CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP011589	Enterobacter asburiae strain CAV1043 plasmid pKPC_CAV1043, complete sequence	0 crisprs	NA	1
NZ_CP011588	Enterobacter asburiae strain CAV1043 plasmid pCAV1043-58, complete sequence	0 crisprs	NA	1
NZ_CP011590	Enterobacter asburiae strain CAV1043 plasmid pCAV1043-97, complete sequence	0 crisprs	csa3	2
NZ_CP011591	Enterobacter asburiae strain CAV1043, complete genome	1 crisprs	DEDDh,DinG,cas3,RT,csa3,WYL	9
NZ_CP011586	Enterobacter asburiae strain CAV1043 plasmid pCAV1043-10, complete sequence	0 crisprs	NA	0
NZ_CP011585	Enterobacter asburiae strain CAV1043 plasmid pCAV1043-1919, complete sequence	0 crisprs	NA	0
NZ_CP011587	Enterobacter asburiae strain CAV1043 plasmid pCAV1043-51, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5421 : 19198

Escherichia_phage(33.33%)

integrase,protease,transposase

attL 7994:8008|attR 11635:11649

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010455375.1\|5421_6543_-\|transposase	ISAs1-like element ISPa60 family transposase	NA	NA	NA	NA
WP_010454871.1\|6897_7701_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.2e-34	36.2
WP_024012635.1\|7693_9193_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.8e-11	26.7
7994:8008	attL	NA	NA	NA	NA
WP_047741489.1\|10114_10306_+	hypothetical protein	NA	NA	NA	NA
WP_047741491.1\|10338_10635_+	hypothetical protein	NA	NA	NA	NA
WP_047741493.1\|10649_11609_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	1.4e-12	29.0
WP_047389784.1\|11667_12363_-\|transposase	IS6-like element ISEas1 family transposase	A0A0N9RU54	Staphylococcus_phage	4.9e-36	37.0
11635:11649	attR	NA	NA	NA	NA
WP_052132604.1\|12673_12976_+	hypothetical protein	NA	NA	NA	NA
WP_047389782.1\|13126_13747_+	ParA family protein	A2I303	Vibrio_virus	1.8e-21	35.0
WP_047389780.1\|13785_14013_+	DNA partition complex ParG	NA	NA	NA	NA
WP_047389778.1\|14144_14429_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_047389775.1\|14421_14664_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_087451024.1\|15220_16341_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_052132603.1\|16949_17192_+	hypothetical protein	NA	NA	NA	NA
WP_047389771.1\|18008_18269_-	hypothetical protein	NA	NA	NA	NA
WP_040080118.1\|18379_19198_-\|protease	metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9617

Burkholderia_phage(42.86%)

integrase,transposase

attL 3150:3167|attR 10334:10351

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001749982.1\|0_720_+	replication initiation protein	I3WF20	Macacine_betaherpesvirus	8.6e-20	28.9
WP_001749988.1\|2676_3246_-	recombinase family protein	E5FFF9	Burkholderia_phage	5.2e-36	43.2
3150:3167	attL	NA	NA	NA	NA
WP_000845048.1\|3638_4652_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_004201280.1\|4807_5281_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
WP_001144737.1\|5501_5768_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_001389365.1\|5910_6675_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_004098817.1\|6935_8150_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_001288432.1\|8183_9617_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
10334:10351	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011591

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011591_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011591_1

4662719-4662808

Orphan

Consensus_repeat	Method
AACGCGAAGTCGCGGAACCTATTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011591_1

>merge|NZ_CP011591|1|4662719-4662808|CRISPRCasFinder
AACGCGAAGTCGCGGAACCTATTCCGCAAAATCACGGAACCGAAAACGCAGAACCACAGAACCCTAACCGCGAAGTCGCGGAACCTATTC

>NZ_CP011591|1|1|4662719-4662808|CRISPRCasFinder
AACGCGAAGTCGCGGAACCTATTC	CGCAAAATCACGGAACCGAAAACGCAGAACCACAGAACCCTA
ACCGCGAAGTCGCGGAACCTATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011591.1\|WP_000016608.1\|4668206_4668962_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_047744246.1\|4665961_4667023_+\|DUF968-domain-containing-protein	unknown	unknown	gnl\|CDD\|310615
NZ_CP011591.1\|WP_047744245.1\|4665272_4665965_+\|antirepressor	unknown	unknown	gnl\|CDD\|226171
NZ_CP011591.1\|WP_047744242.1\|4661175_4661439_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP011591.1\|WP_016247402.1\|4656494_4656716_-\|TraR/DksA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|222775
NZ_CP011591.1\|WP_047744244.1\|4663250_4664585_+\|phage-N-6-adenine-methyltransferase	unknown	unknown	gnl\|CDD\|368643
NZ_CP011591.1\|WP_016247400.1\|4657212_4657410_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_047744248.1\|4667044_4667737_+\|antitermination-protein	unknown	unknown	gnl\|CDD\|368843
NZ_CP011591.1\|WP_047744255.1\|4669575_4670628_+\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223931
NZ_CP011591.1\|WP_047352165.1\|4658072_4658903_-\|YfdQ-family-protein	unknown	unknown	gnl\|CDD\|378375
NZ_CP011591.1\|WP_155404508.1\|4671021_4671465_+\|glycoside-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|381599
NZ_CP011591.1\|WP_024191785.1\|4662152_4662338_+\|DUF4222-domain-containing-protein	unknown	unknown	gnl\|CDD\|372855
NZ_CP011591.1\|WP_047744232.1\|4656712_4657216_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_047744238.1\|4658956_4659328_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_047744261.1\|4671461_4672007_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_047744257.1\|4670696_4671038_+\|phage-holin,-lambda-family	unknown	unknown	gnl\|CDD\|368287
NZ_CP011591.1\|WP_000116520.1\|4668961_4669366_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_047744234.1\|4657397_4657937_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224808
NZ_CP011591.1\|WP_047744243.1\|4661431_4661980_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011591.1\|WP_032448896.1\|4660382_4661078_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225484

Protein	Function_ID	Function_description	E-value
NZ_CP011591.1\|WP_047744246.1\|4665961_4667023_+\|DUF968-domain-containing-protein	gnl\|CDD\|310615	pfam06147, DUF968, Protein of unknown function (DUF968). Family of uncharacterized prophage proteins found in Gammaproteobacteria. These may be HNH-nucleases, as there are several conserved cysteines and histidines.	6.29993e-73
NZ_CP011591.1\|WP_047744245.1\|4665272_4665965_+\|antirepressor	gnl\|CDD\|226171	COG3645, COG3645, Uncharacterized phage-encoded protein [Function unknown].	6.2778e-40
NZ_CP011591.1\|WP_047744242.1\|4661175_4661439_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	7.31667e-11
NZ_CP011591.1\|WP_016247402.1\|4656494_4656716_-\|TraR/DksA-family-transcriptional-regulator	gnl\|CDD\|222775	PHA00080, PHA00080, DksA-like zinc finger domain containing protein.	3.00977e-20
NZ_CP011591.1\|WP_047744244.1\|4663250_4664585_+\|phage-N-6-adenine-methyltransferase	gnl\|CDD\|368643	pfam05869, Dam, DNA N-6-adenine-methyltransferase (Dam). This family consists of several bacterial and phage DNA N-6-adenine-methyltransferase (Dam) like sequences.	5.47364e-67
NZ_CP011591.1\|WP_047744255.1\|4669575_4670628_+\|site-specific-DNA-methyltransferase	gnl\|CDD\|223931	COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair].	1.20092e-22
NZ_CP011591.1\|WP_047352165.1\|4658072_4658903_-\|YfdQ-family-protein	gnl\|CDD\|378375	pfam10065, DUF2303, Uncharacterized conserved protein (DUF2303). Members of this family of hypothetical bacterial proteins have no known function.	1.29116e-83
NZ_CP011591.1\|WP_155404508.1\|4671021_4671465_+\|glycoside-hydrolase-family-protein	gnl\|CDD\|381599	cd00737, lyz_endolysin_autolysin, endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.	1.56815e-80
NZ_CP011591.1\|WP_024191785.1\|4662152_4662338_+\|DUF4222-domain-containing-protein	gnl\|CDD\|372855	pfam13973, DUF4222, Domain of unknown function (DUF4222). This short protein is likely to be of phage origin. For example it is found in the Enterobacteria phage YYZ-2008. It is largely found in enteric bacteria. The molecular function of this protein is unknown.	7.93769e-10
NZ_CP011591.1\|WP_047744257.1\|4670696_4671038_+\|phage-holin,-lambda-family	gnl\|CDD\|368287	pfam05106, Phage_holin_3_1, Phage holin family (Lysis protein S). This family represents one of a large number of mutually dissimilar families of phage holins. Holins act against the host cell membrane to allow lytic enzymes of the phage to reach the bacterial cell wall. This family includes the product of the S gene of phage lambda.	2.87212e-33
NZ_CP011591.1\|WP_047744234.1\|4657397_4657937_-\|hypothetical-protein	gnl\|CDD\|224808	COG1896, COG1896, Predicted hydrolases of HD superfamily [General function prediction only].	1.02906e-17
NZ_CP011591.1\|WP_047744248.1\|4667044_4667737_+\|antitermination-protein	gnl\|CDD\|368843	pfam06323, Phage_antiter_Q, Phage antitermination protein Q. This family consists of several phage antitermination protein Q and related bacterial sequences. Phage 82 gene Q encodes a phage-specific positive regulator of late gene expression, thought, by analogy to the corresponding gene of phage lambda, to be a transcription antiterminator.	7.37346e-56
NZ_CP011591.1\|WP_032448896.1\|4660382_4661078_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225484	COG2932, COG2932, Predicted transcriptional regulator [Transcription].	2.42361e-27

>NZ_CP011591.1|WP_024191785.1|4662152_4662338_+|DUF4222-domain-containing-protein
MREVNRRFKDHRGIPVRVIRWEPETRRVIYLRAGYEHECFSPLELFRQKFREITNEHEPDI
>NZ_CP011591.1|WP_047744243.1|4661431_4661980_+|hypothetical-protein
MGNEPEWKVDKQPAWLVAAIKKTITELPGGYSEAAEWLGVTENALFNRLRTDGDQIFPLGWAMVLQRAGGSNHIANAIARHSNGVFVPLAEVEEIENGDINQRLMESVEWIGRHSQYVRKATADGVIDAQERAQIEENSYQVMAKWQEHLTLLFRVFCAPEKSDARECAAPGVVADKSCMEK
>NZ_CP011591.1|WP_047744242.1|4661175_4661439_+|helix-turn-helix-transcriptional-regulator
MQSPLRNLRKSQGLTLSHVANLVDIDPANLSRIERGQQIASLDVAERLVKFYSGQIDELQILYPHRYTQATENGAASVPQEKGESRG
>NZ_CP011591.1|WP_032448896.1|4660382_4661078_-|helix-turn-helix-domain-containing-protein
MNIGNRIRELRLEKGMKISDLAEAVGIDGANVSRVETGKQKSFTEQSLSKYATALGVSVAELFTPSPNETTVCKSSGKNPTYGEGDPVFRVELLDVSASAGTGHIQGSDVVDVIRSIEYNNERAAALFGGRTPDTVKVINVRGDSMADTIEPGDLIFVDISVNEFDGDGIYVFGFDDKIYVKRLQMIPDKILVISDNPKYREWSVDKSNEDRFYVFGKVMISQSQSVKRHG
>NZ_CP011591.1|WP_047744238.1|4658956_4659328_-|hypothetical-protein
MSNDRMTVVPDFLAELDAGVFMNKIAAALNTTALGVLNNGTKGKVVLTFDIERMGNSVEEKRVKIKHKLNYVTPTPRGKASEEDTTETPMWVNKGGKLTILQEDQGQLFGINGGVDGKLKAAQ
>NZ_CP011591.1|WP_047352165.1|4658072_4658903_-|YfdQ-family-protein
MSQILDGNALQQVKDLVLSGYHLTAVKETACPTALLPDGVNVESLERFDLERFRFRGAMTTTSIPDFVRYAAGYANEAEPARCFIDADNMTARSVFNIGTLANPGHADNVASITLKKTAPFRALLQVNGDRLGQKEIAEWLEDWADFLSAFDADGNVLSIAQAAGAVRRVNIKQVSEAAHEDEDFGGRKSLMQSVEASSKDVMPVAFEFKCVPYEGLGERRFSLRNSLLKSGEPVFVLRIVQLEAQEEAIANEFRDLLIEKFTDKPVETFIGNFKA
>NZ_CP011591.1|WP_047744234.1|4657397_4657937_-|hypothetical-protein
MSYIQTLSGKKFDYLNSTTDDVEIEDIATALSHICRFSGHLPEFYSVAQHSVLCSQIVPPEFAFEALMHDAAEAYCQDIPAPLKALLPDYRRIEEGVEQLIRAKFSITPDMSAVVKYADLVMLATERRDLDIDDGSLWPCLEGIPASDIIQIVPLRPGQAYGLFINRFNELTESRACLA
>NZ_CP011591.1|WP_016247400.1|4657212_4657410_-|hypothetical-protein
MPRMKIKELVAAAHAAAGKLPPAEASLMREVATRLDVTFAALTESMDQRMSLDAEINHLRQESVQ
>NZ_CP011591.1|WP_047744232.1|4656712_4657216_-|hypothetical-protein
MTTNKYATLRGTIARAKRNDCQKVVIRVTLVEELLLQLSNAEKQVAALAAEVQTVRWAAGQVYSAGYNHGHLNTADELPYASDEELLQRGNEALIEFTDPDHSGNVTDAVLDEVRAHAIKSALNDCSEYLDRDCIMDSNGISYEDAALREAGAMALHDALLRQERAV
>NZ_CP011591.1|WP_016247402.1|4656494_4656716_-|TraR/DksA-family-transcriptional-regulator
MSSDIIDQANELVEHRLQLAIQKHRIDQNAVSAEHCSECEEDIPEARRVAMPGCKTCASCQEVLELMIKQRKG
>NZ_CP011591.1|WP_047744244.1|4663250_4664585_+|phage-N-6-adenine-methyltransferase
MIESKYCRALAELRSKPAHELKEVGDQWRTPDLLFWGINAMFGPLVLDLFADDSNAKCPAWYTAEDNALTQDWSERLAELGGAGFGNPPYSRSQYHDKQAVTGMTHIINHAMAMREKGGRYVFLIKSATSETWWPEEADHVTFIRGRIGFDLPTWFVPKDEKQQPTSAFFAGAIVVFDKTWRGERFSYINRTDLEAKGRASMSLAQFAVGRTQTDAVPELDAEVVQEKSETELPLTQKAILETSGVEAWACVVAAFGEKDEYTFSESKFGHTWAADSLENPEFTNVSPLTIDRAKKLISESILVGVNAWLETLPFDSDDVKQDMSERLRTVAVESAKEYGINHSEFIATMESLDKAKWSNIRGIRAYVRDTQESKDKALNESRVWPLEVGLVFNQIEGADALPVSQQNKLKANINQLWLERMPTSEIITTAGGLFNSMQGAVNA
>NZ_CP011591.1|WP_047744245.1|4665272_4665965_+|antirepressor
MNQLTAKGVVTMSSREIARLVQSKHGDVKRSAERLASAGILTAPLAHTPYTHPQNGQTYEEYWFNKRDSLVIVARLSPEFTAAVVDRWQELENSQAVSVPQTLPEALRLAADLAEQKEQLSQQLAAAAPKVEFVDRYCTAKGSMSFRQVAKLLQDKETDFRLFLIESGILYRLSGVLTPRHQHIAAGRFEVKTGTTSETNYAFSQARFTPKGIEWIGGLWTAHIAKGHAA
>NZ_CP011591.1|WP_047744246.1|4665961_4667023_+|DUF968-domain-containing-protein
MRGLFTAETVPRLGLVLLKPGSELMSLFQQGRVLVEPQPKSMAGLPSGLVPDARQPLAEDKSLEGFFTDERVIRAAGGLNALESWLERNVKECQYPHTDYHHHEQVTMRHPPGSMLLCWHCDNQLRDQTTAALAELARRNLINWLISSILSSLGYNNERELSLGELCWWAVYSGIADAITERMAQRALRLPDEPFLSVYRESDIVPMPPAKSILQKKVTPAVTAAKLKHGANQEVAYEQPKVLALHADPESPESFMLRPKHRRWVNEDYTRWVKTQPCEGCRRPADDPHHVIGHGIGGTATKAHDLFVIPLCRECHDKLHADVAAFEKKHGTQLELLFRFMNRALAIGVITKA
>NZ_CP011591.1|WP_047744248.1|4667044_4667737_+|antitermination-protein
MNLQELEYTRIELRRALADLSGSTKGQLQAFSDHPPADKNKYPRHHPEIVMEGGEGCGSKVVKTLATPLYVLETRSRRRPLPPIKDTEFACSAWRRSVNGLGEHLQAWVRYCYGYDLTFRYQTLMCQYVWEQFQRQHSGKKIQGRVTKKLIGLVWLAAQEVAASRNNDTYQEYAGAALARMVSVERSTWLRVYSGHWAAFKASFAEMDSQALSEILSRYEEYQELKVAEM
>NZ_CP011591.1|WP_000016608.1|4668206_4668962_+|hypothetical-protein
MSGQPESKEQELLATILDYFQKGEVPDTDTIAEIEHDIAKLPISERAHAYAWLNGTLGRHSDAVRLFKDAMSSGSPTIAQNYLAYLSRSAHNYEHRVELFRIVELFPSHELRLVARNAAFCIGNDKLVKKFSLKMAALYDGQEREDIINQGNYMAEQIVDFKNATRLSSRELEALCDQAEEIANKRGINCSSVSYYLGGDDDNAFIVRAQTADPQVLAEMNMELLVLLSDDSYRNSPFTSWFQSDEKRGIY
>NZ_CP011591.1|WP_000116520.1|4668961_4669366_+|hypothetical-protein
MSVSGKDFIVFAGKCISHNDEIGYRNAIGRAYYGVYHETLDKLEKCPNKSSHQAVRDYLTNDAWLKGNEPFEKMKLISMGTMLRHLHTRRKWADYELDRTLSKADAEAILIMANKAIDTLQQMYEQVYPSEPAA
>NZ_CP011591.1|WP_047744255.1|4669575_4670628_+|site-specific-DNA-methyltransferase
MKNTVNINSVELVNADSLQYIATLPDNSIDLIVTDPPYFKVKPNGWDNQWKGDEDYLRWLDMCLAQFWRVLKPAGSLYLFSGHRLAADIEIMMRERFNVLNHIIWAKPSGRWNGCNKESLRSYFPATERILFAEHYQGPYKPKSDGYAEKGSELKQHVMTPLISYFRDAREALGISSKQIADATGKKNMVSHWFSGSQWQLPNESDYRKLQSLFTQVAIEKHQNGELATPHHQLVALWHSLNRKYSELLEEYKSLRRHFSVSVSVPYTDVWTHKPVQFYPGKHPCEKPADMLRQIINASSKPGDVVADFFMGSGSTVKVALELGRHAIGVELEKDRFSQTVEEIRALTGE
>NZ_CP011591.1|WP_047744257.1|4670696_4671038_+|phage-holin,-lambda-family
MKMHNDPHSWTEFIELLHSWWRGETPMGAVLLSVAMAAMRIAYGGGGWKKMLLEGAICGALTLTAVSALDYFNLPQSLSIAIGGALGFVGVEQVKVMAARVFNSRFGGGDANQ
>NZ_CP011591.1|WP_155404508.1|4671021_4671465_+|glycoside-hydrolase-family-protein
MMQTSDKGIALIKKFEGCKLTAYQDSVGVCTIGYGWTQPVDGKPIRVGMTIKQETAERLLKTGLVSYESDVSRLVKVGLTQGQFDALVSFTYNLGARALSTSTLLRKLNAGDYAGAADEFLRWNKAGGKVLNGLTRRREAERALFLS
>NZ_CP011591.1|WP_047744261.1|4671461_4672007_+|hypothetical-protein
MITFADIKASWRLMLLVAVIAVITVLCVLLANSRSDAATLKSDNDVLRSDNILQGTVIATQAFNFNRFNQVAENANRLNSLIDISTEETVTEYREILRREKTCDLPVPADIAGGLLEYAHRLRTSAMHTDTNRPDSADDRAAAASPMTYCQAVLWIKPLLGVIEKGNNNFAGIRQIEQERK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

96958 : 103246

Enterobacteria_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047741609.1\|96958_98350_+	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	3.7e-19	32.8
WP_029742022.1\|98526_99423_+	GalU regulator GalF	A0A127AW70	Bacillus_phage	1.8e-43	42.2
WP_047741610.1\|99776_100859_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.8e-99	53.6
WP_047741611.1\|100861_101761_+	dTDP-4-dehydrorhamnose reductase	A0A140G5S3	Enterobacteria_phage	1.1e-29	34.9
WP_047741612.1\|101813_102692_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.7e-107	64.5
WP_047741613.1\|102694_103246_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.0e-48	56.4

DBSCAN-SWA_2

1001454 : 1061587

Escherichia_phage(25.0%)

transposase,protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047741628.1\|1001454_1002675_-\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_155404503.1\|1003804_1005001_-	hypothetical protein	NA	NA	NA	NA
WP_047742028.1\|1005849_1008333_-\|tail	phage tail protein	F1C5A7	Cronobacter_phage	7.5e-281	59.2
WP_047742029.1\|1008274_1008712_-	C40 family peptidase	F1C5F2	Cronobacter_phage	1.8e-44	62.6
WP_047742030.1\|1008704_1009175_-	hypothetical protein	R9TPR6	Aeromonas_phage	1.7e-45	55.8
WP_047742031.1\|1009174_1009669_-	hypothetical protein	F1C5F0	Cronobacter_phage	4.2e-58	65.2
WP_047744392.1\|1010515_1010833_-	hypothetical protein	K7P7P8	Enterobacteria_phage	9.5e-48	91.3
WP_080963213.1\|1010853_1011705_-	DUF551 domain-containing protein	K7P7E4	Enterobacteria_phage	4.3e-34	39.6
WP_016063169.1\|1011704_1011905_-	hypothetical protein	K7P6F8	Enterobacteria_phage	5.6e-30	100.0
WP_047742033.1\|1012069_1013089_-	Zn-dependent oxidoreductase	E3SJ82	Synechococcus_phage	5.1e-18	26.9
WP_047174828.1\|1013103_1014318_-	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	6.3e-47	29.4
WP_047742034.1\|1014428_1014755_-	YnfA family protein	A0A218MNG8	uncultured_virus	2.4e-22	53.9
WP_023311550.1\|1014907_1015246_+	DUF1283 family protein	NA	NA	NA	NA
WP_023311549.1\|1015245_1015806_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_032668251.1\|1015823_1016534_-	YnfC family lipoprotein	NA	NA	NA	NA
WP_023311546.1\|1016638_1016905_+	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_047742036.1\|1020345_1020960_+	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	1.4e-26	34.9
WP_047742037.1\|1021000_1022716_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_047742038.1\|1022886_1023312_-	VOC family protein	NA	NA	NA	NA
WP_094169092.1\|1023842_1024859_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_045354786.1\|1025436_1026273_-	MipA/OmpV family protein	NA	NA	NA	NA
WP_047742039.1\|1026476_1027154_+	response regulator	NA	NA	NA	NA
WP_047742040.1\|1027153_1028542_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_155404500.1\|1028718_1029735_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	3.7e-186	99.4
WP_047742041.1\|1029911_1030358_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_045354781.1\|1030456_1033612_-	multidrug efflux RND transporter permease subunit OqxB	NA	NA	NA	NA
WP_023311529.1\|1033635_1034811_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_023311528.1\|1035147_1035501_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023338070.1\|1035596_1037081_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_023311527.1\|1037480_1037798_+	YebG family protein	NA	NA	NA	NA
WP_047742042.1\|1037859_1038381_-	hypothetical protein	NA	NA	NA	NA
WP_047742043.1\|1038781_1039192_+	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_047742044.1\|1039235_1039691_-	hypothetical protein	NA	NA	NA	NA
WP_023311523.1\|1040089_1040593_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094169092.1\|1040829_1041846_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_047744398.1\|1041844_1042090_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_047742046.1\|1042155_1043040_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_047742047.1\|1043154_1044282_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_047742048.1\|1044331_1045516_+	MFS transporter	NA	NA	NA	NA
WP_047742049.1\|1045600_1046224_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_032668247.1\|1046377_1047115_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_023311516.1\|1047391_1048102_+	osmoprotectant ABC transporter permease OsmY	NA	NA	NA	NA
WP_047742050.1\|1048120_1049020_+	osmoprotectant ABC transporter substrate-binding protein OsmX	NA	NA	NA	NA
WP_023311514.1\|1049028_1049676_+	osmoprotectant ABC transporter permease OsmW	NA	NA	NA	NA
WP_047742051.1\|1049675_1050824_+	osmoprotectant ABC transporter ATP-binding protein OsmV	G9BWD6	Planktothrix_phage	4.9e-25	33.0
WP_052948717.1\|1050926_1051730_+	voltage-gated ClC-type chloride channel ClcB	NA	NA	NA	NA
WP_047742052.1\|1051664_1052360_-	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_023311510.1\|1052490_1053711_-	ROK family transcriptional regulator	NA	NA	NA	NA
WP_047742053.1\|1053805_1054738_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_047742054.1\|1054859_1056113_+	MFS transporter	NA	NA	NA	NA
WP_047742055.1\|1056286_1056769_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_047742056.1\|1056782_1057232_+	hypothetical protein	NA	NA	NA	NA
WP_047742057.1\|1057231_1057561_+	DUF1493 family protein	NA	NA	NA	NA
WP_047742058.1\|1057662_1059150_+	carboxypeptidase M32	NA	NA	NA	NA
WP_080298623.1\|1059306_1059846_+	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_032657610.1\|1060020_1060485_+	acid resistance repetitive basic protein Asr	NA	NA	NA	NA
WP_047742059.1\|1060765_1061587_+\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

1278096 : 1287547

Enterobacteria_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047742145.1\|1278096_1279380_+	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	1.3e-10	36.3
WP_045406334.1\|1279507_1279828_-	hypothetical protein	K7PGV5	Enterobacterial_phage	3.5e-50	88.7
WP_047742146.1\|1279827_1280067_-	hypothetical protein	K7P7N3	Enterobacteria_phage	3.7e-36	85.9
WP_047741628.1\|1280132_1281353_-\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_047742147.1\|1281477_1281744_+	DinI family protein	K7PKR6	Enterobacteria_phage	4.7e-40	95.5
WP_052948721.1\|1283218_1283770_-	hypothetical protein	A0A0E3GMH9	Enterobacteria_phage	9.2e-22	35.0
WP_047742150.1\|1284370_1287547_-	host specificity protein J	K7P7G9	Enterobacteria_phage	0.0e+00	91.7

DBSCAN-SWA_4

1290724 : 1302593

Enterobacterial_phage(58.82%)

protease,integrase,holin,head

attL 1288620:1288632|attR 1303665:1303677

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1288620:1288632	attL	NA	NA	NA	NA
WP_047742152.1\|1290724_1290988_-	DUF4035 domain-containing protein	K7P7L5	Enterobacteria_phage	1.4e-41	97.7
WP_071845475.1\|1291207_1291924_-\|head,protease	HK97 family phage prohead protease	K7PKL4	Enterobacterial_phage	7.6e-69	99.3
WP_047742154.1\|1291930_1292416_-	hypothetical protein	K7PGU7	Enterobacterial_phage	5.9e-81	98.1
WP_047742155.1\|1292601_1292805_-	hypothetical protein	K7PHC8	Enterobacterial_phage	5.9e-19	68.7
WP_047742156.1\|1292804_1293146_-	HNH endonuclease	K7P7P4	Enterobacteria_phage	1.5e-62	96.5
WP_047742157.1\|1293142_1293733_-	hypothetical protein	F1C588	Cronobacter_phage	7.6e-99	86.2
WP_047742160.1\|1293714_1295172_-	glycosyl transferase	K7PKP3	Enterobacterial_phage	5.5e-215	72.2
WP_052948722.1\|1295285_1296179_-	trypsin-like peptidase domain-containing protein	S5FV10	Shigella_phage	8.3e-73	70.7
WP_047742162.1\|1296245_1296473_-	hypothetical protein	NA	NA	NA	NA
WP_047742163.1\|1296500_1296695_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	4.1e-17	76.4
WP_047742165.1\|1296645_1296921_-	hypothetical protein	K7PGW4	Enterobacterial_phage	1.5e-12	93.4
WP_047742166.1\|1296928_1297555_-	glycoside hydrolase family 19 protein	K7PJS7	Enterobacterial_phage	2.4e-111	95.2
WP_022648766.1\|1297554_1297836_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	4.1e-42	93.5
WP_022648767.1\|1297822_1298218_-	phage membrane protein	K7PHB9	Enterobacterial_phage	9.1e-64	99.2
WP_047742167.1\|1298927_1299938_+	hypothetical protein	A0A0R6PIZ6	Moraxella_phage	2.0e-38	30.6
WP_047744407.1\|1299951_1300329_-	DUF1133 family protein	K7PGW2	Enterobacterial_phage	1.2e-57	94.2
WP_047742169.1\|1300910_1301180_+	hypothetical protein	K7PKM4	Enterobacterial_phage	1.7e-37	85.4
WP_062676769.1\|1301212_1301476_+	hypothetical protein	NA	NA	NA	NA
WP_047742171.1\|1301450_1302593_+\|integrase	tyrosine-type recombinase/integrase	O21929	Phage_21	2.4e-93	48.4
1303665:1303677	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3744830 : 3785529

Escherichia_phage(22.22%)

transposase,integrase

attL 3745942:3745958|attR 3780801:3780817

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000019450.1\|3744830_3745811_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.8e-185	99.1
3745942:3745958	attL	NA	NA	NA	NA
WP_074173020.1\|3746295_3746670_-	hypothetical protein	NA	NA	NA	NA
WP_071845519.1\|3746758_3747484_-	hypothetical protein	NA	NA	NA	NA
WP_080470126.1\|3747744_3749148_-	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	7.8e-33	27.6
WP_047743631.1\|3749556_3751077_+	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.4e-32	48.5
WP_047743635.1\|3751669_3752362_-	hypothetical protein	NA	NA	NA	NA
WP_007372177.1\|3752572_3754222_-	glycerone kinase	NA	NA	NA	NA
WP_023336797.1\|3754296_3755715_-	dihydroxyacetone kinase subunit DhaM	NA	NA	NA	NA
WP_007372179.1\|3755725_3756358_-	dihydroxyacetone kinase ADP-binding subunit DhaL	NA	NA	NA	NA
WP_007372180.1\|3756368_3757439_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_007372182.1\|3757995_3759093_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_007372183.1\|3759282_3759561_-	dihydroxyacetone kinase	NA	NA	NA	NA
WP_007372185.1\|3760121_3761219_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_009653098.1\|3761308_3763234_+	PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR	NA	NA	NA	NA
WP_007372187.1\|3763211_3763742_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_007372188.1\|3763742_3764096_-	hypothetical protein	NA	NA	NA	NA
WP_007372189.1\|3764112_3765276_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_007372190.1\|3765298_3765727_-	heme-binding protein	NA	NA	NA	NA
WP_016241522.1\|3766119_3767787_+	propanediol/glycerol family dehydratase large subunit	NA	NA	NA	NA
WP_009652918.1\|3767798_3768383_+	propanediol/glycerol family dehydratase medium subunit	NA	NA	NA	NA
WP_007372193.1\|3768385_3768814_+	diol dehydratase small subunit	NA	NA	NA	NA
WP_007372194.1\|3768824_3770636_+	diol dehydratase reactivase subunit alpha	NA	NA	NA	NA
WP_032655135.1\|3770689_3771493_+	aquaporin	M1HJ75	Acanthocystis_turfacea_Chlorella_virus	1.6e-14	31.5
WP_024196074.1\|3771544_3771874_-	acid-activated periplasmic chaperone HdeB	NA	NA	NA	NA
WP_045269869.1\|3772112_3773429_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	1.6e-35	30.6
WP_155404512.1\|3774068_3775272_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.7e-100	62.5
WP_001225594.1\|3775393_3775549_-	hypothetical protein	NA	NA	NA	NA
WP_000459847.1\|3775677_3776118_+	hypothetical protein	NA	NA	NA	NA
WP_024209758.1\|3776462_3776690_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_000481743.1\|3776805_3778230_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_023294607.1\|3778355_3778982_+	inovirus Gp2 family protein	NA	NA	NA	NA
WP_080963219.1\|3779245_3779656_-	HNH endonuclease	NA	NA	NA	NA
WP_094169092.1\|3779654_3780671_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_047744346.1\|3781729_3782653_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	3.6e-172	96.7
3780801:3780817	attR	NA	NA	NA	NA
WP_080963220.1\|3782719_3783388_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_096147877.1\|3784409_3785529_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_6

3808150 : 3840894

Cronobacter_phage(73.33%)

portal,tail,terminase,holin,integrase,tRNA,head

attL 3808017:3808064|attR 3834325:3834372

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3808017:3808064	attL	NA	NA	NA	NA
WP_047743673.1\|3808150_3809188_-\|integrase	tyrosine-type recombinase/integrase	F1BUS9	Erwinia_phage	1.3e-122	64.4
WP_047743676.1\|3809191_3809758_-	phage protein	Q4ZA70	Staphylococcus_virus	6.3e-18	32.2
WP_047743678.1\|3809774_3810371_-	phage repressor protein CI	A0A218M4J1	Erwinia_phage	3.9e-26	38.6
WP_015460844.1\|3810471_3810693_+	regulator from bacteriophage origin	NA	NA	NA	NA
WP_047743681.1\|3810723_3811227_+	hypothetical protein	F1BUN6	Cronobacter_phage	2.1e-57	69.5
WP_047743683.1\|3811236_3811431_+	hypothetical protein	NA	NA	NA	NA
WP_013097409.1\|3811420_3811849_+	hypothetical protein	F1BUN5	Cronobacter_phage	5.8e-24	49.2
WP_047743685.1\|3811848_3812250_+	hypothetical protein	NA	NA	NA	NA
WP_047743687.1\|3812316_3812550_+	DUF2732 family protein	NA	NA	NA	NA
WP_047743689.1\|3812540_3812873_+	hypothetical protein	NA	NA	NA	NA
WP_047743697.1\|3812872_3813739_+	DNA adenine methylase	F1BUN1	Cronobacter_phage	1.1e-146	92.9
WP_047743699.1\|3813735_3813948_+	hypothetical protein	NA	NA	NA	NA
WP_047743700.1\|3813949_3815965_+	replication endonuclease	F1BUM9	Cronobacter_phage	1.3e-307	75.7
WP_047743701.1\|3816083_3816272_+	hypothetical protein	NA	NA	NA	NA
WP_047743703.1\|3816248_3816569_-	ogr/Delta-like zinc finger family protein	F1BUM8	Cronobacter_phage	5.1e-41	78.8
WP_047743704.1\|3816565_3817597_-\|portal	phage portal protein	F1BUM7	Cronobacter_phage	2.5e-161	80.8
WP_047743709.1\|3818148_3818853_+\|terminase	terminase	F1BUM0	Cronobacter_phage	5.9e-98	76.3
WP_047743711.1\|3818910_3819399_+\|head	head completion/stabilization protein	F1BUL8	Cronobacter_phage	4.4e-60	77.3
WP_047743713.1\|3819395_3819899_+\|tail	phage tail protein	F1BUL7	Cronobacter_phage	1.3e-67	72.7
WP_047743715.1\|3819898_3820606_+	phage protein	F1BUL6	Cronobacter_phage	8.5e-105	82.8
WP_047743716.1\|3820602_3821730_+	DUF2586 family protein	F1BUL5	Cronobacter_phage	3.0e-176	82.4
WP_047743718.1\|3821726_3822182_+	DUF2597 family protein	F1BUL4	Cronobacter_phage	2.8e-64	78.1
WP_047743720.1\|3822190_3822484_+\|holin	holin	A0A0M5M1H1	Salmonella_phage	1.3e-19	53.1
WP_047743722.1\|3822480_3822822_+	M15 family metallopeptidase	F1BUL3	Cronobacter_phage	2.5e-46	85.1
WP_047743723.1\|3822821_3823187_+	hypothetical protein	F1BUL2	Cronobacter_phage	5.5e-23	58.5
WP_047743726.1\|3823303_3823564_+	hypothetical protein	A5X9I7	Aeromonas_virus	2.0e-19	55.8
WP_047743728.1\|3823751_3825719_+\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	1.1e-253	68.0
WP_047743729.1\|3825715_3826045_+	DUF2590 family protein	F1BUK8	Cronobacter_phage	2.1e-45	85.7
WP_047743730.1\|3826041_3827226_+	phage protein	F1BUK6	Cronobacter_phage	1.4e-179	81.2
WP_080963221.1\|3827218_3827857_+	hypothetical protein	F1BUK5	Cronobacter_phage	3.0e-77	73.7
WP_052948741.1\|3827865_3829953_+\|tail	phage tail protein	F1BUK3	Cronobacter_phage	5.6e-96	63.6
WP_047743731.1\|3829967_3830153_+	hypothetical protein	NA	NA	NA	NA
WP_047743732.1\|3830139_3830388_+	hypothetical protein	NA	NA	NA	NA
WP_047743733.1\|3830450_3831167_+	hypothetical protein	F1BUK1	Cronobacter_phage	2.2e-60	53.1
WP_047743734.1\|3831141_3831687_+	hypothetical protein	F1BUJ9	Cronobacter_phage	7.6e-61	73.2
WP_047743735.1\|3831690_3833388_+	hypothetical protein	F1BUJ7	Cronobacter_phage	2.3e-212	71.4
WP_047743736.1\|3833952_3834276_+	hypothetical protein	NA	NA	NA	NA
WP_029741755.1\|3834528_3835035_+	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
3834325:3834372	attR	NA	NA	NA	NA
WP_047743737.1\|3835566_3837414_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
WP_029741754.1\|3837567_3839313_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.9e-76	39.0
WP_001144069.1\|3839428_3839644_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_032650276.1\|3839880_3840894_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.1e-108	58.6

DBSCAN-SWA_7

3891495 : 3941045

Staphylococcus_phage(27.27%)

transposase,integrase

attL 3889018:3889033|attR 3919555:3919570

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3889018:3889033	attL	NA	NA	NA	NA
WP_007897923.1\|3891495_3892743_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007897920.1\|3892729_3894496_+	hypothetical protein	NA	NA	NA	NA
WP_017384059.1\|3894483_3896601_+	hypothetical protein	NA	NA	NA	NA
WP_017384060.1\|3896604_3897033_+	hypothetical protein	NA	NA	NA	NA
WP_013036336.1\|3901289_3901370_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_040063370.1\|3901608_3902760_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-41	35.7
WP_012561110.1\|3903845_3904682_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_012561111.1\|3904746_3905145_-	VOC family protein	NA	NA	NA	NA
WP_017384070.1\|3905188_3906298_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.2e-30	28.7
WP_017384071.1\|3906332_3906608_-	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_023280857.1\|3907819_3908803_+	oxidoreductase	NA	NA	NA	NA
WP_023280966.1\|3908865_3909522_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_017384073.1\|3909945_3910242_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023280967.1\|3911100_3911589_+	hypothetical protein	NA	NA	NA	NA
WP_087855188.1\|3911633_3912783_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.4e-48	41.5
WP_032415320.1\|3912851_3915623_+	hypothetical protein	NA	NA	NA	NA
WP_000140246.1\|3915827_3916157_+	hypothetical protein	NA	NA	NA	NA
WP_023309180.1\|3916256_3917279_+	DUF3362 domain-containing protein	M1QSD9	Pseudomonas_phage	5.5e-105	71.2
WP_023309179.1\|3917363_3918191_-	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.1e-63	45.2
WP_047743759.1\|3918296_3919460_-	alcohol dehydrogenase	NA	NA	NA	NA
WP_023309177.1\|3919655_3920555_+	AraC family transcriptional regulator	NA	NA	NA	NA
3919555:3919570	attR	NA	NA	NA	NA
WP_023309176.1\|3920600_3921260_-	DedA family protein	NA	NA	NA	NA
WP_047743761.1\|3921403_3922591_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_023309174.1\|3922842_3923574_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
WP_023309173.1\|3923578_3924004_+	TonB system transport protein ExbD	NA	NA	NA	NA
WP_023309172.1\|3924046_3924496_-	hypothetical protein	NA	NA	NA	NA
WP_023309171.1\|3924497_3924902_-	hypothetical protein	NA	NA	NA	NA
WP_023309170.1\|3925005_3925509_+	hypothetical protein	NA	NA	NA	NA
WP_023309169.1\|3925590_3926079_+	TIGR00645 family protein	NA	NA	NA	NA
WP_047743763.1\|3926158_3927199_-	aldo/keto reductase	NA	NA	NA	NA
WP_023309167.1\|3927429_3928977_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.9e-12	36.9
WP_023309166.1\|3929104_3929359_+	hypothetical protein	NA	NA	NA	NA
WP_045356040.1\|3929457_3929808_-	DNA-binding protein	NA	NA	NA	NA
WP_047743764.1\|3929820_3930096_-	addiction module protein	NA	NA	NA	NA
WP_000839182.1\|3930192_3930597_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	1.6e-68	97.8
WP_000612626.1\|3930593_3930941_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.6e-62	100.0
WP_008786790.1\|3930989_3932528_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.7e-278	93.8
WP_023309163.1\|3932808_3933141_-	hypothetical protein	NA	NA	NA	NA
WP_047743766.1\|3933301_3934168_-	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_047743768.1\|3934413_3936003_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023309160.1\|3936048_3937002_+	ABC transporter permease	NA	NA	NA	NA
WP_047743770.1\|3937007_3937853_+	ABC transporter permease	NA	NA	NA	NA
WP_047743772.1\|3937845_3938823_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	29.1
WP_047743773.1\|3938819_3939797_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_040063370.1\|3939893_3941045_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-41	35.7

DBSCAN-SWA_8

4209346 : 4266165

Cronobacter_phage(44.44%)

portal,tail,capsid,terminase,integrase,transposase,tRNA

attL 4248382:4248426|attR 4265229:4265273

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045355806.1\|4209346_4211974_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	8.4e-81	39.2
WP_000906486.1\|4212328_4212514_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
WP_023308940.1\|4213763_4214330_+	fructose-1-phosphate/6-phosphogluconate phosphatase	NA	NA	NA	NA
WP_008499541.1\|4214326_4214755_+	DedA family protein	NA	NA	NA	NA
WP_023308938.1\|4214838_4216383_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_014884972.1\|4216536_4217052_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_047743958.1\|4217106_4217871_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_045357565.1\|4217857_4219513_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_047743960.1\|4219695_4221243_-	multidrug efflux MFS transporter permease subunit EmrB	NA	NA	NA	NA
WP_023308934.1\|4221259_4222432_-	multidrug efflux MFS transporter periplasmic adaptor subunit EmrA	NA	NA	NA	NA
WP_023308933.1\|4222558_4223089_-	transcriptional repressor MprA	NA	NA	NA	NA
WP_045357559.1\|4223402_4224587_-	MFS transporter	NA	NA	NA	NA
WP_045404718.1\|4224778_4225774_-	glycine betaine/L-proline ABC transporter substrate-binding protein ProX	NA	NA	NA	NA
WP_045404715.1\|4225783_4226854_-	glycine betaine/L-proline ABC transporter permease ProW	NA	NA	NA	NA
WP_047743962.1\|4226837_4228049_-	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.9e-27	38.3
WP_047743964.1\|4228380_4229340_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	6.7e-137	72.7
WP_047743966.1\|4229349_4231494_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	5.6e-200	48.9
WP_023308926.1\|4231466_4231877_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	4.6e-18	45.1
WP_023308925.1\|4231873_4232113_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	2.9e-12	43.2
WP_045404711.1\|4232356_4232683_-	DUF883 domain-containing protein	NA	NA	NA	NA
WP_023308923.1\|4232843_4233188_+	YgaC family protein	NA	NA	NA	NA
WP_047743969.1\|4233220_4233670_-	L-alanine exporter AlaE	NA	NA	NA	NA
WP_047743970.1\|4234166_4234571_+	DNA-binding protein StpA	NA	NA	NA	NA
WP_023308920.1\|4234609_4234789_-	hypothetical protein	NA	NA	NA	NA
WP_047743972.1\|4234868_4235390_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_023308918.1\|4235399_4235699_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023308917.1\|4235878_4236037_+	YqaE/Pmp3 family membrane protein	NA	NA	NA	NA
WP_033146353.1\|4236033_4236963_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_047744346.1\|4237065_4237989_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	3.6e-172	96.7
WP_087451024.1\|4238136_4239256_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_000614783.1\|4242121_4243018_-	hypothetical protein	NA	NA	NA	NA
WP_023337657.1\|4243014_4243911_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_047743978.1\|4243900_4245457_-	recombinase family protein	A0A0A7RTP8	Clostridium_phage	3.2e-19	30.0
WP_087855188.1\|4245622_4246773_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.4e-48	41.5
WP_023337654.1\|4246986_4248216_-\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	6.7e-206	85.8
4248382:4248426	attL	NA	NA	NA	NA
WP_047744516.1\|4248540_4249518_-	hypothetical protein	NA	NA	NA	NA
WP_047743979.1\|4249531_4250548_-\|integrase	tyrosine-type recombinase/integrase	F1BUN9	Cronobacter_phage	3.5e-176	87.2
WP_047743981.1\|4250544_4251123_-	phage repressor protein CI	F1BUN8	Cronobacter_phage	2.1e-77	71.7
WP_047743983.1\|4251522_4252026_+	hypothetical protein	F1BUN6	Cronobacter_phage	1.2e-55	68.9
WP_047743984.1\|4252035_4252245_+	hypothetical protein	NA	NA	NA	NA
WP_047743986.1\|4252594_4254613_+	replication endonuclease	F1BUS0	Erwinia_phage	1.8e-211	58.9
WP_047743988.1\|4254731_4254944_+	hypothetical protein	A0A1S6L006	Salmonella_phage	7.1e-07	53.1
WP_047743989.1\|4254917_4255241_-	ogr/Delta-like zinc finger family protein	F1BUM8	Cronobacter_phage	1.6e-45	83.8
WP_047743991.1\|4255237_4256269_-\|portal	phage portal protein	F1BUM7	Cronobacter_phage	4.2e-161	81.1
WP_047743994.1\|4256265_4258041_-\|terminase	terminase	F1BUM5	Cronobacter_phage	6.8e-284	82.9
WP_047744519.1\|4258198_4259008_+\|capsid	phage capsid scaffolding protein	F1BUM4	Cronobacter_phage	7.8e-78	54.0
WP_047743996.1\|4259061_4260591_+	hypothetical protein	F1BUK6	Cronobacter_phage	3.5e-127	80.9
WP_071845529.1\|4260583_4261222_+	hypothetical protein	F1BUK5	Cronobacter_phage	1.9e-79	77.2
WP_052948745.1\|4261230_4261923_+\|tail	phage tail protein	F1BUK3	Cronobacter_phage	4.1e-59	71.2
WP_052948748.1\|4261861_4262098_+	hypothetical protein	NA	NA	NA	NA
WP_047743998.1\|4262072_4262618_+	hypothetical protein	F1BUJ9	Cronobacter_phage	9.6e-56	68.7
WP_047744000.1\|4262621_4264319_+	hypothetical protein	F1BUJ7	Cronobacter_phage	2.3e-212	71.6
WP_047744001.1\|4264880_4265165_+	hypothetical protein	NA	NA	NA	NA
WP_008502505.1\|4265682_4266165_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.3e-29	47.4
4265229:4265273	attR	NA	NA	NA	NA

DBSCAN-SWA_9

4651071 : 4728234

Salmonella_phage(19.51%)

portal,tail,capsid,protease,plate,holin,integrase,transposase,head

attL 4643478:4643493|attR 4686562:4686577

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4643478:4643493	attL	NA	NA	NA	NA
WP_047744222.1\|4651071_4651575_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_008500962.1\|4651784_4652045_+	DUF2534 family protein	NA	NA	NA	NA
WP_047744224.1\|4652182_4653370_+	MFS transporter	NA	NA	NA	NA
WP_047744226.1\|4653587_4654775_-\|integrase	tyrosine-type recombinase/integrase	A0A2D1GN00	Marinobacter_phage	2.3e-33	30.2
WP_001515618.1\|4654777_4654987_-	hypothetical protein	NA	NA	NA	NA
WP_047363398.1\|4655031_4655604_-	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	1.2e-93	83.5
WP_047744230.1\|4655584_4655806_-	hypothetical protein	K7PKM4	Enterobacterial_phage	1.5e-12	59.7
WP_047363404.1\|4656275_4656488_-	hypothetical protein	NA	NA	NA	NA
WP_016247402.1\|4656494_4656716_-	TraR/DksA family transcriptional regulator	A0A0P0ZCX5	Stx2-converting_phage	8.2e-14	56.5
WP_047744232.1\|4656712_4657216_-	hypothetical protein	NA	NA	NA	NA
WP_016247400.1\|4657212_4657410_-	hypothetical protein	NA	NA	NA	NA
WP_047744234.1\|4657397_4657937_-	hypothetical protein	A0A192Y8M4	Salmonella_phage	2.0e-74	75.4
WP_047352165.1\|4658072_4658903_-	YfdQ family protein	Q8HAA2	Salmonella_phage	1.8e-117	77.5
WP_047744238.1\|4658956_4659328_-	hypothetical protein	Q8HAA1	Salmonella_phage	1.9e-55	89.4
WP_032448896.1\|4660382_4661078_-	helix-turn-helix domain-containing protein	Q8HAA0	Salmonella_phage	2.1e-87	69.6
WP_047744242.1\|4661175_4661439_+	helix-turn-helix transcriptional regulator	A0A0P0ZCZ7	Stx2-converting_phage	4.5e-19	58.6
WP_047744243.1\|4661431_4661980_+	hypothetical protein	A0A1C9II13	Salmonella_phage	1.1e-67	67.6
WP_024191785.1\|4662152_4662338_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	1.7e-12	67.3
WP_001515603.1\|4662321_4663254_+	hypothetical protein	K7PLZ7	Enterobacterial_phage	3.3e-80	51.7
WP_047744244.1\|4663250_4664585_+	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	2.2e-117	50.8
WP_047744245.1\|4665272_4665965_+	antirepressor	G0ZND1	Cronobacter_phage	5.3e-59	55.1
WP_047744246.1\|4665961_4667023_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	4.9e-112	56.3
WP_047744248.1\|4667044_4667737_+	antitermination protein	NA	NA	NA	NA
WP_000016608.1\|4668206_4668962_+	hypothetical protein	NA	NA	NA	NA
WP_000116520.1\|4668961_4669366_+	hypothetical protein	NA	NA	NA	NA
WP_047744255.1\|4669575_4670628_+	site-specific DNA-methyltransferase	A5LH81	Enterobacteria_phage	6.8e-175	81.7
WP_047744257.1\|4670696_4671038_+\|holin	phage holin, lambda family	Q8SBE1	Shigella_phage	2.4e-28	53.3
WP_155404508.1\|4671021_4671465_+	glycoside hydrolase family protein	A0A0M4R365	Salmonella_phage	1.7e-47	68.5
WP_047744261.1\|4671461_4672007_+	hypothetical protein	K7PHH7	Enterobacteria_phage	6.6e-65	82.9
WP_047744263.1\|4672149_4672701_-	hypothetical protein	NA	NA	NA	NA
WP_047744265.1\|4672834_4673476_+	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	8.2e-06	32.1
WP_000210383.1\|4673714_4674284_+	hypothetical protein	NA	NA	NA	NA
WP_016239512.1\|4674225_4676349_+	hypothetical protein	A0A2K9V3X4	Faecalibacterium_phage	2.3e-97	35.9
WP_000483309.1\|4676357_4676621_+	hypothetical protein	NA	NA	NA	NA
WP_001045359.1\|4676620_4678258_+\|portal	phage portal protein	A0A291AUL8	Sinorhizobium_phage	3.3e-91	35.2
WP_001052909.1\|4678254_4679121_+	S49 family peptidase	A0A2D1GN02	Marinobacter_phage	4.8e-49	37.9
WP_047744268.1\|4679122_4679692_+	hypothetical protein	NA	NA	NA	NA
WP_001472189.1\|4679691_4680096_+\|head	head decoration protein	NA	NA	NA	NA
WP_047744270.1\|4680193_4681243_+\|capsid	major capsid protein	V5Q8G6	Xylella_phage	4.7e-51	33.7
WP_047744272.1\|4681214_4681625_+	hypothetical protein	NA	NA	NA	NA
WP_000537794.1\|4681629_4681989_+	hypothetical protein	NA	NA	NA	NA
WP_045888904.1\|4681985_4682531_+	hypothetical protein	NA	NA	NA	NA
WP_000497745.1\|4682534_4682732_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_047744274.1\|4682728_4684231_+\|tail	tail protein	B5TK67	Pseudomonas_phage	2.5e-101	42.2
WP_000896638.1\|4684234_4684606_+\|tail	phage tail protein	NA	NA	NA	NA
WP_047744276.1\|4684607_4684886_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_047744279.1\|4685027_4686887_+	hypothetical protein	T1SBJ1	Salmonella_phage	3.8e-19	40.1
4686562:4686577	attR	NA	NA	NA	NA
WP_047744281.1\|4686949_4687684_+	hypothetical protein	NA	NA	NA	NA
WP_047744539.1\|4687746_4689150_+	hypothetical protein	NA	NA	NA	NA
WP_001548480.1\|4689146_4690232_+	hypothetical protein	M1PVV2	Vibrio_phage	1.3e-43	31.2
WP_000900614.1\|4690270_4690813_+\|plate	baseplate assembly protein	A0A077KAY0	Edwardsiella_phage	5.9e-05	30.8
WP_001279799.1\|4690809_4691247_+	hypothetical protein	B5TK74	Pseudomonas_phage	4.0e-12	45.8
WP_047744284.1\|4691248_4692391_+\|plate	baseplate J/gp47 family protein	A0A0A8WEY6	Clostridium_phage	3.1e-11	27.9
WP_047744286.1\|4692387_4692981_+	YmfQ family protein	NA	NA	NA	NA
WP_047744288.1\|4694832_4695099_-	DinI family protein	K7PKR6	Enterobacteria_phage	1.4e-39	93.2
WP_000343760.1\|4695198_4696419_-\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_047744290.1\|4696523_4696763_+	hypothetical protein	K7P7N3	Enterobacteria_phage	2.6e-37	93.6
WP_047744292.1\|4696762_4697083_+	hypothetical protein	K7PGV5	Enterobacterial_phage	1.9e-43	76.4
WP_047744294.1\|4698639_4700400_-	DUF3413 domain-containing protein	NA	NA	NA	NA
WP_008500958.1\|4700419_4700647_-	YejL family protein	NA	NA	NA	NA
WP_021241524.1\|4700781_4701789_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	7.7e-83	48.9
WP_023312497.1\|4701841_4702126_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_047744296.1\|4702251_4704012_-	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	1.7e-101	42.4
WP_045354252.1\|4704164_4704872_+	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_047744298.1\|4706362_4706707_+	hypothetical protein	NA	NA	NA	NA
WP_047744300.1\|4706710_4708300_-	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	1.0e-17	32.8
WP_032641492.1\|4708301_4709327_-	ABC transporter permease	NA	NA	NA	NA
WP_023312491.1\|4709326_4710421_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_047744301.1\|4710430_4712236_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047744304.1\|4712310_4713867_-	cyclic di-GMP phosphodiesterase	NA	NA	NA	NA
WP_008500946.1\|4713994_4714564_-	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	A0A1V0DZX6	Clostridioides_phage	3.6e-13	38.9
WP_047744305.1\|4714991_4715705_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_047744307.1\|4715726_4716713_-	GTP-binding protein	NA	NA	NA	NA
WP_047744309.1\|4716837_4718304_-	fructuronate reductase	E5EQS6	Micromonas_sp._RCC1109_virus	6.9e-40	30.0
WP_047744311.1\|4718509_4719700_+	mannonate dehydratase	NA	NA	NA	NA
WP_008500940.1\|4719819_4720392_-	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_071845539.1\|4720752_4721007_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_045414638.1\|4721187_4721877_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_045414636.1\|4722342_4722561_+	hypothetical protein	NA	NA	NA	NA
WP_045414634.1\|4723050_4723665_-	serine recombinase	A0A0A8WJD4	Clostridium_phage	4.6e-06	27.5
WP_047744314.1\|4724018_4724393_-	hypothetical protein	NA	NA	NA	NA
WP_045414632.1\|4725084_4725675_-	hypothetical protein	K4F7I7	Cronobacter_phage	4.6e-80	76.0
WP_045414749.1\|4725950_4726520_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_085950818.1\|4727113_4728234_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP011590

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10208 : 50387

Escherichia_phage(23.53%)

transposase,integrase

attL 23730:23747|attR 42123:42140

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|10208_10913_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_071845418.1\|11416_11944_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003032103.1\|11967_12492_+	hypothetical protein	NA	NA	NA	NA
WP_032192077.1\|13341_14106_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003032097.1\|14332_15118_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003032095.1\|15122_16097_+	SIS domain-containing protein	NA	NA	NA	NA
WP_003032093.1\|16109_16922_+	PfkB domain-containing protein	NA	NA	NA	NA
WP_047741574.1\|18063_18987_-\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	4.6e-175	98.7
WP_008502228.1\|19268_19970_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_006687059.1\|20035_21142_-	alkene reductase	NA	NA	NA	NA
WP_008502229.1\|21354_21684_+	thioredoxin family protein	V9SJ74	Achromobacter_phage	9.7e-11	34.7
WP_000888080.1\|21713_22052_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_008502230.1\|22056_22638_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_047741551.1\|22779_23337_-	OsmC family protein	NA	NA	NA	NA
WP_008502231.1\|23522_24107_-	recombinase family protein	A0A219YA40	Aeromonas_phage	2.6e-22	36.1
23730:23747	attL	NA	NA	NA	NA
WP_155404497.1\|24523_25730_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	2.3e-102	63.9
WP_148752318.1\|25722_25989_-	hypothetical protein	NA	NA	NA	NA
WP_015386429.1\|26469_27678_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.6e-47	45.7
WP_047353163.1\|28018_30016_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.0e-21	26.2
WP_023304011.1\|30079_31372_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_047741556.1\|31412_32393_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	4.4e-184	98.8
WP_004153649.1\|33456_33663_+	hypothetical protein	NA	NA	NA	NA
WP_004152336.1\|33708_34017_+	hypothetical protein	NA	NA	NA	NA
WP_004152337.1\|34044_34374_+	hypothetical protein	NA	NA	NA	NA
WP_004152338.1\|34441_34798_+	hypothetical protein	NA	NA	NA	NA
WP_004152339.1\|34804_35137_+	hypothetical protein	NA	NA	NA	NA
WP_004152340.1\|35136_35919_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	4.6e-51	90.2
WP_011977773.1\|36810_37041_-	hypothetical protein	NA	NA	NA	NA
WP_045340523.1\|37132_37606_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_004152347.1\|37986_38319_-	hypothetical protein	NA	NA	NA	NA
WP_001553819.1\|38761_41659_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	4.2e-182	37.8
WP_000509966.1\|41753_42359_+	DNA resolvase	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
42123:42140	attR	NA	NA	NA	NA
WP_047741558.1\|42355_43339_-	ParB/RepB/Spo0J family partition protein	Q1MVJ4	Enterobacteria_phage	7.0e-105	62.4
WP_004152349.1\|43335_44541_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	7.3e-205	89.0
WP_004152350.1\|44862_45759_-	RepB family plasmid replication initiator protein	Q71TL8	Escherichia_phage	3.3e-69	53.8
WP_004152351.1\|46159_47431_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	3.6e-154	63.7
WP_004152352.1\|47430_47862_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.0e-28	52.5
WP_047741561.1\|48187_48940_+	hypothetical protein	NA	NA	NA	NA
WP_001568071.1\|49058_49847_+	DsbA family protein	NA	NA	NA	NA
WP_001568070.1\|49850_50387_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	2.6e-21	37.7

DBSCAN-SWA_2

68877 : 79311

uncultured_Caudovirales_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072199090.1\|68877_69297_+	helix-turn-helix domain-containing protein	A0A222YXG1	Escherichia_phage	1.1e-06	33.6
WP_020806042.1\|69333_69543_-	hypothetical protein	NA	NA	NA	NA
WP_000427623.1\|70117_71122_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_023316432.1\|71296_71722_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.9e-51	72.1
WP_032409266.1\|71734_73024_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	3.4e-168	71.4
WP_047721846.1\|73068_73365_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	2.0e-15	44.3
WP_155404496.1\|73488_74505_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.4e-185	99.1
WP_000817038.1\|75422_76394_-	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	1.4e-150	86.9
WP_000523812.1\|76393_77560_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	3.0e-224	97.7
WP_000200069.1\|78300_79311_+	replication initiation protein	J9Q7H0	Salmonella_phage	6.7e-87	53.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011588

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP011591

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP011590

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection