALDDGELIVAVEITAPAKCGYAKFPNPASRYAMTGVFVARQGDGSVRVAVTGAGSDGVFREADMEQALASNFSAGALDGVTVDPSDLMADIHASSVYRANLVKVMAKRAVTAAG
>NZ_CP011479.1|WP_047032032.1|4741165_4743514_+|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MGLEGIGASVARKEDKRFITGKGRYTDDMVVPGMKHAHFVRSPHAHANIRGIDTSAAMKMPGVIGILAGDELATDGIGSLICGWMIHSKDGSPMNMGDWRPLAQTKVRYVGDAVAVVVADTKAQARDAAEAVVIDYEVLPAVTEAVDALKPGAPLIHDNAPGNLIYDWEIGDGAAVDAAIAGAAHVTRLDLVNNRLVPNAMEPRAALGHYDEGEDHYTCWTTSQNPHVARLVMSAFYNVAPENKLRVIAPDVGGGFGSKIYIYPEEIVCLWASKKTGVPVKWVADRTESFLTDAHGRDHVTTIQMAFDANNKMLAVKADTVANLGAYMSLFSSVVPTFLHAILYSGQYVIPAIHCNMRTVYTNTAPVDAYRGAGRPETTYALERVVETAARELGVSPAELRRQNYIREFPYQTPVILCYDSGDYEASLDAAMAAADYNGFPGRKAEAEARGMKRGIGISSYIEACGIAPSAAVGSLGAGVGLWESAEVRVNAVGTIEVLTGSHSHGQGHETTFAQLVAERFGVGIDSVSIVHGDTDKVQMGMGTYGSRSGAVGMSAVVKALDKVEAKAKKIAAHLMEADEADIVIEGGQVKVAGTDKSLGWHEVSLSAYTAHNLPEGMEPGLKEGAFFDPTNFSFPAGCHICEVEVDPETGKTEIVQFVAADDFGNIINPMVVEGQVHGGVAQGIGQALLEGTHYDPETGQLLTASYMDYTMPRADDLPGYTVSNTVTPATSNPLGIKGCGEAGAIGAPPAVINAITDAIGNNDLTMPATPERVWAALRSAQ
>NZ_CP011479.1|WP_156174614.1|4740972_4741128_-|hypothetical-protein
MGNVWAGSLLSEIEGLETPDFSSRLAVPITDTVSACSKSAAFRHCLFRHAY
>NZ_CP011479.1|WP_047032031.1|4740487_4740979_+|(2Fe-2S)-binding-protein
MTNVSMTVNGRSVSGQCEDRMLLVQFIRENLGLTGTHVGCDTSQCGACVVHVDGKAVKSCTMLAAQADGSEVLTIEGLASGGELHPVQAAFREHHGLQCGFCTPGMIMSAVDMISRHGGKLDEKTVRAELEGNICRCTGYHNIVKAILDAASKMDDGARVAAQ
>NZ_CP011479.1|WP_047032030.1|4738962_4740012_-|TRAP-transporter-substrate-binding-protein
MKKRNFLKSAAVAALALSAVGATSLSAAAQEVTLRMHQFLPAQANVPAELLIPWAEKVGTESGGRIKIEVFSSMSLGGTPPQLMDQARDGVVDIVWTLPGYTPGRFPRAEVFELPFMMTNAEATSRAYWDLFKSDMEAQEFQGIKILATWVHGPGVIHAKGEGVRKLEDMQNKKLRGPTRVINGLLSELGAEPVGMPVPAIPEALSKGVIDGTVIPWEVTPALKIAELVNTHTEFSGDHALYTAAFVLAMNQAKYDSLPDDLKKVLDDNTGADFSAFAGKTQASFDAPGRKIAEATDNEIVVLDAEEVARWGTVAEKVRDNWFAEMKEKGIDGEALYGKAKDLIAKNTM
>NZ_CP011479.1|WP_047032029.1|4738153_4738684_-|TRAP-transporter-small-permease
MFDRIDRLMRTLAAFLAILGGLALIAVILATVMSVSGRALLAFGLSPIRGDFELVELGTGFAVFAFLPWVQINRQHASVEILTMHMGDRINRVIDMIADLLMLSIAVLLAWKHWAGTLDKLAYGETTFIIQYPIWWAYASGLLGAFGFVLISFWCVILSARALMTGQDQAHGEFMH
>NZ_CP011479.1|WP_156174615.1|4749198_4750551_+|hypothetical-protein
MFNPSSMSVTEDGRDELARRLSRLAEIDEERNRLACEIAALSEHRPSKPYPTELQGLPLFSPLAKQRPWVTQHSDSSDKIDLFLDLFTGRRDVYAVRWENSDGSRKGYSFHCANFWKNGCQKKTKGGKCKGCQMREYIPFDGHTVRNHLRGTENDHRDKEFVAGAYALLMDETCRFVVADFDKADYKEDAKAFKVACTASGIPTYLERSRSGNGCHVWVFFTSPVPARHARRMMLATLTKTMEARPDIGFDSYDRLIPNQDKMPKGGLGNLIGLPLQQRSRVDGNSVFVDDEWQPYDDQWAILSGIRRMTPSEVEALSEEGTGAGAVLGLQVPQSEEHADEPWKMKPSRPITSPSAVGLTGKTIKMKLGNQLYIERKDLPSPAAAQFARIGAFQNPKFYSAQAMGLWTGEIPRVISAAEIFPEHIGLPRGCLEEARDLAKLYNAEIDFED
>NZ_CP011479.1|WP_156174386.1|4750607_4751746_+|IS3-family-transposase
MSTAKFSDDFKRDAVHQIVERGYPVAEVSQRLGVSPHSLYAWKKRFSQPSGGDDKDAEIRRLKRELTRVIEERDILKKANRVFRQGCKVRYAFVAEHRPLFSVRAMCRCLRIQPSGFYAWLKHPLSKRAREDVRQTELIHKAWKDSGKVYGYRKLHDDLLDQGETCCPNRVARLATLAGITAQIGYKRRPGSYGGKPSLVVDNTLDRQFDVDVPDRAWVTDITYIRTQEGFAYLAVVIDLYSRRVVGWSMQSRQTTDVVLQALLMAVWRRKPKNRVLIHSDQGSQFTSMDWAAFLRAHNLEHSMSRRGNCHDNAVAESFFNLLKRERIRRRTYKTRTEARQDVFDYIEMFYNPTRKHVRNGMLSPVEFERQQRTKTEGV
>NZ_CP011479.1|WP_047032039.1|4752830_4753709_+|hypothetical-protein
MNLNFAVVDVETANENFSSICSIGVAKFRAGKLVDEHYTLVNPETYFSNTYIHGIDISHVEDAPKLAEGLTMLSAWLSDDYARTVCHMPFDKTATTRAADKVSMNWDHINWHDSARAVKLAWPEYRQSGYGLKKIAKVLGIEFEHHNALADAKAAGEVLLAAAKIIDESKASLWEQISQDKATRARLNYLKNVTDKPIANPEGEFFGQGVCFTGTLPNMTRKEASAFAAAFGFDIQGSVNSKCNILVIGAIDESKLSEGATKTGKWAKAEARIEKGEELRIMSPKDFEALFA
>NZ_CP011479.1|WP_156174616.1|4754117_4754621_+|hypothetical-protein
MIYTAINTFSEKAEKSMWNTNLKNGVIDSIPLIYFFQIFTPKCERRYIGIATSKVRLYQAYRNNVQRIFEGKQKRGNGPLTRDGRPQKRSNLEYRRVHLFLAVAVENKWPIIHTAIENGTKDEVKARELVLIEELNSDLNSRFGQPRQGWLIEEYADLKSKVIAGEI
>NZ_CP011479.1|WP_047028619.1|4754673_4755951_+|IS66-family-transposase
MDRTDLQQLSKDELIEMVLRLQRPAKDSRTSSKPPSTDKKEKRVNSRPGGAKPGHEPHNRVLADFADMFRDHEPTACKRCGHAFSGDDTMVLAGAYDEIDIPAIRPHVTRHRRFSCHCPQCGTTTKATAPAVATATPFGPGIHALAIYLKSFHALSYERLSGVFMDIFGLHASEGAIMNMFARSRPSFQATAQAAKASLRAARVVASDETGVRIEGTNAQHWVFHCKDAVVHQPDYSRAARVVHETMGGHVPEVWISDRYSAQQSHGHRHQTCLAHLARDTAFALEHGEDDLPLRFQLWFGRVFDFARAISTFAASTVASKKRKFDKQLAGLLCAPTSCDLAQKLQAKIGRARDQLLTFCDYPGEVDVTNNTSERKLRPWVIQRKVTNGYRAMWAAQAEADVRTTVDTARLKGANPFQVIASVLA
>NZ_CP011479.1|WP_047032042.1|4756371_4756893_-|hypothetical-protein
MSEQEPVCVPTLEDIRLSLASYITQIVEYYQSGNHKTARIDEIVDGIKINNKAERETVYSAIDPYSEGTDKRDENMPLLFRKTSPAEYTFLGYSADPLELTSKMVFSDPIINEAYKIFSELAEKKHGKGALQEMTMSKRVDSFHRNMQNIPFILKDAQERVTNRKALQAVIRC
>NZ_CP011479.1|WP_082128373.1|4757062_4757620_-|hypothetical-protein
MFSGYVGSGYEVNKGILLLGINPGGGGDAYEKRSLEDELFYPLLKDFRGSSEKSALDDFELINKEFATIVKGWNLWRILEPTLSAAGATIDDVAYMNIVPYRTRDDKFPPSLVRKTAWEYIVAPTLKIISPRAVIALGKKAGSIVDTQLRGRQHVYCVPRTIGDSYISEQARLVLSDIRKDFFQR
>NZ_CP011479.1|WP_156174617.1|4758315_4759125_+|hypothetical-protein
MVSDVFIQSGERRKINARRHEINNLIIEPGGELYVPVKSRGWLLLNISGNVQIGGTITFRGCIATNGGRSITLPDGSEATFAHPQTALGGYGGDGGIGGFGGAVTGGKGAAGTVNYGGGGGGGAYASHGNPPAAISGDNAVEYRAGRKHSPGGNGGRNNASVHGGMIYIYAPTGNLDGSGGRIDLRGFDGANGINAPQTTGQQGGGGGGAPGGHGGYLIIRTATILVEPELLLEPGKGGHNGLRGGLHRANGTDGYRGDDGEQGLVDYY
>NZ_CP011479.1|WP_156174618.1|4759643_4760249_+|hypothetical-protein
MSETSAILTLSLNTFIRYYSLDPSKLVGEISRRMQKSGGYDFYGMLSDAIRAKIRGATEDEIQFILGRSNNPSEVSYNRTAFDVFMSKFGKKRGLAIFEKKGRIKLCDGELIILASPLFSIESSSGFSVYNVWATQNPALDRVRAGVGVHLLNKAFQKSAPNYDYKMFDAVEGKVFSTVGNTIPRAIDTVAKTIIDHAKNG
>NZ_CP011479.1|WP_052766591.1|4760258_4761257_+|hypothetical-protein
MRKTYIFGNGLGMAISPDAYNLTSAMSKAWDEGALAPEQKELISACLPDGDTCPTSEEQLATLQDTVSACEVLLSVRDTGAGHWLSSQGRQFPEAVHKFAYLVARQMYLAQHSTGQEEGNRCVLPEDFLDPLAAEIKSSQSHVATLNYDGLLSSALRNKKILGGDEPILFDGFVDKKFDRQNLFRNKRFGAWYLHLHGGPLFAGKAKAKPFKLTEVTLSKNPKTLKNVGRHIVLTHYTHKPKIIDSSEVLSIYWEFLEMAVDESLEVVLFGYSGNDIHLNRLISQLRGTKVVRVVDWLGAGNKASRTKFWNEQLGGDVELHLLEDVLTFTEW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

630534 : 686515

Salmonella_phage(25.0%)

transposase,protease,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047028970.1\|630534_631596_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-20	32.0
WP_047028971.1\|631592_632447_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_082127976.1\|632513_633443_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047032207.1\|633687_634278_+	thymidine kinase	M1EAN9	Salmonella_phage	6.5e-58	56.0
WP_047028972.1\|634416_634815_+	cytochrome c family protein	NA	NA	NA	NA
WP_047028973.1\|635011_636100_+	hypothetical protein	NA	NA	NA	NA
WP_047028974.1\|636129_637275_+	hypothetical protein	NA	NA	NA	NA
WP_047028975.1\|637279_639196_+	ATP-binding protein	NA	NA	NA	NA
WP_047028976.1\|639192_640494_+	hypothetical protein	NA	NA	NA	NA
WP_047028977.1\|640486_641584_+	DUF2333 family protein	NA	NA	NA	NA
WP_052766271.1\|641648_642110_-	PAS domain-containing protein	NA	NA	NA	NA
WP_156174387.1\|642148_642883_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_047028979.1\|643006_643468_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_156174388.1\|643553_646694_+	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_156174389.1\|646748_647549_-	hypothetical protein	NA	NA	NA	NA
WP_047028981.1\|647850_648960_-	GAF domain-containing protein	NA	NA	NA	NA
WP_047028982.1\|649409_651089_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_156174390.1\|651179_653282_-	hypothetical protein	NA	NA	NA	NA
WP_047028985.1\|653220_653985_-	hypothetical protein	NA	NA	NA	NA
WP_052766272.1\|653997_655518_-	hypothetical protein	NA	NA	NA	NA
WP_047028987.1\|656279_657056_-	YHYH protein	NA	NA	NA	NA
WP_052766273.1\|657241_657988_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_047028988.1\|657984_658794_+	DUF1206 domain-containing protein	NA	NA	NA	NA
WP_047028989.1\|658895_659366_-	hypothetical protein	NA	NA	NA	NA
WP_047028990.1\|659515_659923_-	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_047028992.1\|660531_662721_+	anthranilate synthase	NA	NA	NA	NA
WP_047028993.1\|662717_663077_+	cytochrome c	NA	NA	NA	NA
WP_047028994.1\|663082_663982_+	cation transporter	NA	NA	NA	NA
WP_047028995.1\|664006_664981_-	threonine/serine dehydratase	NA	NA	NA	NA
WP_047028996.1\|665133_666063_+	DMT family transporter	NA	NA	NA	NA
WP_047028997.1\|666382_667825_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-48	33.8
WP_047028998.1\|667997_668576_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A248SJ97	Salicola_phage	2.3e-23	32.6
WP_047028999.1\|668639_669716_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_082127978.1\|669903_670401_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_047029001.1\|670434_671187_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.9e-16	35.7
WP_047029002.1\|671465_672218_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.0e-16	34.8
WP_047029003.1\|672421_673663_-	saccharopine dehydrogenase family protein	NA	NA	NA	NA
WP_047032211.1\|673701_674799_-	carboxynorspermidine decarboxylase	NA	NA	NA	NA
WP_047032212.1\|676019_676313_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_047029005.1\|677141_678419_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_047029006.1\|678466_679174_-	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_047029007.1\|679559_681269_+	2-isopropylmalate synthase	NA	NA	NA	NA
WP_047029008.1\|681322_682117_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_052766275.1\|682249_683014_+	hypothetical protein	NA	NA	NA	NA
WP_047029009.1\|683006_683912_-	metallophosphoesterase	NA	NA	NA	NA
WP_082127979.1\|683879_684458_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_047029010.1\|684529_685522_-	hypothetical protein	A0A0M4S6X1	Salmonella_phage	3.0e-63	40.8
WP_156174391.1\|685557_686515_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	8.5e-07	26.9

DBSCAN-SWA_2

977655 : 1007735

Mycobacterium_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047029005.1\|977655_978933_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_047029227.1\|979069_980317_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	3.4e-88	44.5
WP_082127998.1\|980385_980862_-	AAA family ATPase	E5E3R2	Burkholderia_phage	5.3e-10	29.2
WP_082127999.1\|980861_981095_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_082128000.1\|981018_981759_-\|transposase	transposase	NA	NA	NA	NA
WP_047029005.1\|981810_983088_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_082128001.1\|983135_983255_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_047029229.1\|984063_984339_-	YARHG domain-containing protein	NA	NA	NA	NA
WP_082128002.1\|984526_985132_+	DUF922 domain-containing protein	NA	NA	NA	NA
WP_047029230.1\|985244_986351_+	endonuclease	NA	NA	NA	NA
WP_052766298.1\|986354_987107_+	hypothetical protein	NA	NA	NA	NA
WP_047029231.1\|987141_988062_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_047029232.1\|989803_991201_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_047029233.1\|991376_991769_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_047029234.1\|992041_992764_-	hypothetical protein	NA	NA	NA	NA
WP_047029235.1\|993088_993469_-	hypothetical protein	NA	NA	NA	NA
WP_047029236.1\|993480_994152_-	hypothetical protein	NA	NA	NA	NA
WP_047029237.1\|994154_994595_-	hypothetical protein	NA	NA	NA	NA
WP_047029238.1\|994605_995484_-	haloalkane dehalogenase	B9U1C3	Vaccinia_virus	1.6e-55	41.3
WP_047029239.1\|995556_996165_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_047029240.1\|996161_996746_+	3'-5' exonuclease	NA	NA	NA	NA
WP_047029241.1\|997106_998387_-	MFS transporter	NA	NA	NA	NA
WP_156174408.1\|998811_999135_+	hypothetical protein	NA	NA	NA	NA
WP_047029243.1\|1001277_1004430_+	AAA family ATPase	NA	NA	NA	NA
WP_156174385.1\|1004561_1005913_-\|transposase	IS3 family transposase	Q88285	Snakehead_retrovirus	3.9e-05	30.1
WP_047029244.1\|1006247_1007735_+\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1848416 : 1861778

uncultured_Mediterranean_phage(81.82%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047029897.1\|1848416_1849217_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.0e-29	32.6
WP_047032397.1\|1849285_1849972_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.5e-37	44.0
WP_047029898.1\|1850033_1851128_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	9.1e-13	37.2
WP_047029899.1\|1851164_1851395_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.8e-08	70.5
WP_047029900.1\|1851436_1852141_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_047029901.1\|1852137_1852980_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.1e-42	40.7
WP_047029902.1\|1853061_1854345_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.8e-98	46.3
WP_047029903.1\|1854372_1855131_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.7e-30	32.5
WP_047029904.1\|1855134_1855788_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.6e-18	39.1
WP_047029905.1\|1855893_1857624_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	2.0e-06	33.6
WP_047029906.1\|1857710_1858580_-	ATP-binding protein	NA	NA	NA	NA
WP_047029907.1\|1858782_1859112_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.4e-06	32.9
WP_047032398.1\|1859207_1861778_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	5.2e-59	49.6

DBSCAN-SWA_4

2619500 : 2626163

Vibrio_phage(33.33%)

head,capsid,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047030481.1\|2619500_2620085_-\|tail	phage tail tape measure protein	K7RVL7	Vibrio_phage	1.3e-05	47.9
WP_047030482.1\|2620074_2620317_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_082128121.1\|2620313_2620727_-	gene transfer agent family protein	NA	NA	NA	NA
WP_047030483.1\|2620734_2621142_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_047030484.1\|2621191_2621590_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_047030485.1\|2621586_2621922_-\|head	phage head closure protein	NA	NA	NA	NA
WP_047030486.1\|2621921_2622488_-	hypothetical protein	NA	NA	NA	NA
WP_082128122.1\|2622576_2624544_-\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	1.3e-81	42.6
WP_156174501.1\|2624596_2624998_-	hypothetical protein	NA	NA	NA	NA
WP_047030487.1\|2624984_2626163_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.8e-62	37.0

DBSCAN-SWA_5

2810427 : 2847826

Catovirus(11.11%)

integrase,capsid,tail,head,holin,portal

attL 2839720:2839748|attR 2857793:2857821

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047030630.1\|2810427_2812050_-\|holin	glucose-methanol-choline oxidoreductase	A0A1V0S9J5	Catovirus	8.9e-57	30.8
WP_047030631.1\|2812147_2812873_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_156174679.1\|2813095_2813800_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.8e-36	40.4
WP_047032561.1\|2813811_2816172_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_047030632.1\|2816176_2817388_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_047030633.1\|2817459_2817969_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_156174513.1\|2818147_2818543_-	hypothetical protein	NA	NA	NA	NA
WP_047030634.1\|2818673_2818958_-	hypothetical protein	NA	NA	NA	NA
WP_047030635.1\|2819377_2820874_+	FAD-binding oxidoreductase	A0A2K9L3G7	Tupanvirus	2.4e-40	28.0
WP_047030636.1\|2820910_2821321_+	membrane protein	NA	NA	NA	NA
WP_047030637.1\|2821317_2822397_+	hypothetical protein	NA	NA	NA	NA
WP_047030638.1\|2822439_2822799_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_047030639.1\|2823074_2823491_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_047030640.1\|2823520_2824633_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_047030641.1\|2824634_2825771_+	hypothetical protein	NA	NA	NA	NA
WP_047030642.1\|2825811_2827137_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.4e-22	26.5
WP_047030643.1\|2827151_2828123_-	hypothetical protein	NA	NA	NA	NA
WP_082128135.1\|2828144_2829653_-	biotin carboxylase	NA	NA	NA	NA
WP_047030645.1\|2829606_2832357_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_082128136.1\|2832430_2833411_-	carbon-nitrogen hydrolase family protein	M1HUK8	Acanthocystis_turfacea_Chlorella_virus	1.3e-05	32.6
WP_047030646.1\|2833481_2833913_-	universal stress protein	NA	NA	NA	NA
WP_047032564.1\|2833933_2836687_-	TRAP transporter permease	NA	NA	NA	NA
WP_047030647.1\|2836820_2837780_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_047032565.1\|2838267_2838840_+	cupin domain-containing protein	NA	NA	NA	NA
WP_047032566.1\|2838878_2839673_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
2839720:2839748	attL	NA	NA	NA	NA
WP_047030649.1\|2839865_2841656_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_047030650.1\|2841746_2842988_+\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	2.8e-42	30.2
WP_047030651.1\|2842978_2843314_+	gene transfer agent family protein	NA	NA	NA	NA
WP_047030652.1\|2843310_2844909_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	9.5e-35	30.3
WP_047030653.1\|2844920_2845307_+	hypothetical protein	NA	NA	NA	NA
WP_052766424.1\|2845309_2845939_+	hypothetical protein	NA	NA	NA	NA
WP_082128137.1\|2845938_2846376_+	HNH endonuclease	Q38456	Bacillus_phage	1.0e-15	44.3
WP_047030654.1\|2846372_2846678_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_047032569.1\|2846700_2847096_+	hypothetical protein	B4UTQ0	Rhizobium_phage	3.3e-05	56.1
WP_047030655.1\|2847092_2847512_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_047030656.1\|2847508_2847826_+\|head	phage head closure protein	NA	NA	NA	NA
2857793:2857821	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3707444 : 3772354

Snakehead_retrovirus(22.22%)

transposase,integrase

attL 3707372:3707431|attR 3772369:3773878

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3707372:3707431	attL	NA	NA	NA	NA
WP_156174385.1\|3707444_3708796_-\|transposase	IS3 family transposase	Q88285	Snakehead_retrovirus	3.9e-05	30.1
WP_156174556.1\|3709185_3709617_-	hypothetical protein	NA	NA	NA	NA
WP_156174557.1\|3710231_3711059_+	cytochrome ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_082128199.1\|3711055_3713164_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_047031283.1\|3713160_3713790_+	hypothetical protein	NA	NA	NA	NA
WP_047031284.1\|3713786_3714092_+	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_047030099.1\|3714121_3714754_-	MarC family protein	NA	NA	NA	NA
WP_052766506.1\|3715207_3717844_+	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_156174558.1\|3718669_3719795_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_047031287.1\|3719892_3720441_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	3.0e-25	41.2
WP_047031288.1\|3720771_3721401_-	hypothetical protein	NA	NA	NA	NA
WP_052766507.1\|3722095_3722443_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_052766509.1\|3722676_3723096_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_052766511.1\|3724157_3724628_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_047029005.1\|3724694_3725972_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_156174559.1\|3726168_3726651_+	hypothetical protein	NA	NA	NA	NA
WP_047031291.1\|3727585_3728230_-	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	1.8e-45	43.5
WP_047031292.1\|3728660_3728861_-	DNA gyrase inhibitor YacG	NA	NA	NA	NA
WP_047031293.1\|3728864_3729485_-	Maf-like protein	NA	NA	NA	NA
WP_047031294.1\|3729507_3729726_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_082128201.1\|3729827_3730322_-	low molecular weight phosphatase family protein	NA	NA	NA	NA
WP_047031295.1\|3730330_3730807_-	UPF0262 family protein	NA	NA	NA	NA
WP_047031296.1\|3730803_3732120_-	histidinol dehydrogenase	NA	NA	NA	NA
WP_047031297.1\|3732255_3732693_-	DUF2948 family protein	NA	NA	NA	NA
WP_047031298.1\|3732819_3734109_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_047031299.1\|3734226_3734433_-	hypothetical protein	NA	NA	NA	NA
WP_082128202.1\|3734978_3736676_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_047031300.1\|3736748_3740162_+	type I restriction-modification system endonuclease	A0A2I7QZ21	Vibrio_phage	3.6e-15	26.9
WP_047031301.1\|3740225_3741689_+	type I restriction-modification system subunit M	A0A220A2U4	Liberibacter_phage	2.4e-21	25.3
WP_047031302.1\|3741685_3743002_+	hypothetical protein	NA	NA	NA	NA
WP_047031303.1\|3742998_3743595_+	hypothetical protein	NA	NA	NA	NA
WP_156174560.1\|3743642_3745265_+	hypothetical protein	NA	NA	NA	NA
WP_047031305.1\|3745513_3746074_+	recombinase family protein	E5FFF9	Burkholderia_phage	6.7e-28	40.7
WP_047031306.1\|3746305_3746803_+	ribonuclease HI	W5SAN9	Pithovirus	4.7e-25	42.0
WP_047031307.1\|3746802_3747696_+	hypothetical protein	NA	NA	NA	NA
WP_156174561.1\|3748216_3749962_+\|integrase	tyrosine-type recombinase/integrase	A0A059XK29	uncultured_phage	1.2e-09	28.0
WP_047031308.1\|3750586_3754222_-	hypothetical protein	NA	NA	NA	NA
WP_047031309.1\|3754605_3755568_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_156174562.1\|3755564_3756617_-	hypothetical protein	NA	NA	NA	NA
WP_047031310.1\|3757201_3757894_+	hypothetical protein	NA	NA	NA	NA
WP_156174563.1\|3758592_3759210_-	hypothetical protein	NA	NA	NA	NA
WP_047031313.1\|3759206_3760346_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_082128204.1\|3760342_3760942_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_082128205.1\|3760940_3761699_+	hypothetical protein	NA	NA	NA	NA
WP_082128206.1\|3762745_3763348_-	hypothetical protein	NA	NA	NA	NA
WP_156174564.1\|3763344_3763854_-	hypothetical protein	NA	NA	NA	NA
WP_156174565.1\|3764849_3765365_+	hypothetical protein	NA	NA	NA	NA
WP_047031318.1\|3766119_3767445_-	hypothetical protein	NA	NA	NA	NA
WP_082128207.1\|3767558_3769970_-	EAL domain-containing protein	NA	NA	NA	NA
WP_052766517.1\|3770243_3770951_+	hypothetical protein	NA	NA	NA	NA
WP_156174385.1\|3771003_3772354_+\|transposase	IS3 family transposase	Q88285	Snakehead_retrovirus	3.9e-05	30.1
3772369:3773878	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3927593 : 3936198

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047031408.1\|3927593_3928499_+	hypothetical protein	A0A0N9QXU8	Chrysochromulina_ericina_virus	1.5e-24	31.8
WP_047031409.1\|3928495_3929554_+	GDP-mannose 4,6-dehydratase	M1IBD7	Acanthocystis_turfacea_Chlorella_virus	1.9e-132	67.8
WP_047031410.1\|3929546_3930491_+	GDP-L-fucose synthase	D1LW79	Prochlorococcus_phage	1.5e-85	52.6
WP_047031411.1\|3930487_3931168_+	FkbM family methyltransferase	NA	NA	NA	NA
WP_047031412.1\|3931177_3931990_-	FkbM family methyltransferase	A0A1V0SJF4	Klosneuvirus	1.8e-10	27.0
WP_047031413.1\|3932048_3932918_-	alpha-1,2-fucosyltransferase	E3SJA0	Synechococcus_phage	4.7e-28	30.9
WP_052766538.1\|3932924_3933716_-	FkbM family methyltransferase	A0A0N9QAD0	Chrysochromulina_ericina_virus	1.9e-07	24.7
WP_047031414.1\|3933778_3934531_-	glycosyltransferase family 25 protein	A0A1V0SJT4	Klosneuvirus	1.0e-07	41.7
WP_082128225.1\|3934632_3936198_-	malonyl-CoA synthase	A0A2H4PQM9	Staphylococcus_phage	6.6e-33	28.4

DBSCAN-SWA_8

4151463 : 4201874

Snakehead_retrovirus(30.0%)

tRNA,transposase,integrase

attL 4145043:4145060|attR 4189009:4189026

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4145043:4145060	attL	NA	NA	NA	NA
WP_047031580.1\|4151463_4153875_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_047031581.1\|4153888_4154974_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	9.3e-26	32.1
WP_047031582.1\|4155135_4155537_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_047031583.1\|4155571_4155775_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_082128364.1\|4156036_4156573_-	translation initiation factor IF-3	A0A2I7S9Q1	Vibrio_phage	3.4e-13	34.6
WP_047031585.1\|4156764_4157562_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_047031586.1\|4157735_4158344_+	transglutaminase-like cysteine peptidase	V9QJI1	Rhizobium_phage	1.2e-11	30.5
WP_052766559.1\|4158372_4159617_-	MFS transporter	NA	NA	NA	NA
WP_047031587.1\|4159675_4161592_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_047031588.1\|4161825_4162809_-	membrane protein	NA	NA	NA	NA
WP_047032793.1\|4162949_4163768_+	lipo-like protein	NA	NA	NA	NA
WP_047031589.1\|4163992_4167130_-	hypothetical protein	NA	NA	NA	NA
WP_047031590.1\|4167364_4169131_-	hypothetical protein	NA	NA	NA	NA
WP_047031591.1\|4169344_4170274_-	restriction endonuclease	NA	NA	NA	NA
WP_047031592.1\|4170287_4173755_-	class I SAM-dependent DNA methyltransferase	NA	NA	NA	NA
WP_047031593.1\|4173809_4174919_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_052766561.1\|4174915_4175398_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_082128242.1\|4175398_4175605_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_047031594.1\|4175701_4176610_-	hypothetical protein	NA	NA	NA	NA
WP_047031595.1\|4176634_4177825_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	1.1e-85	43.1
WP_047032795.1\|4178384_4179305_+	DMT family transporter	NA	NA	NA	NA
WP_047032796.1\|4179342_4181151_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.1e-20	24.9
WP_047031596.1\|4181505_4182780_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_082128243.1\|4182866_4184066_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_156174588.1\|4184398_4185172_+	glycosyltransferase	NA	NA	NA	NA
WP_156174385.1\|4185228_4186580_-\|transposase	IS3 family transposase	Q88285	Snakehead_retrovirus	3.9e-05	30.1
WP_156174589.1\|4186624_4188000_-\|transposase	IS3 family transposase	Q88285	Snakehead_retrovirus	3.9e-05	30.1
WP_047031598.1\|4188021_4188453_+	hypothetical protein	NA	NA	NA	NA
WP_047031599.1\|4188559_4189645_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	6.0e-25	37.7
4189009:4189026	attR	NA	NA	NA	NA
WP_052766562.1\|4189673_4190501_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_047031600.1\|4190497_4191373_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_047031601.1\|4191389_4192670_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_047031602.1\|4192711_4193440_-	SIS domain-containing protein	NA	NA	NA	NA
WP_047031603.1\|4193436_4194177_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_052766563.1\|4194280_4195783_-	carbohydrate kinase	NA	NA	NA	NA
WP_047031604.1\|4195779_4196946_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_047031605.1\|4196945_4197974_-	SIS domain-containing protein	A0A0G2YDT3	Acanthamoeba_polyphaga_mimivirus	8.3e-16	27.2
WP_047031606.1\|4197976_4198744_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_047031607.1\|4198883_4199195_-	diguanylate cyclase	NA	NA	NA	NA
WP_156174385.1\|4199334_4200685_+\|transposase	IS3 family transposase	Q88285	Snakehead_retrovirus	3.9e-05	30.1
WP_047031608.1\|4200719_4201874_-\|transposase	IS66 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011480

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6227

Sulfitobacter_phage(33.33%)

transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156174714.1\|1254_2313_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_047032895.1\|2611_3568_+	DUF1403 family protein	NA	NA	NA	NA
WP_156174705.1\|3564_4254_+	segregation and condensation protein B	NA	NA	NA	NA
WP_047032897.1\|4315_4660_-	helix-turn-helix transcriptional regulator	M4QZA2	Sulfitobacter_phage	6.4e-05	47.4
WP_047032898.1\|4671_4923_-	hypothetical protein	Q8W6N1	Burkholderia_virus	1.8e-12	46.4
WP_047032994.1\|5312_6227_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.2e-47	41.5

DBSCAN-SWA_2

9497 : 11957

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032902.1\|9497_11957_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.2e-117	37.9

DBSCAN-SWA_3

15372 : 20001

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032905.1\|15372_18147_-	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	1.4e-22	29.4
WP_047032906.1\|18143_19178_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_047032907.1\|19218_20001_-	TIGR00730 family Rossman fold protein	F4YCQ1	Synechococcus_phage	1.2e-11	31.9

DBSCAN-SWA_4

24472 : 27577

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032912.1\|24472_27577_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.7e-40	21.4

DBSCAN-SWA_5

30768 : 31428

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032915.1\|30768_31428_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.4e-23	29.6

DBSCAN-SWA_6

46298 : 84506

Staphylococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032922.1\|46298_46997_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	8.6e-41	41.8
WP_047032923.1\|47164_47743_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_047031487.1\|47742_49134_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_047032924.1\|49508_50603_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_082128395.1\|50782_52195_-	AAA family ATPase	A7KV33	Bacillus_phage	1.5e-07	31.1
WP_047032925.1\|52291_52894_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_082128377.1\|53385_54084_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	3.7e-28	40.0
WP_082128379.1\|56468_57401_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_082128396.1\|57409_58150_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-28	38.9
WP_047032929.1\|58179_58980_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047032930.1\|59080_59773_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_047032931.1\|59783_60473_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_047032932.1\|60580_61852_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_047032933.1\|61858_63202_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_047032934.1\|63606_64323_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_047032935.1\|65202_65793_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_052766645.1\|65789_66572_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_047032936.1\|66564_68049_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	3.8e-38	25.5
WP_047032937.1\|68045_68402_+	hydratase	NA	NA	NA	NA
WP_082128380.1\|68398_68758_+	phosphate acetyltransferase	NA	NA	NA	NA
WP_052766646.1\|68781_69552_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_047032939.1\|69557_70610_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_047032940.1\|70611_71643_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_047032941.1\|71645_72368_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.0e-09	26.3
WP_047032942.1\|72360_73125_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-11	23.4
WP_047033007.1\|73191_74361_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047032944.1\|74979_75729_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-15	28.1
WP_047032945.1\|75721_76438_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.5e-08	26.2
WP_047032946.1\|76490_77693_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047032947.1\|77768_78656_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_156174707.1\|78655_79633_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_047032948.1\|80352_81009_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	1.0e-27	40.1
WP_047032949.1\|81005_81746_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_047033009.1\|82058_82475_+\|transposase	IS200/IS605 family transposase	A0A0H3UZM0	Geobacillus_virus	1.3e-20	40.8
WP_156174708.1\|82697_83636_+	hypothetical protein	NA	NA	NA	NA
WP_047032951.1\|83651_84506_+	hypothetical protein	M4QMR5	Micromonas_pusilla_virus	2.1e-09	27.6

DBSCAN-SWA_7

90987 : 93879

Leptospira_phage(50.0%)

integrase

attL 89760:89773|attR 93201:93214

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
89760:89773	attL	NA	NA	NA	NA
WP_047032955.1\|90987_91848_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	5.3e-32	33.8
WP_047032956.1\|91980_93879_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	3.2e-29	31.3
93201:93214	attR	NA	NA	NA	NA

DBSCAN-SWA_8

104334 : 113699

Escherichia_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032961.1\|104334_106341_+	acyltransferase	W6MVL2	Pseudomonas_phage	3.6e-39	34.8
WP_047032962.1\|106346_107492_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_047032963.1\|107659_109012_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	8.7e-74	37.1
WP_082128384.1\|109235_110246_+	glycosyltransferase	NA	NA	NA	NA
WP_047032964.1\|110285_111146_+	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	2.4e-101	61.1
WP_047033015.1\|111156_111729_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D8EQH2	Escherichia_phage	7.8e-32	42.9
WP_047032965.1\|111730_112783_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.7e-91	49.7
WP_047032966.1\|112799_113699_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.2e-31	34.1

DBSCAN-SWA_9

118219 : 124005

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082128387.1\|118219_118987_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-09	28.5
WP_082128388.1\|119609_119852_+	hypothetical protein	NA	NA	NA	NA
WP_047029227.1\|120082_121330_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	3.4e-88	44.5
WP_156174710.1\|121843_122398_+	hypothetical protein	NA	NA	NA	NA
WP_047032971.1\|123291_124005_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	3.2e-27	39.4

DBSCAN-SWA_10

133344 : 134418

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047032981.1\|133344_134418_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	7.0e-26	32.4

DBSCAN-SWA_11

140505 : 141856

Lactobacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156174385.1\|140505_141856_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.9e-10	28.7

DBSCAN-SWA_12

146005 : 153044

Dasychira_pudibunda_nucleopolyhedrovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082128393.1\|146005_149488_+	DEAD/DEAH box helicase	A0A0N7D8L3	Dasychira_pudibunda_nucleopolyhedrovirus	4.4e-45	30.2
WP_082128394.1\|150063_150288_+	cupin domain-containing protein	NA	NA	NA	NA
WP_047032991.1\|150359_151715_-	hypothetical protein	L7TKN6	Rhizobium_phage	4.3e-12	24.6
WP_047032992.1\|151937_153044_-	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	2.7e-44	38.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011481

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12064

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047033025.1\|1326_2484_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_047033026.1\|2515_4465_-	hypothetical protein	NA	NA	NA	NA
WP_047033027.1\|4461_4887_-	hypothetical protein	NA	NA	NA	NA
WP_047033028.1\|4945_6634_-	flotillin family protein	NA	NA	NA	NA
WP_052766653.1\|6691_7393_-	light-driven rhodopsin	NA	NA	NA	NA
WP_156174730.1\|7443_8691_-	inner-membrane translocator	NA	NA	NA	NA
WP_156174731.1\|8807_10163_-	hypothetical protein	NA	NA	NA	NA
WP_082128397.1\|10237_12064_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.9e-13	25.6

DBSCAN-SWA_2

18451 : 19429

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047033113.1\|18451_19429_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.5e-56	41.9

DBSCAN-SWA_3

36526 : 47828

Clostridium_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052766657.1\|36526_37714_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	2.1e-39	30.0
WP_047033050.1\|37703_38354_-	hypothetical protein	NA	NA	NA	NA
WP_047033051.1\|38418_38655_-	hypothetical protein	NA	NA	NA	NA
WP_047033052.1\|39108_39975_+	EamA family transporter	NA	NA	NA	NA
WP_156174385.1\|40142_41493_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.9e-10	28.7
WP_156174721.1\|41637_42120_+	hypothetical protein	NA	NA	NA	NA
WP_082128401.1\|42270_44700_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.3e-75	33.2
WP_047033054.1\|45332_46403_-	type II glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_047033055.1\|46793_47828_-	acyltransferase family protein	A0A142KBN9	Gordonia_phage	3.7e-08	24.8

DBSCAN-SWA_4

52310 : 54466

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047033061.1\|52310_53747_-	HAMP domain-containing protein	A0A1B0VMK3	Pseudomonas_phage	1.8e-08	26.7
WP_047033062.1\|53743_54466_-	response regulator	W8CYM9	Bacillus_phage	3.9e-28	35.2

DBSCAN-SWA_5

60509 : 65892

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082128410.1\|60509_62780_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.1e-84	32.5
WP_047033070.1\|62851_63058_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_047033071.1\|63411_65892_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-102	36.8

DBSCAN-SWA_6

76403 : 76979

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156174732.1\|76403_76979_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	6.0e-16	31.5

DBSCAN-SWA_7

80566 : 84260

Ochrobactrum_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047033083.1\|80566_81745_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	3.8e-81	43.5
WP_047033128.1\|81741_82761_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	9.0e-31	30.7
WP_047033084.1\|82919_84260_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	3.5e-14	28.0

DBSCAN-SWA_8

88945 : 90900

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047033086.1\|88945_90034_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.4e-27	33.5
WP_047033087.1\|90030_90900_+	ABC transporter permease	Q6GZ02	Mycoplasma_phage	1.2e-10	26.4

DBSCAN-SWA_9

118131 : 120189

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082128405.1\|118131_120189_+	AAA family ATPase	R4TQL5	Phaeocystis_globosa_virus	1.7e-23	39.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011479

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011480

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP011481

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection