CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	0 crisprs	csa3	1
NZ_CP011612	Citrobacter freundii strain CAV1321 chromosome, complete genome	1 crisprs	csa3,DEDDh,DinG,cas3,WYL,PD-DExK	368
NZ_CP011605	Citrobacter freundii strain CAV1321 plasmid pCAV1321-3820, complete sequence	0 crisprs	cas2	0
NZ_CP011609	Citrobacter freundii strain CAV1321 plasmid pCAV1321-71, complete sequence	0 crisprs	NA	1
NZ_CP011604	Citrobacter freundii strain CAV1321 plasmid pCAV1321-3223, complete sequence	0 crisprs	NA	0
NZ_CP011606	Citrobacter freundii strain CAV1321 plasmid pCAV1321-4310, complete sequence	0 crisprs	NA	0
NZ_CP011603	Citrobacter freundii strain CAV1321 plasmid pCAV1321-1916, complete sequence	0 crisprs	NA	0
NZ_CP011607	Citrobacter freundii strain CAV1321 plasmid pCAV1321-4938, complete sequence	0 crisprs	NA	0
NZ_CP011611	Citrobacter freundii strain CAV1321 plasmid pKPC_CAV1321-244, complete sequence	0 crisprs	DinG	1
NZ_CP011608	Citrobacter freundii strain CAV1321 plasmid pKPC_CAV1321-45, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9420 : 57059

Escherichia_phage(23.81%)

integrase,transposase

attL 28365:28381|attR 34086:34102

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022652239.1\|9420_11547_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_022652238.1\|11695_12910_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	9.4e-35	42.9
WP_072200700.1\|12943_14347_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	9.0e-106	50.6
WP_022652236.1\|14680_16819_-	hypothetical protein	NA	NA	NA	NA
WP_022652318.1\|18847_19813_-	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	8.8e-137	77.5
WP_022652317.1\|19812_20979_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	1.1e-218	94.3
WP_047715661.1\|21804_23163_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	1.7e-117	47.5
WP_032430836.1\|23219_24755_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	6.5e-259	87.5
WP_000609174.1\|24804_25152_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.7e-59	95.7
WP_001201739.1\|25148_25532_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	4.1e-13	36.3
WP_022652315.1\|25640_26792_-\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	9.8e-42	35.3
WP_086538014.1\|27893_28787_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	6.7e-155	87.1
28365:28381	attL	NA	NA	NA	NA
WP_022652313.1\|28918_29449_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_022652312.1\|29452_29722_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_022652311.1\|30577_31567_+	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	5.0e-103	61.2
WP_022652310.1\|31892_32633_-\|integrase	site-specific integrase	I3WFA4	Macacine_betaherpesvirus	5.4e-25	58.6
WP_001572362.1\|33708_34731_-\|transposase	IS110 family transposase	NA	NA	NA	NA
34086:34102	attR	NA	NA	NA	NA
WP_022652309.1\|35237_36716_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.9e-194	73.2
WP_032430841.1\|36733_37561_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	4.9e-51	40.3
WP_022652307.1\|37642_37846_+	hypothetical protein	NA	NA	NA	NA
WP_021314637.1\|38123_38354_-	thioredoxin family protein	NA	NA	NA	NA
WP_050483874.1\|39525_40035_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_032430842.1\|40625_41579_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_022652302.1\|42199_42910_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-31	37.7
WP_022652303.1\|42911_44117_-	ABC transporter permease	NA	NA	NA	NA
WP_032430843.1\|44113_45265_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004393990.1\|45261_45870_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_022542389.1\|46057_47062_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_000493286.1\|47665_47995_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_000780222.1\|47975_48257_+	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_047715662.1\|48534_49515_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.6e-184	98.8
WP_148116659.1\|49820_51049_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.5e-146	81.7
WP_001752509.1\|51167_51668_-	non-heme ferritin-like protein	NA	NA	NA	NA
WP_001067855.1\|51994_52699_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000215515.1\|55595_55952_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001067855.1\|56354_57059_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011612

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011612_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011612_1

3543620-3543735

Orphan

Consensus_repeat	Method
GCCTGATGGCGCTACGCTTATCAGGCCTAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011612_1

>merge|NZ_CP011612|1|3543620-3543735|CRISPRCasFinder
GCCTGATGGCGCTACGCTTATCAGGCCTACGGGGTAGCACGTTGTAGGCCGGATAAGGCGTTTGCGCCGCATCCGGCGAAAGATCTGCCTGATGGCGCTGCGCTTATCAGGCCTAC

>NZ_CP011612|1|1|3543620-3543735|CRISPRCasFinder
GCCTGATGGCGCTACGCTTATCAGGCCTAC	GGGGTAGCACGTTGTAGGCCGGATAAGGCGTTTGCGCCGCATCCGGCGAAAGATCT
GCCTGATGGCGCTGCGCTTATCAGGCCTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011612.1\|WP_044702196.1\|3544398_3545289_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176129
NZ_CP011612.1\|WP_003844735.1\|3551118_3552555_+\|ammonia-forming-nitrite-reductase-cytochrome-c552-subunit	unknown	unknown	gnl\|CDD\|236854
NZ_CP011612.1\|WP_044702194.1\|3545793_3546483_+\|LrgB-family-protein	unknown	unknown	gnl\|CDD\|224265
NZ_CP011612.1\|WP_003031733.1\|3539274_3539733_+\|redox-sensitive-transcriptional-activator-SoxR	unknown	unknown	gnl\|CDD\|184964
NZ_CP011612.1\|WP_003031758.1\|3552599_3553166_+\|cytochrome-c-nitrite-reductase-pentaheme-subunit	unknown	unknown	gnl\|CDD\|183264
NZ_CP011612.1\|WP_003031719.1\|3532303_3532660_+\|MmcQ/YjbR-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|225197
NZ_CP011612.1\|WP_003031737.1\|3541964_3543611_+\|Na+/H+-antiporter	unknown	unknown	gnl\|CDD\|129911
NZ_CP011612.1\|WP_044702294.1\|3531462_3532176_+\|acid-phosphatase-AphA	unknown	unknown	gnl\|CDD\|236818
NZ_CP011612.1\|WP_003031727.1\|3536440_3536722_-\|YjcB-family-protein	unknown	unknown	gnl\|CDD\|374240
NZ_CP011612.1\|WP_003031747.1\|3546528_3548178_-\|cation/acetate-symporter-ActP	unknown	unknown	gnl\|CDD\|236495
NZ_CP011612.1\|WP_003841054.1\|3537275_3538862_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227279
NZ_CP011612.1\|WP_003031761.1\|3553162_3553834_+\|cytochrome-c-nitrite-reductase-Fe-S-protein	unknown	unknown	gnl\|CDD\|274451
NZ_CP011612.1\|WP_003031731.1\|3538864_3539188_-\|superoxide-response-transcriptional-regulator-SoxS	unknown	unknown	gnl\|CDD\|182314
NZ_CP011612.1\|WP_003841063.1\|3548726_3550685_-\|acetate--CoA-ligase	unknown	unknown	gnl\|CDD\|234677
NZ_CP011612.1\|WP_003031720.1\|3532775_3535598_-\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|234734
NZ_CP011612.1\|WP_044702199.1\|3543836_3544328_+\|transposase	unknown	unknown	gnl\|CDD\|224854
NZ_CP011612.1\|WP_003826621.1\|3535849_3536374_+\|single-stranded-DNA-binding-protein-SSB1	unknown	unknown	gnl\|CDD\|236362
NZ_CP011612.1\|WP_003031735.1\|3540457_3541807_+\|guanine/hypoxanthine-transporter-GhxP	unknown	unknown	gnl\|CDD\|225161
NZ_CP011612.1\|WP_003031742.1\|3545390_3545801_+\|CidA/LrgA-family-protein	unknown	unknown	gnl\|CDD\|224298
NZ_CP011612.1\|WP_003031750.1\|3548174_3548489_-\|DUF485-domain-containing-protein	unknown	unknown	gnl\|CDD\|225704

Protein	Function_ID	Function_description	E-value
NZ_CP011612.1\|WP_044702196.1\|3544398_3545289_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176129	cd08438, PBP2_CidR, The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of CidR which positively up-regulates the expression of cidABC operon in the presence of acetic acid produced by the metabolism of excess glucose. The CidR affects the control of murein hydrolase activity by enhancing cidABC expression in the presence of acetic acid. Thus, up-regulation of cidABC expression results in increased murein hydrolase activity. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.15383e-88
NZ_CP011612.1\|WP_003844735.1\|3551118_3552555_+\|ammonia-forming-nitrite-reductase-cytochrome-c552-subunit	gnl\|CDD\|236854	PRK11125, nrfA, ammonia-forming cytochrome c nitrite reductase.	0
NZ_CP011612.1\|WP_044702194.1\|3545793_3546483_+\|LrgB-family-protein	gnl\|CDD\|224265	COG1346, LrgB, Putative effector of murein hydrolase [Cell envelope biogenesis, outer membrane].	1.49637e-88
NZ_CP011612.1\|WP_003031733.1\|3539274_3539733_+\|redox-sensitive-transcriptional-activator-SoxR	gnl\|CDD\|184964	PRK15002, PRK15002, redox-sensitive transcriptional activator SoxR.	6.63854e-107
NZ_CP011612.1\|WP_003031758.1\|3552599_3553166_+\|cytochrome-c-nitrite-reductase-pentaheme-subunit	gnl\|CDD\|183264	PRK11659, PRK11659, cytochrome c nitrite reductase pentaheme subunit; Provisional.	5.17591e-111
NZ_CP011612.1\|WP_003031719.1\|3532303_3532660_+\|MmcQ/YjbR-family-DNA-binding-protein	gnl\|CDD\|225197	COG2315, MmcQ, Uncharacterized protein conserved in bacteria [Function unknown].	5.53082e-49
NZ_CP011612.1\|WP_003031737.1\|3541964_3543611_+\|Na+/H+-antiporter	gnl\|CDD\|129911	TIGR00831, Putative_Na+/H+_exchanger_Rv2287/MT2345/Mb2309., Na+/H+ antiporter, bacterial form. The Monovalent Cation:Proton Antiporter-1 (CPA1) Family (TC 2.A.36) The CPA1 family is a large family of proteins derived from Gram-positive and Gram-negative bacteria, blue green bacteria, yeast, plants and animals. Transporters from eukaryotes have been functionally characterized, and all of these catalyze Na+:H+ exchange. Their primary physiological functions may be in (1) cytoplasmic pH regulation, extruding the H+ generated during metabolism, and (2) salt tolerance (in plants), due to Na+ uptake into vacuoles. This model is specific for the bacterial members of this family. [Transport and binding proteins, Cations and iron carrying compounds].	0
NZ_CP011612.1\|WP_044702294.1\|3531462_3532176_+\|acid-phosphatase-AphA	gnl\|CDD\|236818	PRK11009, aphA, class B acid phosphatase.	3.46131e-171
NZ_CP011612.1\|WP_003031727.1\|3536440_3536722_-\|YjcB-family-protein	gnl\|CDD\|374240	pfam15940, YjcB, Family of unknown function. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	2.63994e-40
NZ_CP011612.1\|WP_003031747.1\|3546528_3548178_-\|cation/acetate-symporter-ActP	gnl\|CDD\|236495	PRK09395, actP, cation/acetate symporter ActP.	0
NZ_CP011612.1\|WP_003841054.1\|3537275_3538862_+\|EAL-domain-containing-protein	gnl\|CDD\|227279	COG4943, COG4943, Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms].	0
NZ_CP011612.1\|WP_003031761.1\|3553162_3553834_+\|cytochrome-c-nitrite-reductase-Fe-S-protein	gnl\|CDD\|274451	TIGR03149, cyt_nit_nrfC, cytochrome c nitrite reductase, Fe-S protein. Members of this protein family are the Fe-S protein, NrfC, of a cytochrome c nitrite reductase system for which the pentaheme cytochrome c protein, NrfB (family TIGR03146) is an unambiguous marker. Members of this protein family show similarity to other ferredoxin-like proteins, including a subunit of a polysulfide reductase. [Energy metabolism, Electron transport].	1.23614e-143
NZ_CP011612.1\|WP_003031731.1\|3538864_3539188_-\|superoxide-response-transcriptional-regulator-SoxS	gnl\|CDD\|182314	PRK10219, PRK10219, superoxide response transcriptional regulator SoxS.	9.05826e-64
NZ_CP011612.1\|WP_003841063.1\|3548726_3550685_-\|acetate--CoA-ligase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
NZ_CP011612.1\|WP_003031720.1\|3532775_3535598_-\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|234734	PRK00349, uvrA, excinuclease ABC subunit UvrA.	0
NZ_CP011612.1\|WP_044702199.1\|3543836_3544328_+\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.40222e-37
NZ_CP011612.1\|WP_003826621.1\|3535849_3536374_+\|single-stranded-DNA-binding-protein-SSB1	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	4.66491e-115
NZ_CP011612.1\|WP_003031735.1\|3540457_3541807_+\|guanine/hypoxanthine-transporter-GhxP	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	8.93463e-145
NZ_CP011612.1\|WP_003031742.1\|3545390_3545801_+\|CidA/LrgA-family-protein	gnl\|CDD\|224298	COG1380, COG1380, Putative effector of murein hydrolase LrgA [General function prediction only].	6.27345e-34
NZ_CP011612.1\|WP_003031750.1\|3548174_3548489_-\|DUF485-domain-containing-protein	gnl\|CDD\|225704	COG3162, COG3162, Predicted membrane protein [Function unknown].	2.6138e-50

>NZ_CP011612.1|WP_003031737.1|3541964_3543611_+|Na+/H+-antiporter
MEIFFTILIMTLVVSLSGVFTRVLPFQLPLPLMQIAIGALLAWPTFGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIFGLALALVLVTVVGIGFMIYWLVPGIPLIPAFALAAVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGLVSLKFAVAVAMGTMVFTVGGATLEFFKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEPATQIVLLFLLPFASYLIAEHIGVSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWAMLEFVFNGMVFLLLGLQLPGILESSLAAAEVDPNVEIWMLFTDIVLIYVALMLVRFGWLWTMKKFSLRFLKKKPMEFGSWTTREILIASFAGVRGAITLAGVLSIPLLLPDGSGFPARYELIFLAAGVILFSLFVGVVMLPILLQHLEVADHSQQQKEERIARAATAEVAIVAIQKMEERLAADTEENIDNQLLTEVSSRVIGNLRRRADGRNDVESSMQEENLERRFRLAALRSERAELYHLRATREISNETLQKLLHDLDLLEALLIENQ
>NZ_CP011612.1|WP_003031735.1|3540457_3541807_+|guanine/hypoxanthine-transporter-GhxP
MSTPSARTGGSLDAWFKISLRGSTVRQEVVAGLTTFLAMVYSVIVVPGMLGKAGFPPAAVFVATCLVAGVGSIVMGLWANLPLAIGCAISLTAFTAFSLVLGQHISVPVALGAVFLMGVLFTIISATGIRSWILRNLPQGVAHGTGIGIGLFLLLIAANGVGLVIKNPLDGLPVALGDFDTFPVIMSLVGLAVIIGLEKLKVPGGILLTIIGISIVGLIFDPAVHFSGIFAMPSLSDENGNSLIGSLDIMGALNPIVLPSVLALVMTAVFDATGTIRAVAGQANLLDKDGQIIDGGKALTTDSLSSVFSGLVGAAPAAVYIESAAGTAAGGKTGLTAITVGVLFLLILFLSPLSYLVPVYATAPALMYVGLLMLSNVAKIDFADFVDAMAGLVTAVFIVLTCNIVTGIMIGFATLVIGRLVSGEWRKLNIGTVVIAIALVAFYAGGWAI
>NZ_CP011612.1|WP_003031733.1|3539274_3539733_+|redox-sensitive-transcriptional-activator-SoxR
MEKKLPRIKALLTPGEVAKRSGVAVSTLHFYESKGLISSMRNSGNQRRYKRDVLRYVAIIKIAQRIGIPLATIGDALGVLPEGHSLSAKEWKQLSSQWREELDRRIHTLVSLRDELDGCIGCGCLSRSDCPLRNPGDQLGEQGTGARLLEDD
>NZ_CP011612.1|WP_003031731.1|3538864_3539188_-|superoxide-response-transcriptional-regulator-SoxS
MSHQQIIQTLIEWIDEHIDQPLNIEAVAKKSGYSKWYLQRMFRTVTRQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRREFDRTPSDYRHRL
>NZ_CP011612.1|WP_003841054.1|3537275_3538862_+|EAL-domain-containing-protein
MNHSARRKLLKLLGTFMVVLLPVVLALWFAQIRAMSETRNQLRSFAQLVLNKTELVILQADLARDMAQLYQGKMCTPAHQKSMLNIIRGRLYISELIYAQGDHFLCSTSMVPPVTYIMPTADYKRTPDIAIYYYRDTPFFAGYRMTYMQRGNYVAVINPLSYSEVMSDDPDLSWGVYDTVTDTFFSASEAANIAQFAPLVRGEASTFQQDDRFYTIVHSEKRPIAIIVSTSDNRVSQIFYHEAALTIPFGIICSILILLMWWRTRQEYLSPRRLLKRAIKKRQLCLHYQPIIDIKNGQCVGAEALLRWPGCKGEVMSPTEFIPLAEKEGMIERITDYVVEEVFNDLGYFLSAHPQLYISINLSASDFHSSRLIALINDKNREYSVAAQQIKVEVTERGFIDVHKMTPVIQAFRKAGYEVAFDDFGTGYSNLHNLSALNVDILKIDKSFISTLSTNSTSHLIAEHIIEMAQSLHLKTIAEGVETKEQIEWLLERGVQYCQGWYFAKALPSQEFMHWIQRSPAILTQSGQ
>NZ_CP011612.1|WP_003031727.1|3536440_3536722_-|YjcB-family-protein
MATITTGVVLLRWQLLSAVLMFLASTLNIRFRKSDYIGLAVISSGLGLVFACWFATGLLGITLVDMSTIWKNIETVMVDVMSHTPPDWPMVLN
>NZ_CP011612.1|WP_003826621.1|3535849_3536374_+|single-stranded-DNA-binding-protein-SSB1
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGVEKYTTEVVVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF
>NZ_CP011612.1|WP_003031720.1|3532775_3535598_-|excinuclease-ABC-subunit-UvrA
MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEIHDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPVIKERKGEHTKTLENLAGQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVIDRFKVRDDLTQRLAESFETALELSGGTAVVADMDDPKAEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCDGLGVQQYFDPDRVIQNPELSLAGGAIRGWDRRNFYYFQMLKSLAEHYKFDVEAPWASLSPTVHKVVLYGSGKENIEFKYMNDRGDTSVRRHPFEGVLHNMERRYKETESSAVREELAKFISNRPCASCEGTRLRREARHVFVENTPLPAISDMSIGHAMDFFNNLKLAGQRAKIAEKILKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIGLHQRDNERLLGTLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGQVVAEGTLDDIMAVPESLTGQYMSGKRKIEVPKQRVAADPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQTALNGATLAEPAPYRDVQGLEHFDKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPESRARGYTPGRFSFNVRGGRCEACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIQQLLDVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLKPLL
>NZ_CP011612.1|WP_003031719.1|3532303_3532660_+|MmcQ/YjbR-family-DNA-binding-protein
MTNSELLQYCMAKMGAEQSVHSDWKATQIKVEDVLFAMVKEVEERPAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAVNTLPADKRRILTQP
>NZ_CP011612.1|WP_044702294.1|3531462_3532176_+|acid-phosphatase-AphA
MRKFTLALSAVCLLFTLNQPAQALVSSPSQLNPGTNVATLAEQAPIHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSEDYLKNPAFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDSIFFVTGRSQTKTETVSKTLSDNFHIPAGNMNPVIFAGDKPGQNTKTQWLQDKNIRMFYGDSDNDITAARDVGIRGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
>NZ_CP011612.1|WP_044702199.1|3543836_3544328_+|transposase
MSNYRRNYINGGTWFFTVNLQDRRSQLLLSKIDRLRCAISAVQKMKPFYINAWVVLPEHMHCIWTLPENDADFSSRWREIKKHFTRSLSARHIWQPRFWEHTIRDEHDYRQHVDYIYINPVKHGWVKQVQTWPFSTFHRDVRRGLFPHNWAGEIMDFNMGERA
>NZ_CP011612.1|WP_044702196.1|3544398_3545289_-|LysR-family-transcriptional-regulator
MDIRTLRYFVEVVRQQSFTRAAEKLFVTQPTISKMLKNLEDELNCTLLIRDGRRLLLTDTGQVVFERGLAILAEFRQLEAELSDINHLNRGVLRLGIPPMVGMLMAGPISLFRQHYPGVELKVSEFGGLTVQQAVMNGDLDVAMTALPVEEESGLATLPLFSHPLCVLVPRSGQWTTCESISPEALAEHPLLIYNEDFALSRQLLELFSQHNVKPRIAVRSGQWDFLAAMVQAGVGIAILPEPICQRLDKQTLRWIPLESDLRWQLGMIWREGVYLSHSAQAWLKCCEGFWLPQAS
>NZ_CP011612.1|WP_003031742.1|3545390_3545801_+|CidA/LrgA-family-protein
MAVAISRVTPAVIHRLQIPVQVLLYAGLFVFAQYLVSWLHLPLPANLVGMVLMLALIVCRVIPLNWIRAGARWLLAEMLLFFVPAVVAVVNYTQLLLVDGWRIFAVIAISTLMVLGATAWVVDKVYRYEMSRLNRE
>NZ_CP011612.1|WP_044702194.1|3545793_3546483_+|LrgB-family-protein
MSNFQLSLLCLVITLGIYFANKRLYRRFRKLPLMPLVLTPALLVLMLVFGHISWQNYIGESHWLLWLLGPATIAFAVPVYDNLAVIKRHWMSLTAGVVTATLVAVTSSVWLARLFMLPDEIQRSLAVRSVTTPFALAAAEPLGGQPDLVALFVVVTGVFGMAVGDVLFLRLSIREGMAKGAGFGAASHGAGTARSYELGQQEGVVASLVMMLSGVVMVLVAPLVARLMF
>NZ_CP011612.1|WP_003031747.1|3546528_3548178_-|cation/acetate-symporter-ActP
MKRVLTALAATLPFAANAADAISGAVQRQPTNWQAIVMFLIFVIFTLGITYWASKRVRSRNDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFGLNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFTEAMAVHPKGSAIMSPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGALIGGNNMAAVHLANAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFRKGATEREELKVSKITVLVLGVIAILLGVLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSRLTTRGAMLGGWLGLLTAVVLMILGPTIWVQILGHEKAIFPYEYPALFSISIAFLGIWFFSATDNSEEGNREREQFRAQFIRSQTGYGVEQGRAH
>NZ_CP011612.1|WP_003031750.1|3548174_3548489_-|DUF485-domain-containing-protein
MNDQIYQRIEDSARFRELVEKRQRFATILSIIMLAVYISFILLIAFAPGWLGTPLHAGTSVTRGIPIGVGVILISFILTGIYIWRANGEFDRLNNAVLHEVKAS
>NZ_CP011612.1|WP_003841063.1|3548726_3550685_-|acetate--CoA-ligase
MSQIHKHAIPANIADRCLINPEQYAEKYQQSVNEPDTFWGEQGKILDWIKPYSQVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQANGDRTAIIWEGDDATQSKNITYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITADEGVRAGRAIPLKKNVDDALKNPNVKTVEHVIVLKRTGGKTEWQEGRDLWWSDLIEKASSEHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHQGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMSQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPAIVDNEGNPLEGATEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
>NZ_CP011612.1|WP_003844735.1|3551118_3552555_+|ammonia-forming-nitrite-reductase-cytochrome-c552-subunit
MARIKSRVRRFFSLLVPLLFISAVHAEQTPVPAKTVTVEAKNEVFAPQHPDQYLSWKATSEQSAREDALAEDPRLVILWAGYPFSRDYNKPRGHAYAVTDVRETLRTGAPKTAEDGPLPMACWSCKSPDVARLIQKDGEDGYFHGKWARGGPEIVNNLGCGDCHNTASPDFAKGKPELTLSRPYAERAMETIGKPFEKAGRFDQQSMVCGQCHVEYYFDGKNKAVKFPWDDGMKVENMEKYYDTIAFSDWTNSLSKTPMLKAQHPEYETWSAGIHGKNNVTCIDCHMPKVQNAEGKIYTDHKIGNPFDNFAQTCANCHTQDKASLQKVVAERKQAIHDLKIKVEDQLVRAHFEAKAAWDAGATEAEMKPILEDIRHAQWRWDLSIASHGIHMHAPEEGLRMLGSAMDKAADARTKLVRLLATKGITHEIPLPDISTKEKAQAAIGLNMQQINAEKQDFIKTVIPQWEDQARKNGLLSQ
>NZ_CP011612.1|WP_003031758.1|3552599_3553166_+|cytochrome-c-nitrite-reductase-pentaheme-subunit
MSVLRSLLTAGVLASGLLWSLSGITATPTPQESDQRWTVTQQRNPDAACLDCHKPDTEGMHGKHAEAINPNNKLPVTCTNCHGQPSPNHREGVKDVMRFNEPMYNVEQQNSVCMSCHLPEQLQKAFWPHDVHVTKVACASCHSLHPKQDTMQTLSDKGRIKICVDCHSDQRNNPNFNPASVPLLKEHP
>NZ_CP011612.1|WP_003031761.1|3553162_3553834_+|cytochrome-c-nitrite-reductase-Fe-S-protein
MSCSRRQFITGVGALVAVSGTAGRVVAKTLNINGVRYGMVHDESLCIGCTACMDACREVNNVPEGVSRLTIIRSEPQGTFPDVKYRFFRHSCQHCDHAPCVDVCPTGASYRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVSKTADKCDFCRKTNLKAGKQPACVESCPTKALTFGNLDDPNSDISRLLQQKTTYRYKLALGTKPKVYRVPFKFGEVSQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 16302

Bacillus_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035862.1\|1701_2955_+	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
WP_003836843.1\|2959_4600_+	intermembrane transport protein PqiB	NA	NA	NA	NA
WP_003035868.1\|4596_5160_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_003035871.1\|5416_5584_+	ribosome modulation factor	NA	NA	NA	NA
WP_003035875.1\|5691_6210_-	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_003035878.1\|6278_8039_-\|protease	Lon protease family protein	NA	NA	NA	NA
WP_003035881.1\|8224_8677_+	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_003836839.1\|8768_9827_-	porin OmpA	NA	NA	NA	NA
WP_032936288.1\|10184_10694_-	cell division inhibitor SulA	NA	NA	NA	NA
WP_003035889.1\|10911_11526_+	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_032941200.1\|11503_13657_-	TIGR01666 family membrane protein	NA	NA	NA	NA
WP_003035892.1\|13675_14122_-	YccF domain-containing protein	NA	NA	NA	NA
WP_044700756.1\|14247_16302_+	DNA helicase IV	A0A1P8CWU5	Bacillus_phage	1.8e-09	24.0

DBSCAN-SWA_2

20552 : 21212

uncultured_Caudovirales_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035917.1\|20552_21212_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	8.9e-48	55.3

DBSCAN-SWA_3

26492 : 27308

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700745.1\|26492_27308_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.5e-15	30.7

DBSCAN-SWA_4

34981 : 35902

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700736.1\|34981_35902_-	curved DNA-binding protein	A0A1V0SIM1	Klosneuvirus	3.6e-10	39.0

DBSCAN-SWA_5

48716 : 49412

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836817.1\|48716_49412_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.9e-17	33.2

DBSCAN-SWA_6

54613 : 54787

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036022.1\|54613_54787_+	general stress protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_7

66937 : 67726

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036052.1\|66937_67726_+	phosphate starvation-inducible protein PhoH	R4II13	Cronobacter_phage	6.0e-91	77.1

DBSCAN-SWA_8

72567 : 76372

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700709.1\|72567_73506_+	glyoxylate/hydroxypyruvate reductase GhrA	A0A1B1IVB5	uncultured_Mediterranean_phage	3.2e-06	28.5
WP_003836800.1\|73592_74330_+	phosphatase	NA	NA	NA	NA
WP_003836798.1\|74353_74908_+	molecular chaperone	NA	NA	NA	NA
WP_044700707.1\|75009_75492_+	DUF1097 domain-containing protein	NA	NA	NA	NA
WP_003036082.1\|75538_76372_-	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	3.0e-40	39.7

DBSCAN-SWA_9

80561 : 81104

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036110.1\|80561_81104_+	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	3.2e-27	49.3

DBSCAN-SWA_10

89319 : 93101

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032948981.1\|89319_90741_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.2e-18	35.1
WP_044700699.1\|90804_92025_-	multidrug efflux MFS transporter MdtG	NA	NA	NA	NA
WP_003036136.1\|92180_93101_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	1.0e-57	41.6

DBSCAN-SWA_11

97820 : 98066

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036157.1\|97820_98066_-	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	1.1e-14	50.0

DBSCAN-SWA_12

113301 : 114252

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836755.1\|113301_114252_+	flagellar assembly peptidoglycan hydrolase FlgJ	S5M633	Brevibacillus_phage	1.6e-10	30.9

DBSCAN-SWA_13

128990 : 130117

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036255.1\|128990_129725_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	7.7e-16	34.1
WP_000103754.1\|129880_130117_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.5e-10	45.2

DBSCAN-SWA_14

133403 : 139415

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846791.1\|133403_134045_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	7.6e-28	37.5
WP_044700671.1\|134041_135046_+	DNA polymerase III subunit delta'	A0A1V0DYC6	Dinoroseobacter_phage	8.1e-08	34.8
WP_003036276.1\|135056_135854_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_003836725.1\|136147_137581_+	PTS glucose transporter subunit IIBC	NA	NA	NA	NA
WP_032936192.1\|137636_139415_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	4.1e-79	33.3

DBSCAN-SWA_15

144528 : 145296

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036301.1\|144528_145296_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	W6JKT0	Anomala_cuprea_entomopoxvirus	1.9e-12	27.0

DBSCAN-SWA_16

180050 : 180308

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030810.1\|180050_180308_+	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	2.8e-05	35.7

DBSCAN-SWA_17

187592 : 195303

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700614.1\|187592_188294_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.9e-36	40.3
WP_003030804.1\|188293_189538_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_003030802.1\|189627_190539_+	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_003030799.1\|190554_191376_+	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	3.3e-23	36.1
WP_003030797.1\|191475_192522_-	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
WP_003030794.1\|192549_193329_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_044700611.1\|193325_194183_-	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	4.3e-10	25.8
WP_003030791.1\|194166_195303_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	7.2e-29	40.3

DBSCAN-SWA_18

200304 : 291214

108

Enterobacteria_phage(23.38%)

holin,capsid,portal,tail,transposase,terminase,protease,tRNA,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700610.1\|200304_201591_-	DUF3596 domain-containing protein	A0A0U2JGI6	Escherichia_phage	5.5e-110	50.4
WP_032943036.1\|201590_201806_-	excisionase family protein	A0A0U2RY08	Escherichia_phage	5.7e-20	56.3
WP_052739229.1\|201872_204344_-	exonuclease	K7P6V4	Enterobacteria_phage	3.3e-111	38.6
WP_003832304.1\|204485_204812_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_044700608.1\|205184_205451_-	hypothetical protein	NA	NA	NA	NA
WP_003832307.1\|205787_206168_-	helix-turn-helix domain-containing protein	K7PH71	Enterobacterial_phage	6.5e-19	66.7
WP_003832309.1\|206273_206486_+	helix-turn-helix transcriptional regulator	A0A077K9X2	Edwardsiella_phage	3.8e-16	59.7
WP_044700607.1\|206489_207044_+	hypothetical protein	NA	NA	NA	NA
WP_072213458.1\|207993_208665_+	replication protein	A0A0U2JGJ0	Escherichia_phage	3.9e-67	77.5
WP_044700602.1\|208788_209142_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.8e-24	51.9
WP_038641374.1\|209189_209552_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_044700601.1\|209569_211321_+	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_038641369.1\|211367_212657_+	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	9.6e-171	73.8
WP_038641366.1\|212669_213095_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	4.3e-51	70.7
WP_038641364.1\|213162_213459_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044700597.1\|213558_214650_+	permease	NA	NA	NA	NA
WP_044700595.1\|214936_215170_+	DinI family protein	K7PM44	Enterobacteria_phage	6.0e-31	83.1
WP_071681812.1\|215215_215461_+	hypothetical protein	H6WRY6	Salmonella_phage	2.9e-20	63.0
WP_044700593.1\|215590_215791_+	hypothetical protein	H6WRY8	Salmonella_phage	1.2e-16	60.0
WP_044700591.1\|215793_216153_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	1.4e-42	65.3
WP_044700635.1\|217203_217818_+	hypothetical protein	H9C175	Pectobacterium_phage	1.0e-85	76.9
WP_044700589.1\|218570_218945_-	FlxA-like family protein	NA	NA	NA	NA
WP_044700587.1\|219089_219278_+	hypothetical protein	NA	NA	NA	NA
WP_044700586.1\|219431_219710_+\|holin	holin	K7P6H9	Enterobacteria_phage	1.2e-43	96.7
WP_044700584.1\|219681_220230_+	lysozyme	K7PM52	Enterobacteria_phage	1.0e-97	93.4
WP_044700581.1\|220226_220742_+	DUF2514 domain-containing protein	NA	NA	NA	NA
WP_044700579.1\|220738_220969_+	hypothetical protein	NA	NA	NA	NA
WP_044700634.1\|221359_221557_+	hypothetical protein	K7PHC3	Enterobacterial_phage	3.7e-26	90.8
WP_079938067.1\|221594_221750_+	DUF2514 family protein	NA	NA	NA	NA
WP_000066494.1\|222128_222341_+	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	4.6e-22	72.9
WP_057069020.1\|222351_222540_+	hypothetical protein	NA	NA	NA	NA
WP_000756041.1\|222613_222844_+	hypothetical protein	NA	NA	NA	NA
WP_044700578.1\|223048_223222_+	addiction module toxin, GnsA/GnsB family	NA	NA	NA	NA
WP_044700576.1\|223594_224134_-	cytochrome b	A0A0U2QLA7	Escherichia_phage	6.4e-44	79.0
WP_047715729.1\|224409_224772_+	HNH endonuclease	Q6UAS2	Klebsiella_phage	3.7e-56	86.7
WP_044700575.1\|225005_225503_+\|terminase	phage terminase small subunit P27 family	Q8HAD7	Salmonella_phage	8.4e-83	93.3
WP_016150031.1\|225499_227227_+\|terminase	terminase large subunit	Q8HAD6	Salmonella_phage	0.0e+00	92.8
WP_003832363.1\|227220_227400_+	hypothetical protein	Q6UAX9	Klebsiella_phage	3.3e-13	71.2
WP_044700572.1\|227399_228659_+\|portal	phage portal protein	Q6UAX8	Klebsiella_phage	7.1e-219	89.0
WP_044700569.1\|228695_229616_+	S49 family peptidase	Q6UAX7	Klebsiella_phage	6.0e-135	79.7
WP_044700568.1\|229688_230975_+\|capsid	phage major capsid protein	Q6UAX6	Klebsiella_phage	8.0e-210	87.6
WP_044700565.1\|231072_231450_+	hypothetical protein	Q6UAX5	Klebsiella_phage	3.2e-18	59.5
WP_003832371.1\|231430_231748_+\|head,tail	phage gp6-like head-tail connector protein	Q6UAX4	Klebsiella_phage	2.8e-39	79.6
WP_044700562.1\|231744_232095_+\|head	phage head closure protein	Q6UAX3	Klebsiella_phage	1.6e-43	73.9
WP_044700560.1\|232063_232453_+	hypothetical protein	Q6UAX2	Klebsiella_phage	1.6e-41	63.7
WP_044700558.1\|232449_232851_+	HK97 gp10 family phage protein	Q6UAX1	Klebsiella_phage	1.1e-56	85.0
WP_044700555.1\|232884_233367_+\|tail	major tail shaft subunit	Q6UAX0	Klebsiella_phage	4.7e-62	81.2
WP_044700554.1\|233428_233791_+\|tail	phage tail protein	Q6UAW8	Klebsiella_phage	2.5e-28	56.8
WP_071681837.1\|233805_234039_+	hypothetical protein	Q6UAW9	Klebsiella_phage	8.3e-25	66.2
WP_044700552.1\|234038_237329_+\|tail	phage tail tape measure protein	Q6UAW7	Klebsiella_phage	0.0e+00	65.3
WP_044700550.1\|237329_237662_+\|tail	phage tail protein	A0A0P0ZDL9	Stx2-converting_phage	2.0e-40	67.0
WP_044700547.1\|237670_238366_+\|tail	phage minor tail protein L	Q687F1	Enterobacteria_phage	1.8e-94	71.0
WP_044700545.1\|238377_239112_+\|tail	phage tail protein	K7PLW1	Enterobacteria_phage	1.9e-115	77.9
WP_071681833.1\|239009_239687_+\|tail	tail assembly protein	A0A2R9YJH6	Escherichia_phage	2.0e-71	71.1
WP_044700543.1\|239759_243161_+	host specificity protein J	K7PKJ2	Enterobacteria_phage	0.0e+00	70.4
WP_044700540.1\|245157_245742_+	DUF4376 domain-containing protein	Q7BQC6	Enterobacteria_phage	1.1e-46	47.9
WP_044700539.1\|245977_246706_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	7.8e-45	44.8
WP_044700535.1\|246909_247344_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_044700533.1\|247340_248060_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_044700531.1\|248056_249313_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_044700528.1\|249314_250037_+	DUF1365 domain-containing protein	NA	NA	NA	NA
WP_044700526.1\|250033_251254_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_044700524.1\|251250_251736_+	DUF2878 domain-containing protein	NA	NA	NA	NA
WP_044700522.1\|251732_252260_+	hypothetical protein	NA	NA	NA	NA
WP_044700520.1\|252256_252787_+	DUF3833 domain-containing protein	NA	NA	NA	NA
WP_044700519.1\|252800_253760_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_042922212.1\|254403_254781_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.4e-58	90.4
WP_042922210.1\|254780_255128_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.8e-61	98.3
WP_042922208.1\|255177_256716_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-271	91.0
WP_044700360.1\|256940_257429_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	8.9e-77	94.4
WP_047499052.1\|257428_259531_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	87.3
WP_001082414.1\|259527_259743_+	hypothetical protein	A5LH28	Enterobacteria_phage	1.5e-25	82.9
WP_047715730.1\|259739_261248_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	6.6e-256	86.1
WP_047715731.1\|261192_263217_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	0.0e+00	84.6
WP_047499162.1\|263309_263636_+	DUF2190 family protein	K7PJY3	Enterobacterial_phage	1.2e-29	59.3
WP_047715732.1\|263628_263904_+	ATP-binding protein	K7PH43	Enterobacteria_phage	6.8e-26	61.5
WP_044700352.1\|263913_264492_+\|tail	phage tail protein	K7PMB7	Enterobacterial_phage	1.2e-93	96.4
WP_044700350.1\|264488_264890_+\|tail	phage tail protein	K7PHM6	Enterobacterial_phage	9.8e-66	89.5
WP_044700348.1\|264899_265643_+\|tail	phage tail protein	K7PKX6	Enterobacterial_phage	8.1e-114	85.8
WP_047715733.1\|265653_266085_+\|tail	phage minor tail protein G	M9NZD7	Enterobacteria_phage	7.1e-54	74.1
WP_071845155.1\|266093_266408_+\|tail	phage tail assembly protein T	E4WL32	Enterobacteria_phage	2.4e-51	91.3
WP_047715734.1\|266391_269535_+\|tail	phage tail tape measure protein	E4WL33	Enterobacteria_phage	0.0e+00	85.9
WP_047715735.1\|269538_269886_+\|tail	phage tail protein	K7PJT2	Enterobacteria_phage	9.5e-41	69.6
WP_047715736.1\|269882_270638_+\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	2.5e-131	86.5
WP_047715737.1\|270639_271350_+	C40 family peptidase	K7PGR2	Enterobacteria_phage	1.6e-135	91.5
WP_047715738.1\|271356_271800_-	Arc family DNA-binding protein	G9L6D6	Escherichia_phage	4.9e-34	60.7
WP_071698655.1\|271919_272087_+	Arc family DNA binding domain-containing protein	G9L6D7	Escherichia_phage	6.6e-16	72.7
WP_080964717.1\|272160_272742_+	Bro-N domain-containing protein	H6WRU8	Salmonella_phage	7.7e-27	38.8
WP_047715739.1\|272819_273563_+	hypothetical protein	A0A0P0ZDC0	Stx2-converting_phage	7.9e-61	53.1
WP_008322436.1\|273673_274099_+	hypothetical protein	K7PLY8	Enterobacterial_phage	6.6e-12	36.9
WP_047715740.1\|274154_274745_+\|tail	tail assembly protein	K7PH91	Enterobacterial_phage	2.4e-76	79.0
WP_047715741.1\|274798_277984_+	host specificity protein J	O64335	Escherichia_phage	0.0e+00	87.5
WP_047715743.1\|277983_278298_+	hypothetical protein	K7PJS1	Enterobacterial_phage	4.6e-26	56.9
WP_047715745.1\|278298_278973_+	hypothetical protein	O64337	Escherichia_phage	2.5e-53	50.7
WP_046155137.1\|279081_279321_+	hypothetical protein	K7PLZ0	Enterobacterial_phage	7.0e-19	57.1
WP_047715746.1\|279379_280453_+\|tail	tail fiber domain-containing protein	Q5G8V6	Enterobacteria_phage	3.8e-88	52.1
WP_047715748.1\|280520_280763_-	DinI family protein	Q6UAW0	Klebsiella_phage	8.4e-28	75.3
WP_044700301.1\|281128_281695_-	hydrolase	NA	NA	NA	NA
WP_003034862.1\|281983_283756_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_003034863.1\|283757_284201_+	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_003034865.1\|284229_284973_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003034867.1\|285007_285529_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
WP_003034869.1\|285609_286221_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003034872.1\|286229_287240_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.6e-08	25.4
WP_003034874.1\|287318_288104_-	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_003034877.1\|288100_288856_-	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	6.5e-18	28.3
WP_003841677.1\|288934_289879_+	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_003034883.1\|289894_291214_+	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	36.8

DBSCAN-SWA_19

295147 : 296623

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034896.1\|295147_296623_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.3e-78	37.1

DBSCAN-SWA_20

304372 : 308859

Klebsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034918.1\|304372_305035_-	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	7.0e-08	31.1
WP_003841657.1\|305058_305715_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_003034925.1\|305821_306052_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.0e-14	60.3
WP_003034928.1\|306195_306570_+	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_003034931.1\|306573_307446_+	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_044700293.1\|307466_307805_+	YebY family protein	NA	NA	NA	NA
WP_003034937.1\|308217_308859_+	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	8.7e-56	50.5

DBSCAN-SWA_21

316305 : 318354

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034960.1\|316305_318354_+	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-87	33.7

DBSCAN-SWA_22

337083 : 338204

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087451024.1\|337083_338204_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_23

342814 : 343465

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700253.1\|342814_343465_+	lytic transglycosylase domain-containing protein	U5PVY0	Bacillus_phage	6.0e-12	36.1

DBSCAN-SWA_24

350456 : 350666

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062678.1\|350456_350666_+	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_25

358163 : 359723

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844070.1\|358163_359723_+	CNNM family cation transport protein YoaE	A0A0R6PEZ3	Moraxella_phage	5.1e-41	45.4

DBSCAN-SWA_26

363591 : 370942

Pandoravirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700240.1\|363591_364953_-	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	2.9e-40	40.2
WP_003020986.1\|365036_365216_+	YoaH family protein	NA	NA	NA	NA
WP_003020984.1\|365222_365567_-	RidA family protein	NA	NA	NA	NA
WP_003020980.1\|365708_367619_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	9.1e-93	33.1
WP_044700237.1\|367677_368373_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	A0A0R6PI74	Moraxella_phage	5.8e-05	35.4
WP_003020975.1\|368467_369052_+	Slp family lipoprotein	NA	NA	NA	NA
WP_003020970.1\|369256_370942_+	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	3.4e-35	25.3

DBSCAN-SWA_27

394300 : 395062

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700223.1\|394300_395062_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.8e-13	30.1

DBSCAN-SWA_28

409135 : 409867

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841536.1\|409135_409867_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.4e-54	50.3

DBSCAN-SWA_29

422774 : 428514

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008784983.1\|422774_424160_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.3e-27	26.2
WP_044700197.1\|424175_425639_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_003020797.1\|425759_427442_-	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	1.3e-21	22.5
WP_001518537.1\|427566_428514_-	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	8.6e-44	37.8

DBSCAN-SWA_30

431761 : 435768

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700189.1\|431761_432844_+	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	4.3e-07	38.8
WP_044700188.1\|432843_433677_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003020779.1\|433673_434066_+	SirB family protein	NA	NA	NA	NA
WP_003020775.1\|434068_434878_+	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_003020772.1\|434913_435768_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.4e-45	38.8

DBSCAN-SWA_31

448990 : 459411

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150347.1\|448990_450529_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.8e-19	40.5
WP_016150346.1\|450525_451236_+	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_003020743.1\|451235_451913_+	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_003020737.1\|453039_453882_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	9.8e-15	48.8
WP_003841307.1\|453937_454393_-	YchJ family protein	NA	NA	NA	NA
WP_003020732.1\|454504_455416_+	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_003841305.1\|455506_456520_+	two-component system response regulator RssB	NA	NA	NA	NA
WP_003020727.1\|456724_457633_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.7e-60	47.5
WP_003020723.1\|457769_458183_-	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
WP_044700177.1\|458793_459411_+	thymidine kinase	A0A0A0YP64	Citrobacter_phage	8.6e-53	54.3

DBSCAN-SWA_32

467842 : 470739

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003833364.1\|467842_468856_+	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppD	G9BWD6	Planktothrix_phage	4.5e-14	29.4
WP_003020696.1\|468852_469857_+	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G3M9Y6	Bacillus_virus	6.8e-15	30.2
WP_003020693.1\|469902_470739_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.4e-08	40.0

DBSCAN-SWA_33

479730 : 486203

Acinetobacter_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047715754.1\|479730_481203_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.1e-16	29.8
WP_044700166.1\|481235_482042_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_044700164.1\|482041_483235_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_003841280.1\|483245_484604_-	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	1.0e-37	40.7
WP_003020639.1\|484607_486203_-	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	3.2e-51	38.6

DBSCAN-SWA_34

491181 : 496569

Chrysochromulina_ericina_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003843987.1\|491181_491943_-	YciK family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	3.0e-07	23.7
WP_003843986.1\|492164_493211_+\|protease	protease SohB	NA	NA	NA	NA
WP_044700155.1\|493321_493573_-	YciN family protein	NA	NA	NA	NA
WP_046155113.1\|493971_496569_+	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	1.5e-85	34.7

DBSCAN-SWA_35

501413 : 502004

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020601.1\|501413_502004_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.7e-43	48.4

DBSCAN-SWA_36

509908 : 511843

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700145.1\|509908_511843_-	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	5.9e-07	24.5

DBSCAN-SWA_37

515233 : 517034

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020558.1\|515233_516040_-	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.3e-13	27.4
WP_003020556.1\|516041_517034_-	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	4.7e-08	24.7

DBSCAN-SWA_38

534992 : 536075

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700116.1\|534992_536075_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-23	34.7

DBSCAN-SWA_39

548359 : 551471

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003843948.1\|548359_549130_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.6e-18	29.1
WP_044700105.1\|549250_549634_+	VOC family protein	NA	NA	NA	NA
WP_044700102.1\|549967_550375_+	cupin domain-containing protein	NA	NA	NA	NA
WP_044700101.1\|550418_551471_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	3.5e-86	46.4

DBSCAN-SWA_40

555141 : 567621

Streptococcus_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032935619.1\|555141_555657_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.2e-23	54.5
WP_032935621.1\|555882_556446_+	DNA endonuclease SmrA	NA	NA	NA	NA
WP_003020387.1\|556458_557691_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	9.0e-17	34.4
WP_044700095.1\|557758_559861_-	EAL domain-containing protein	G3MA91	Bacillus_virus	2.0e-16	31.0
WP_044700094.1\|560272_561382_+	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-09	23.0
WP_003020379.1\|561536_562520_+	zinc transporter ZntB	NA	NA	NA	NA
WP_003843930.1\|562991_564365_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.6e-53	32.0
WP_003833209.1\|564458_565394_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.1e-139	93.8
WP_003020369.1\|565592_566027_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	9.4e-30	52.1
WP_003020366.1\|566108_566321_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_032935630.1\|566466_567621_-	porin OmpC	Q1MVN1	Enterobacteria_phage	1.5e-114	56.7

DBSCAN-SWA_41

572597 : 573587

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020354.1\|572597_573587_-	2-hydroxyacid dehydrogenase	M1HMI7	Paramecium_bursaria_Chlorella_virus	3.3e-70	42.8

DBSCAN-SWA_42

578528 : 582431

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700087.1\|578528_582431_+	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	7.6e-54	29.7

DBSCAN-SWA_43

587233 : 589627

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700084.1\|587233_587764_+	cytochrome b561	A0A0U2QLA7	Escherichia_phage	1.4e-19	44.9
WP_003020321.1\|587936_588356_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	3.9e-33	58.5
WP_047715763.1\|588358_589627_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	2.6e-197	78.4

DBSCAN-SWA_44

596395 : 599372

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020293.1\|596395_597514_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	3.6e-33	29.6
WP_003836088.1\|597683_599372_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-15	28.2

DBSCAN-SWA_45

621230 : 623198

Phage_TP(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702349.1\|621230_623198_+	23S rRNA 5-hydroxycytidine C2501 synthase	Q6DW11	Phage_TP	1.6e-23	27.8

DBSCAN-SWA_46

629571 : 630588

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020210.1\|629571_630588_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.5e-25	58.9

DBSCAN-SWA_47

650228 : 651770

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702330.1\|650228_651770_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.3e-36	54.1

DBSCAN-SWA_48

658120 : 658894

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702321.1\|658120_658894_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-18	31.0

DBSCAN-SWA_49

669255 : 670800

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020103.1\|669255_670800_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_50

678890 : 679973

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836220.1\|678890_679973_-	porin OmpD	Q1MVN1	Enterobacteria_phage	4.2e-143	70.4

DBSCAN-SWA_51

686327 : 688725

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032935729.1\|686327_686930_+	inorganic diphosphatase	A0A1B1ISK6	uncultured_Mediterranean_phage	2.6e-22	39.1
WP_032935731.1\|687009_688725_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	1.2e-35	25.9

DBSCAN-SWA_52

698520 : 700435

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032949300.1\|698520_699456_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.2e-14	28.2
WP_003836252.1\|699448_700435_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	32.0

DBSCAN-SWA_53

706324 : 708268

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702437.1\|706324_708268_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-11	32.8

DBSCAN-SWA_54

713725 : 715465

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702443.1\|713725_715465_-	type I secretion system permease/ATPase	F2Y1V6	Organic_Lake_phycodnavirus	7.7e-14	29.8

DBSCAN-SWA_55

735658 : 737236

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699822.1\|735658_737236_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-12	21.6

DBSCAN-SWA_56

742538 : 747036

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003032424.1\|742538_742922_+	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	3.6e-09	32.3
WP_003032422.1\|742952_743171_+	multiple antibiotic resistance protein MarB	NA	NA	NA	NA
WP_003032420.1\|743201_744101_-	O-acetylserine/cysteine exporter	NA	NA	NA	NA
WP_044699830.1\|744299_745487_+	efflux MFS transporter YdeE	NA	NA	NA	NA
WP_003032416.1\|745530_746229_-	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	2.6e-13	25.6
WP_032935768.1\|746238_747036_-	urea ABC transporter ATP-binding protein UrtD	A0A285PWH2	Cedratvirus	2.1e-11	27.5

DBSCAN-SWA_57

751863 : 752790

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699837.1\|751863_752790_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.2e-19	36.0

DBSCAN-SWA_58

757388 : 769290

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003032393.1\|757388_757592_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	2.9e-13	55.2
WP_044699842.1\|757667_759134_-	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	2.4e-45	32.2
WP_044699843.1\|759297_760632_-	MHS family MFS transporter	NA	NA	NA	NA
WP_003032386.1\|760692_761907_-	starvation-sensing protein RspA	Q6A202	Oenococcus_phage	2.5e-48	29.9
WP_044699845.1\|762015_762342_-	YnfA family protein	A0A218MNG8	uncultured_virus	9.9e-24	54.9
WP_003032382.1\|762495_762837_+	DUF1283 family protein	NA	NA	NA	NA
WP_003032379.1\|762872_763433_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_044699847.1\|763440_764187_-	YnfC family lipoprotein	NA	NA	NA	NA
WP_086538958.1\|764253_764562_+	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_047715781.1\|764710_767149_+	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	7.8e-214	48.5
WP_044699855.1\|767159_767777_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	7.3e-76	59.6
WP_044699858.1\|767778_768633_+	dimethyl sulfoxide reductase anchor subunit family protein	NA	NA	NA	NA
WP_003028918.1\|768675_769290_+	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	4.0e-26	36.0

DBSCAN-SWA_59

775947 : 783195

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028927.1\|775947_777438_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.1e-24	30.3
WP_003028928.1\|777434_778157_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-35	36.6
WP_044699866.1\|778346_779351_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_003843582.1\|779350_779977_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_047715784.1\|780243_781029_-	hypothetical protein	A0A291AY49	Shigella_phage	2.7e-91	70.0
WP_047715787.1\|781122_783195_-	tape measure protein	A0A0D4DAK9	Salmonella_phage	2.4e-38	29.1

DBSCAN-SWA_60

788023 : 790121

Mycobacterium_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047715799.1\|788023_788575_-	recombinase family protein	G8I4U3	Mycobacterium_phage	3.3e-27	40.3
WP_087451024.1\|789001_790121_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_61

811735 : 813037

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028962.1\|811735_813037_+	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	5.2e-15	23.8

DBSCAN-SWA_62

838148 : 839423

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029168.1\|838148_839423_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	6.5e-87	42.6

DBSCAN-SWA_63

846341 : 846866

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029187.1\|846341_846866_-	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	1.7e-46	55.7

DBSCAN-SWA_64

851968 : 863011

Streptomyces_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699906.1\|851968_852799_+	C40 family peptidase	A0A2H5BM69	Streptomyces_phage	3.2e-18	41.6
WP_003029205.1\|852926_853508_+	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	3.4e-43	46.0
WP_044699907.1\|853547_854717_-	MFS transporter	NA	NA	NA	NA
WP_003029209.1\|854893_854983_-	stress response protein YnhF	NA	NA	NA	NA
WP_003029211.1\|855280_856306_+	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	8.2e-32	31.3
WP_047715818.1\|856302_857235_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003843529.1\|857348_858554_+	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
WP_044699909.1\|858844_859993_+	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.6e-84	44.9
WP_044699911.1\|860034_860682_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	6.8e-24	37.8
WP_044699913.1\|860899_862273_+	multidrug efflux MATE transporter MdtK	NA	NA	NA	NA
WP_044699916.1\|862312_863011_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.3e-09	30.0

DBSCAN-SWA_65

869629 : 876424

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699924.1\|869629_870112_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	3.3e-23	40.7
WP_044699926.1\|870277_871387_+	AI-2E family transporter	NA	NA	NA	NA
WP_044699928.1\|871506_873291_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.8e-19	35.0
WP_044699929.1\|873492_874497_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003029256.1\|874917_875664_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.5e-06	32.4
WP_003836487.1\|875734_876424_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	3.1e-11	29.1

DBSCAN-SWA_66

887368 : 893189

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836510.1\|887368_888121_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	6.7e-07	30.8
WP_003029283.1\|888117_889122_-	iron ABC transporter permease	NA	NA	NA	NA
WP_032935872.1\|889108_890164_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032935874.1\|890344_891607_-	4-aminobutyrate transaminase	A0A1V0SKB7	Klosneuvirus	6.1e-21	25.4
WP_044699937.1\|891713_893189_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.0e-15	27.8

DBSCAN-SWA_67

903122 : 907669

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029322.1\|903122_903941_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-37	43.6
WP_003029324.1\|903940_904726_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032935888.1\|904715_905393_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003836540.1\|905402_906215_-	hypothetical protein	A0A077K9W7	Edwardsiella_phage	6.8e-05	32.5
WP_003029330.1\|906218_907004_-	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_003029332.1\|907000_907669_-	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	4.1e-24	37.8

DBSCAN-SWA_68

914560 : 924793

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699953.1\|914560_915295_+	tetrathionate reductase subunit TtrB	A0A077SL61	Escherichia_phage	1.1e-22	40.0
WP_044699954.1\|915295_916318_+	tetrathionate reductase subunit TtrC	NA	NA	NA	NA
WP_044699957.1\|916310_919376_+	tetrathionate reductase subunit TtrA	A0A077SK27	Escherichia_phage	4.7e-06	26.0
WP_044699958.1\|920713_921682_+	hypothetical protein	A0A2H4J6N0	uncultured_Caudovirales_phage	1.2e-16	24.2
WP_003836560.1\|921650_922067_+	hypothetical protein	NA	NA	NA	NA
WP_155404704.1\|922106_922253_-	hypothetical protein	NA	NA	NA	NA
WP_016150148.1\|922275_923088_-	hypothetical protein	NA	NA	NA	NA
WP_003029361.1\|923109_923778_-	ABC transporter permease	NA	NA	NA	NA
WP_016150147.1\|923770_924793_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-13	23.4

DBSCAN-SWA_69

933581 : 938672

environmental_halophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699968.1\|933581_934802_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	8.7e-97	43.1
WP_003836582.1\|934798_936070_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_044699970.1\|936044_936791_-	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	5.1e-07	24.8
WP_003836585.1\|936807_938295_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_003029385.1\|938303_938672_-	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	5.6e-15	39.4

DBSCAN-SWA_70

950006 : 951023

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087121885.1\|950006_951023_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.1e-185	99.7

DBSCAN-SWA_71

960344 : 966762

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699981.1\|960344_961982_+	medium-chain fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	7.7e-32	29.7
WP_003030548.1\|962049_964428_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.0e-169	36.2
WP_003030553.1\|964755_965589_+	posphoenolpyruvate synthetase regulatory kinase/phosphorylase PpsR	NA	NA	NA	NA
WP_003030555.1\|965715_966762_+	3-deoxy-7-phosphoheptulonate synthase AroH	A0A0B5IW14	Pandoravirus	8.8e-82	47.1

DBSCAN-SWA_72

972058 : 985646

Tupanvirus(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836641.1\|972058_972838_+	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	7.9e-11	26.7
WP_044699989.1\|972834_974277_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	4.5e-52	35.3
WP_003836643.1\|974338_975052_-	EAL domain-containing protein	NA	NA	NA	NA
WP_003836644.1\|975368_975833_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.5e-14	38.2
WP_003030567.1\|975910_976660_-	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	9.3e-09	30.3
WP_003030569.1\|976659_977211_-	glutathione peroxidase	NA	NA	NA	NA
WP_003832584.1\|977271_978252_-	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	6.7e-15	24.8
WP_003030571.1\|978405_978705_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_003030574.1\|978709_981097_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003832580.1\|981112_982096_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.4e-33	38.5
WP_152659856.1\|982295_982427_-	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_003030578.1\|982465_982822_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003030583.1\|982877_983075_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_048997935.1\|983171_983714_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	8.2e-15	32.9
WP_003832572.1\|983717_985646_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.4e-127	36.8

DBSCAN-SWA_73

990912 : 996662

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840907.1\|990912_991674_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	3.1e-20	32.1
WP_086551139.1\|991757_992357_+	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	1.0e-05	33.6
WP_003843455.1\|992492_993884_+	cystine/sulfocysteine:cation symporter	NA	NA	NA	NA
WP_071524328.1\|993947_994211_-	cell division activator CedA	NA	NA	NA	NA
WP_003843454.1\|994403_996662_+	catalase HPII	A0A2K9L572	Tupanvirus	1.7e-138	47.6

DBSCAN-SWA_74

1002811 : 1003642

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840899.1\|1002811_1003642_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.0e-73	54.9

DBSCAN-SWA_75

1011188 : 1012409

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840894.1\|1011188_1012409_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	4.2e-27	28.6

DBSCAN-SWA_76

1017943 : 1018576

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700015.1\|1017943_1018576_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.4e-12	32.3

DBSCAN-SWA_77

1023599 : 1025546

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700023.1\|1023599_1025546_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.3e-40	29.7

DBSCAN-SWA_78

1030374 : 1034434

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155267879.1\|1030374_1031019_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	9.4e-18	37.2
WP_003840879.1\|1031056_1032415_-	MFS transporter	NA	NA	NA	NA
WP_003030679.1\|1032555_1033314_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_044700027.1\|1033450_1034434_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	7.4e-06	23.4

DBSCAN-SWA_79

1040096 : 1041350

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700031.1\|1040096_1041350_+	glycoside hydrolase family 18 protein	A0A2K9L3D4	Tupanvirus	4.1e-25	30.7

DBSCAN-SWA_80

1049299 : 1053073

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030708.1\|1049299_1050583_+	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	1.9e-09	26.6
WP_044700039.1\|1050648_1051419_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_044700042.1\|1051582_1053073_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.4e-11	28.8

DBSCAN-SWA_81

1057977 : 1059003

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840865.1\|1057977_1059003_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.8e-10	26.3

DBSCAN-SWA_82

1074893 : 1084584

uncultured_Caudovirales_phage(44.44%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100216202.1\|1074893_1076061_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.4e-166	89.5
WP_032949082.1\|1076826_1077099_+	hypothetical protein	NA	NA	NA	NA
WP_044702845.1\|1077364_1077619_-	hypothetical protein	NA	NA	NA	NA
WP_032948081.1\|1077629_1078115_-	outer membrane beta-barrel protein	A0A1B0VBR9	Salmonella_phage	2.3e-08	34.9
WP_044702844.1\|1079003_1079429_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	4.7e-50	70.7
WP_016150088.1\|1079441_1080731_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	3.2e-166	70.4
WP_047715979.1\|1080775_1081096_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	2.5e-19	44.8
WP_008320415.1\|1081181_1081880_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.8e-89	68.1
WP_071681874.1\|1081956_1082190_-	DNA polymerase V	A0A222YZE2	Escherichia_phage	6.6e-22	80.3
WP_003840850.1\|1082268_1082511_+	DinI family protein	Q6UAW0	Klebsiella_phage	1.5e-29	77.9
WP_003030767.1\|1082685_1083195_+	VTT domain-containing protein	NA	NA	NA	NA
WP_003841892.1\|1083333_1084584_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.9e-22	96.3

DBSCAN-SWA_83

1088693 : 1123156

Escherichia_phage(17.65%)

holin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032949068.1\|1088693_1090064_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.7e-107	44.6
WP_044702837.1\|1090500_1091169_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.3e-81	60.8
WP_044702835.1\|1091473_1091710_-	hypothetical protein	NA	NA	NA	NA
WP_042922208.1\|1093149_1094688_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-271	91.0
WP_042922210.1\|1094737_1095085_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.8e-61	98.3
WP_042922212.1\|1095084_1095462_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.4e-58	90.4
WP_044703081.1\|1095625_1095829_-	hypothetical protein	A0A1W6JPG4	Morganella_phage	2.0e-06	62.9
WP_087451024.1\|1096738_1097858_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_044702995.1\|1098120_1098645_-	Rha family transcriptional regulator	G8C7W4	Escherichia_phage	4.9e-89	96.0
WP_044702996.1\|1098836_1099073_-	hypothetical protein	NA	NA	NA	NA
WP_080941989.1\|1099142_1099436_-	hypothetical protein	Q8W634	Enterobacteria_phage	1.4e-21	61.9
WP_047715857.1\|1099623_1099893_-	hypothetical protein	G8C7W1	Escherichia_phage	9.0e-23	71.3
WP_044703002.1\|1099900_1100518_-	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	4.4e-81	72.2
WP_046155109.1\|1100517_1100799_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	5.5e-39	88.2
WP_008323296.1\|1100785_1101181_-\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	2.6e-50	81.7
WP_044703006.1\|1101280_1101859_-	hypothetical protein	NA	NA	NA	NA
WP_047715860.1\|1102455_1103034_-	DUF1133 family protein	A0A0U2S606	Escherichia_phage	1.7e-47	56.7
WP_047715863.1\|1103048_1104038_-	DUF968 domain-containing protein	K7PJS6	Enterobacterial_phage	1.1e-142	71.7
WP_080964714.1\|1104034_1104760_-	phage antirepressor KilAC domain-containing protein	G0ZND1	Cronobacter_phage	2.0e-56	54.0
WP_047715865.1\|1104776_1105166_-	RusA family crossover junction endodeoxyribonuclease	A5LH74	Enterobacteria_phage	7.9e-44	66.7
WP_047715867.1\|1105162_1105483_-	LexA family transcriptional regulator	K7PHB4	Enterobacterial_phage	2.2e-28	57.7
WP_047715870.1\|1105484_1105703_-	hypothetical protein	NA	NA	NA	NA
WP_047715872.1\|1105689_1106358_-	DNA methyltransferase	I6PDF5	Cronobacter_phage	9.9e-95	79.1
WP_047715874.1\|1106357_1106801_-	hypothetical protein	U5P0U0	Shigella_phage	4.8e-13	31.1
WP_047715876.1\|1106803_1107787_-	hypothetical protein	S5FM81	Shigella_phage	2.6e-59	71.9
WP_047715878.1\|1108119_1108674_-	hypothetical protein	U5P4K1	Shigella_phage	2.2e-47	51.9
WP_047715881.1\|1108702_1108954_-	hypothetical protein	A0A2I6PIE5	Escherichia_phage	2.7e-13	52.2
WP_165919942.1\|1109033_1109741_+	helix-turn-helix domain-containing protein	A0A2I6PIE7	Escherichia_phage	2.4e-75	55.8
WP_047715886.1\|1109757_1110192_+	hypothetical protein	NA	NA	NA	NA
WP_047715889.1\|1110191_1110542_+	hypothetical protein	NA	NA	NA	NA
WP_047715892.1\|1110580_1110787_-	hypothetical protein	K7P7I0	Enterobacteria_phage	7.4e-17	69.1
WP_047715894.1\|1111956_1112784_+	hypothetical protein	K7PKM7	Enterobacterial_phage	6.9e-122	84.4
WP_052941164.1\|1112780_1113272_+	hypothetical protein	A0A0F6N6A6	Escherichia_phage	4.7e-09	40.5
WP_047715896.1\|1113268_1113760_+	hypothetical protein	NA	NA	NA	NA
WP_052941163.1\|1113756_1114173_+	hypothetical protein	A0A125RNQ8	Pseudomonas_phage	6.3e-07	31.1
WP_047715899.1\|1114174_1114597_+	HNH endonuclease	C6ZR29	Salmonella_phage	2.5e-67	85.0
WP_047715901.1\|1114593_1115028_+	hypothetical protein	NA	NA	NA	NA
WP_003034696.1\|1115067_1115304_+	excisionase family protein	Q8W657	Enterobacteria_phage	2.1e-39	92.3
WP_047715903.1\|1115362_1116676_+	DUF3596 domain-containing protein	Q8W658	Enterobacteria_phage	3.9e-236	89.9
WP_044701478.1\|1116654_1117428_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.0e-55	78.7
WP_003034689.1\|1117480_1117876_+	MAPEG family protein	NA	NA	NA	NA
WP_003034686.1\|1117916_1118660_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	3.2e-25	31.3
WP_003839177.1\|1118656_1119625_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_044701481.1\|1119868_1120615_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_003034677.1\|1120617_1121184_-	VOC family protein	NA	NA	NA	NA
WP_003034673.1\|1121422_1123156_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	1.7e-85	33.6

DBSCAN-SWA_84

1131169 : 1142164

Bacillus_thuringiensis_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034656.1\|1131169_1131559_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3
WP_044701490.1\|1131576_1132626_-	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	1.8e-05	32.0
WP_003034649.1\|1132622_1133495_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_044701491.1\|1133514_1135116_-	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9
WP_003833879.1\|1135159_1136815_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-08	24.8
WP_044701493.1\|1137221_1138493_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_044701495.1\|1138603_1142164_-	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.8e-30	25.4

DBSCAN-SWA_85

1152557 : 1154072

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701499.1\|1152557_1154072_-	arabinose ABC transporter ATP binding protein AraG	A0A285PWH2	Cedratvirus	1.3e-12	28.7

DBSCAN-SWA_86

1172678 : 1173431

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030477.1\|1172678_1173431_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	6.4e-26	34.4

DBSCAN-SWA_87

1200148 : 1204404

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839067.1\|1200148_1200616_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	8.9e-34	48.3
WP_032933152.1\|1200596_1202027_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	4.3e-103	55.2
WP_003839062.1\|1202103_1202796_-	phosphohydrolase	S4W232	Pandoravirus	8.0e-07	27.1
WP_032936822.1\|1203237_1204404_+	porin	Q1MVN1	Enterobacteria_phage	1.9e-109	57.0

DBSCAN-SWA_88

1209477 : 1210161

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844224.1\|1209477_1210161_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-27	37.2

DBSCAN-SWA_89

1215130 : 1215946

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839037.1\|1215130_1215946_-	energy-coupling factor ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.5e-07	24.2

DBSCAN-SWA_90

1229440 : 1230250

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030258.1\|1229440_1230250_-	propanediol diffusion facilitator PduF	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.7e-11	27.8

DBSCAN-SWA_91

1249907 : 1252562

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701552.1\|1249907_1251080_-	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	3.4e-199	87.4
WP_044701554.1\|1251219_1251987_-	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_003844270.1\|1251983_1252562_-	thiosulfate reductase electron transport protein PhsB	A0A077SL61	Escherichia_phage	2.1e-21	38.0

DBSCAN-SWA_92

1262583 : 1263483

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030161.1\|1262583_1263483_+	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_93

1271066 : 1278691

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701936.1\|1271066_1272071_+	NAD-dependent epimerase	A0A0K0KW07	Prochlorococcus_phage	1.9e-17	32.2
WP_044701934.1\|1272129_1273296_-	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	1.5e-114	55.0
WP_032936740.1\|1273494_1274901_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.4e-37	28.5
WP_044701931.1\|1275233_1276106_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.7e-107	65.2
WP_044701929.1\|1276144_1277044_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.0e-30	36.0
WP_003844298.1\|1277043_1278132_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.1e-98	52.0
WP_003844299.1\|1278148_1278691_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.3e-56	60.7

DBSCAN-SWA_94

1285575 : 1288029

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844310.1\|1285575_1286469_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	3.6e-44	39.7
WP_044701921.1\|1286634_1288029_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	4.0e-21	34.6

DBSCAN-SWA_95

1293490 : 1300228

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701918.1\|1293490_1294861_-	colanic acid biosynthesis phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	5.4e-31	26.3
WP_044701916.1\|1294997_1296434_-	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	5.9e-52	30.5
WP_044701914.1\|1296436_1297660_-	colanic acid biosynthesis fucosyltransferase WcaI	NA	NA	NA	NA
WP_044701913.1\|1297656_1298136_-	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
WP_003841801.1\|1298138_1299104_-	GDP-L-fucose synthase	M1I5W5	Acanthocystis_turfacea_Chlorella_virus	6.9e-89	51.6
WP_003036748.1\|1299106_1300228_-	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	65.5

DBSCAN-SWA_96

1303974 : 1314613

Streptococcus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844327.1\|1303974_1304463_-	colanic acid biosynthesis acetyltransferase WcaB	A0A191KBJ5	Streptococcus_virus	1.2e-09	41.0
WP_003841790.1\|1304465_1305308_-	colanic acid biosynthesis glycosyltransferase WcaA	NA	NA	NA	NA
WP_044701908.1\|1305380_1307543_-	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	2.9e-18	30.8
WP_003036763.1\|1307539_1307989_-	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
WP_003036765.1\|1307994_1309134_-	polysaccharide export protein	NA	NA	NA	NA
WP_044701906.1\|1309790_1311374_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	5.3e-38	45.4
WP_044701904.1\|1311418_1313272_-	outer membrane assembly protein AsmA	NA	NA	NA	NA
WP_003036774.1\|1313298_1313880_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	3.2e-33	43.2
WP_003841777.1\|1313971_1314613_-	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	38.3

DBSCAN-SWA_97

1319231 : 1320584

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701901.1\|1319231_1320584_+	molecular chaperone	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.9e-05	20.5

DBSCAN-SWA_98

1325391 : 1385295

Bacillus_phage(14.29%)

capsid,transposase,integrase,protease,tRNA

attL 1369995:1370042|attR 1385379:1385426

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701897.1\|1325391_1328472_+	multidrug efflux RND transporter permease subunit MdtC	S5VTK5	Leptospira_phage	3.4e-65	22.7
WP_003036790.1\|1328468_1329881_+	MFS transporter	NA	NA	NA	NA
WP_003844344.1\|1329880_1331284_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	5.0e-32	29.2
WP_003036797.1\|1331280_1332003_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	9.2e-30	32.7
WP_003841759.1\|1332138_1332471_+	YegP family protein	NA	NA	NA	NA
WP_044701894.1\|1332630_1333992_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	5.3e-204	92.9
WP_003036804.1\|1334261_1336538_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.1
WP_003036810.1\|1336568_1336889_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-13	45.7
WP_003036813.1\|1337212_1337437_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_003840216.1\|1337511_1339458_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.4e-40	41.8
WP_016150621.1\|1339454_1340570_-	macrolide transporter subunit MacA	NA	NA	NA	NA
WP_016150622.1\|1340729_1341677_+	DUF535 domain-containing protein	NA	NA	NA	NA
WP_003036822.1\|1341673_1343332_-	ATP-dependent endonuclease	NA	NA	NA	NA
WP_003840208.1\|1343703_1344399_+	aquaporin Z	NA	NA	NA	NA
WP_044701893.1\|1344543_1345443_+	lysine exporter LysO family protein	NA	NA	NA	NA
WP_044701892.1\|1345598_1347251_+	hydroxylamine reductase	NA	NA	NA	NA
WP_003027256.1\|1347261_1348230_+	NADH oxidoreductase	NA	NA	NA	NA
WP_044701891.1\|1348429_1350043_+	FAD-NAD(P)-binding protein	NA	NA	NA	NA
WP_044701888.1\|1350118_1350553_-	DoxX family protein	NA	NA	NA	NA
WP_003027264.1\|1350705_1352424_+	ubiquinone-dependent pyruvate dehydrogenase	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	8.9e-31	23.8
WP_044701886.1\|1352460_1353462_+	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_044701955.1\|1353472_1354903_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003840192.1\|1355000_1356014_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_044701884.1\|1356119_1356950_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_001160725.1\|1356946_1357270_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_044701881.1\|1357396_1357912_+	lipoprotein	NA	NA	NA	NA
WP_003027295.1\|1358137_1358866_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.1e-27	36.0
WP_044701878.1\|1358882_1359614_+	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003027301.1\|1359620_1360337_+	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_003840185.1\|1360336_1361005_+	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_003834417.1\|1361266_1361998_+	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003027310.1\|1362129_1363029_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	2.8e-12	28.6
WP_003027312.1\|1363051_1364104_-	class I fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_003027315.1\|1364356_1365634_+	MFS transporter	NA	NA	NA	NA
WP_044701877.1\|1365630_1366635_+	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	4.1e-12	27.7
WP_044701874.1\|1366631_1367597_+	sugar kinase	NA	NA	NA	NA
WP_003027325.1\|1367570_1368317_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_044701870.1\|1368359_1369160_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_044701867.1\|1369162_1369945_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
1369995:1370042	attL	NA	NA	NA	NA
WP_044701866.1\|1370439_1370682_+	hypothetical protein	NA	NA	NA	NA
WP_044701865.1\|1370707_1371382_-	hypothetical protein	I7I023	Enterobacteria_phage	6.3e-73	76.1
WP_100216202.1\|1372047_1373215_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.4e-166	89.5
WP_044702135.1\|1374859_1375891_-\|capsid	major capsid protein	NA	NA	NA	NA
WP_044702134.1\|1375907_1376270_-	hypothetical protein	NA	NA	NA	NA
WP_044702132.1\|1376266_1376491_-	hypothetical protein	NA	NA	NA	NA
WP_044702129.1\|1377218_1377557_-	hypothetical protein	NA	NA	NA	NA
WP_080942041.1\|1377549_1377813_-	hypothetical protein	NA	NA	NA	NA
WP_044702126.1\|1378060_1378342_-	hypothetical protein	NA	NA	NA	NA
WP_044702123.1\|1378350_1378797_-	hypothetical protein	NA	NA	NA	NA
WP_162838206.1\|1379548_1379725_-	hypothetical protein	NA	NA	NA	NA
WP_044702121.1\|1381551_1382112_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_044702119.1\|1382117_1382306_+	hypothetical protein	NA	NA	NA	NA
WP_044702117.1\|1382371_1383187_-	hypothetical protein	NA	NA	NA	NA
WP_127791446.1\|1383193_1383910_-	hypothetical protein	NA	NA	NA	NA
WP_044702114.1\|1383993_1385295_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1385379:1385426	attR	NA	NA	NA	NA

DBSCAN-SWA_99

1392979 : 1401398

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844377.1\|1392979_1395013_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.0e-54	27.6
WP_003840158.1\|1395219_1395678_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	5.1e-50	68.0
WP_003027346.1\|1395720_1396191_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.9e-64	76.9
WP_003840155.1\|1396237_1396957_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_003027348.1\|1396953_1398639_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-281	91.6
WP_003844381.1\|1398864_1399596_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.8e-105	93.5
WP_003027354.1\|1399647_1399755_+	protein YohO	NA	NA	NA	NA
WP_032936682.1\|1399735_1400467_-	ABC transporter permease	NA	NA	NA	NA
WP_044702103.1\|1400450_1401398_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	2.2e-07	25.6

DBSCAN-SWA_100

1412163 : 1412898

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150648.1\|1412163_1412898_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	7.1e-54	44.4

DBSCAN-SWA_101

1427279 : 1428800

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027396.1\|1427279_1428800_-	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	3.4e-10	32.8

DBSCAN-SWA_102

1432504 : 1433173

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027410.1\|1432504_1433173_-	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	4.1e-56	56.8

DBSCAN-SWA_103

1438873 : 1440859

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702069.1\|1438873_1440859_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	4.5e-10	32.6

DBSCAN-SWA_104

1444769 : 1445627

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027428.1\|1444769_1445627_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	4.4e-23	32.8

DBSCAN-SWA_105

1459313 : 1461230

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936654.1\|1459313_1461230_+	recombinase family protein	Q6V7T7	Burkholderia_virus	9.0e-32	29.9

DBSCAN-SWA_106

1470030 : 1472343

Stx2-converting_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042922212.1\|1470030_1470408_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.4e-58	90.4
WP_042922210.1\|1470407_1470755_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.8e-61	98.3
WP_042922208.1\|1470804_1472343_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-271	91.0

DBSCAN-SWA_107

1484260 : 1488564

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701134.1\|1484260_1485727_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	1.2e-39	30.2
WP_044701137.1\|1485846_1486833_+	GTP-binding protein	NA	NA	NA	NA
WP_003840063.1\|1486867_1487581_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003027474.1\|1487994_1488564_+	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	2.3e-12	37.6

DBSCAN-SWA_108

1494330 : 1506524

Vibrio_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701144.1\|1494330_1495920_+	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	3.6e-18	31.8
WP_085951589.1\|1495923_1496268_-	hypothetical protein	NA	NA	NA	NA
WP_003027494.1\|1496601_1497792_-	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	1.4e-19	22.4
WP_003027496.1\|1497807_1498515_-	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_044701147.1\|1498665_1500426_+	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	9.3e-100	41.8
WP_003027502.1\|1500550_1500835_+	50S ribosomal protein L25	NA	NA	NA	NA
WP_003027504.1\|1500955_1501963_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	1.0e-82	47.6
WP_003027506.1\|1502097_1502325_+	YejL family protein	NA	NA	NA	NA
WP_016150675.1\|1502356_1504117_+	DUF3413 domain-containing protein	NA	NA	NA	NA
WP_032936622.1\|1504469_1504691_-	DNA polymerase V	A0A222YZE2	Escherichia_phage	2.3e-24	74.0
WP_044701152.1\|1504939_1505182_+	DinI family protein	Q6UAW0	Klebsiella_phage	1.1e-27	75.3
WP_044701153.1\|1505666_1506524_+	protein YibB	A0A292GL11	Xanthomonas_phage	1.1e-08	23.0

DBSCAN-SWA_109

1514516 : 1515137

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027545.1\|1514516_1515137_-	cytochrome c biogenesis heme-transporting ATPase CcmA	G3M9Y6	Bacillus_virus	1.4e-10	24.5

DBSCAN-SWA_110

1523937 : 1532486

uncultured_Caudovirales_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701223.1\|1523937_1525185_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.0e-82	49.0
WP_003027576.1\|1525147_1526584_-	magnesium transporter	NA	NA	NA	NA
WP_003027580.1\|1526689_1528333_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-10	22.8
WP_003027582.1\|1528408_1529059_-	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	2.9e-06	34.3
WP_044701164.1\|1529058_1530123_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A2P1EL10	Moumouvirus	1.1e-18	52.9
WP_044701165.1\|1530202_1531255_-	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_003027588.1\|1531370_1532486_-	porin OmpC	Q1MVN1	Enterobacteria_phage	8.4e-115	58.4

DBSCAN-SWA_111

1536673 : 1548675

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701167.1\|1536673_1539520_-	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	4.1e-41	25.8
WP_044701169.1\|1539641_1542278_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	2.8e-92	31.1
WP_003027601.1\|1542436_1543165_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_003027604.1\|1543653_1545939_+	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	6.0e-285	63.9
WP_003027605.1\|1546049_1547180_+	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	1.3e-174	78.9
WP_003027609.1\|1547179_1547434_+	ferredoxin-like diferric-tyrosyl radical cofactor maintenance protein YfaE	G9IAA2	Pseudomonas_phage	2.4e-25	76.1
WP_003839410.1\|1547607_1548675_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	2.3e-08	50.9

DBSCAN-SWA_112

1557776 : 1561881

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027645.1\|1557776_1558916_+	UDP-4-amino-4-deoxy-L-arabinose aminotransferase	A0A2K9L0G1	Tupanvirus	1.3e-30	29.0
WP_003027648.1\|1558918_1559902_+	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	A8CG95	Salmonella_phage	9.9e-35	32.5
WP_044701174.1\|1559898_1561881_+	bifunctional UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronic acid oxidase ArnA	A0A2K9KZK0	Tupanvirus	6.3e-20	25.5

DBSCAN-SWA_113

1574562 : 1575567

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839364.1\|1574562_1575567_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.4e-28	25.7

DBSCAN-SWA_114

1594484 : 1595084

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701194.1\|1594484_1595084_+	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	3.1e-07	39.8

DBSCAN-SWA_115

1608921 : 1609695

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839331.1\|1608921_1609695_-	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	3.6e-08	27.7

DBSCAN-SWA_116

1614050 : 1615568

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028127.1\|1614050_1615568_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-88	44.0

DBSCAN-SWA_117

1622065 : 1623202

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028146.1\|1622065_1623202_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	8.8e-19	26.3

DBSCAN-SWA_118

1631682 : 1632768

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701213.1\|1631682_1632768_-	chorismate synthase	A0A291AU41	Pandoravirus	1.0e-88	46.7

DBSCAN-SWA_119

1641906 : 1645724

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839292.1\|1641906_1642848_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	7.5e-149	89.3
WP_044701716.1\|1643021_1643651_-	DNA-binding protein	NA	NA	NA	NA
WP_044701718.1\|1643825_1645724_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.9e-14	24.3

DBSCAN-SWA_120

1653781 : 1654702

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839269.1\|1653781_1654702_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	5.4e-75	53.5

DBSCAN-SWA_121

1659179 : 1659914

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936528.1\|1659179_1659914_+	two-component system response regulator YpdB	A0A2R2ZGH8	Clostridioides_phage	1.6e-13	25.8

DBSCAN-SWA_122

1684626 : 1694493

Lactobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838572.1\|1684626_1685553_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	5.2e-09	26.3
WP_003038103.1\|1685642_1686641_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_003038102.1\|1686637_1686856_-	DUF3820 family protein	NA	NA	NA	NA
WP_044701746.1\|1686857_1688873_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	4.2e-149	43.4
WP_003038097.1\|1688944_1689952_-	cell division protein ZipA	NA	NA	NA	NA
WP_003838567.1\|1690182_1690944_+	sulfate transporter CysZ	NA	NA	NA	NA
WP_003038091.1\|1691107_1692079_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	3.3e-75	51.0
WP_003038086.1\|1692462_1692720_+	phosphocarrier protein Hpr	NA	NA	NA	NA
WP_044701750.1\|1692765_1694493_+	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	7.4e-17	31.1

DBSCAN-SWA_123

1698476 : 1708011

Streptococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838552.1\|1698476_1699388_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.8e-60	43.8
WP_003847288.1\|1699507_1700605_-	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	6.3e-30	38.9
WP_003038064.1\|1700594_1701470_-	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
WP_003038061.1\|1701469_1702303_-	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
WP_003038059.1\|1702303_1703320_-	thiosulfate/sulfate ABC transporter substrate-binding protein CysP	NA	NA	NA	NA
WP_003038057.1\|1703476_1704268_-	SDR family oxidoreductase UcpA	Q06VL0	Trichoplusia_ni_ascovirus	6.8e-18	31.8
WP_003838547.1\|1704439_1705339_-	porphyrinogen peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
WP_016150735.1\|1705432_1706008_-	RpoE-regulated lipoprotein	NA	NA	NA	NA
WP_003038050.1\|1706067_1706517_-	DUF2919 domain-containing protein	NA	NA	NA	NA
WP_003038048.1\|1706503_1706929_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_003038046.1\|1707141_1708011_+	N-acetylmuramoyl-L-alanine amidase AmiA	A0A0N9SGH1	Paenibacillus_phage	1.5e-18	33.3

DBSCAN-SWA_124

1743875 : 1744589

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037964.1\|1743875_1744589_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	2.0e-37	35.7

DBSCAN-SWA_125

1754503 : 1760101

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037932.1\|1754503_1755793_-	uracil permease	Q9KX94	Enterobacteria_phage	1.7e-63	36.7
WP_003037929.1\|1755889_1756516_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_044701787.1\|1756699_1758130_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_003838485.1\|1758425_1759463_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	6.3e-72	42.4
WP_044701788.1\|1759459_1760101_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	9.0e-29	41.1

DBSCAN-SWA_126

1766528 : 1766732

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049002457.1\|1766528_1766732_+	DUF2633 family protein	G9L6F2	Escherichia_phage	5.6e-17	71.4

DBSCAN-SWA_127

1771647 : 1777929

Shigella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100216202.1\|1771647_1772815_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.4e-166	89.5
WP_003037760.1\|1773293_1774871_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_003037756.1\|1774934_1776401_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	5.7e-87	38.5
WP_016150751.1\|1776561_1777929_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	3.4e-41	35.0

DBSCAN-SWA_128

1789233 : 1790775

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037736.1\|1789233_1790775_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.4e-160	57.6

DBSCAN-SWA_129

1799751 : 1800183

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037710.1\|1799751_1800183_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	5.3e-17	37.1

DBSCAN-SWA_130

1810027 : 1816382

Mycoplasma_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701997.1\|1810027_1811311_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	7.6e-35	35.4
WP_003037694.1\|1811372_1811573_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003037690.1\|1811584_1811920_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003838439.1\|1811921_1813772_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.4e-103	41.9
WP_003838436.1\|1813787_1814303_-	co-chaperone HscB	NA	NA	NA	NA
WP_003037681.1\|1814411_1814735_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.2e-22	47.7
WP_002913991.1\|1814755_1815142_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.7e-52	77.3
WP_003037677.1\|1815167_1816382_-	cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6

DBSCAN-SWA_131

1822002 : 1823511

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701991.1\|1822002_1823511_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-15	26.4

DBSCAN-SWA_132

1842802 : 1854127

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037627.1\|1842802_1844056_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.9e-100	53.4
WP_044701974.1\|1844382_1845573_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_002914032.1\|1845674_1846013_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_003838398.1\|1846073_1847411_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	1.4e-10	34.1
WP_044701971.1\|1847407_1848151_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_003847077.1\|1848173_1849604_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	2.0e-12	25.6
WP_044701969.1\|1850239_1854127_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	5.0e-130	59.0

DBSCAN-SWA_133

1860428 : 1867338

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037590.1\|1860428_1860689_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.7e-18	54.7
WP_003037588.1\|1860817_1861198_-	holo-ACP synthase	NA	NA	NA	NA
WP_016150781.1\|1861197_1861929_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_044701965.1\|1861940_1862669_-	DNA repair protein RecO	NA	NA	NA	NA
WP_003037581.1\|1862696_1863602_-	GTPase Era	NA	NA	NA	NA
WP_003037579.1\|1863598_1864279_-	ribonuclease III	A0A2K9L5P0	Tupanvirus	1.6e-20	31.8
WP_003838377.1\|1864548_1865523_-	signal peptidase I	NA	NA	NA	NA
WP_003037577.1\|1865538_1867338_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.8e-24	25.1

DBSCAN-SWA_134

1873182 : 1878759

Cafeteria_roenbergensis_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037569.1\|1873182_1874511_+	ATP-dependent RNA helicase SrmB	E3T5E1	Cafeteria_roenbergensis_virus	2.5e-41	29.1
WP_003037563.1\|1875628_1876012_-	autonomous glycyl radical cofactor GrcA	A0A1W5N098	Cronobacter_phage	3.6e-33	70.9
WP_003037561.1\|1876329_1877019_+	uracil-DNA glycosylase	A0A076JX67	Equid_alphaherpesvirus	7.9e-55	49.3
WP_003838362.1\|1877052_1878132_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_003037559.1\|1878339_1878759_+	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	8.3e-15	36.5

DBSCAN-SWA_135

1884058 : 1885357

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150786.1\|1884058_1885357_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.1e-44	30.6

DBSCAN-SWA_136

1891195 : 1893769

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031249.1\|1891195_1893769_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	1.5e-127	35.2

DBSCAN-SWA_137

1899723 : 1903279

Escherichia_coli_O157_typing_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699552.1\|1899723_1900794_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	3.4e-89	50.9
WP_003845849.1\|1901008_1901383_+	DUF2799 domain-containing protein	NA	NA	NA	NA
WP_003839843.1\|1901541_1902060_+	YfiR family protein	NA	NA	NA	NA
WP_032937960.1\|1902052_1903279_+	diguanylate cyclase DgcN	A0A2K8I9Y5	Pseudomonas_phage	1.1e-06	37.6

DBSCAN-SWA_138

1914613 : 1915096

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031211.1\|1914613_1915096_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.2e-28	46.8

DBSCAN-SWA_139

1928387 : 1944622

Enterobacteria_phage(72.73%)

integrase

attL 1913333:1913347|attR 1934121:1934135

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1913333:1913347	attL	NA	NA	NA	NA
WP_044699566.1\|1928387_1930574_+	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	7.1e-17	29.8
WP_085951585.1\|1930581_1931745_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_016242323.1\|1932365_1933565_+\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	5.3e-107	50.9
WP_044699570.1\|1933576_1934995_-	hypothetical protein	NA	NA	NA	NA
1934121:1934135	attR	NA	NA	NA	NA
WP_044699572.1\|1935635_1936211_-	hypothetical protein	Q7M2A1	Enterobacteria_phage	1.1e-38	50.8
WP_000984214.1\|1936227_1936470_-	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	1.4e-19	58.0
WP_047715917.1\|1936466_1937270_-	hypothetical protein	Q7M2A2	Enterobacteria_phage	9.6e-12	25.2
WP_016242327.1\|1937821_1938088_+	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	2.8e-24	64.8
WP_047715918.1\|1938084_1938684_+	host cell division inhibitor Icd-like protein	Q7M2A7	Enterobacteria_phage	2.8e-48	77.4
WP_044699579.1\|1938676_1938976_+	hypothetical protein	Q7M2A0	Enterobacteria_phage	7.7e-31	67.7
WP_044699580.1\|1938968_1939418_+	hypothetical protein	Q7M298	Enterobacteria_phage	1.1e-44	67.3
WP_024173160.1\|1939522_1939750_+	hypothetical protein	NA	NA	NA	NA
WP_000743156.1\|1939746_1940067_+	DUF5375 domain-containing protein	NA	NA	NA	NA
WP_044699583.1\|1940078_1942412_+	toprim domain-containing protein	Q7M2A8	Enterobacteria_phage	0.0e+00	83.4
WP_044699584.1\|1943024_1944230_+	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_071681355.1\|1944403_1944622_-	hypothetical protein	G8C7R9	Escherichia_phage	1.2e-20	69.1

DBSCAN-SWA_140

1950080 : 1954436

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046155102.1\|1950080_1954436_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	6.8e-136	37.0

DBSCAN-SWA_141

1960481 : 1966305

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839789.1\|1960481_1962029_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.6e-09	25.2
WP_032949851.1\|1962080_1963010_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_044699607.1\|1963048_1964035_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_044699610.1\|1964379_1966305_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	E5EQ70	Micromonas_sp._RCC1109_virus	1.3e-25	23.1

DBSCAN-SWA_142

1976500 : 1979743

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699619.1\|1976500_1979743_-	transporter substrate-binding domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.2e-33	30.3

DBSCAN-SWA_143

1991122 : 1996343

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699629.1\|1991122_1992139_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	3.6e-80	46.2
WP_044699632.1\|1992185_1993577_-	DUF4832 domain-containing protein	NA	NA	NA	NA
WP_032938074.1\|1993607_1994015_-	hypothetical protein	NA	NA	NA	NA
WP_032938077.1\|1994017_1995130_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_044699634.1\|1995131_1996343_-	glycosyltransferase family 4 protein	A0A2P0VNG4	Tetraselmis_virus	1.3e-12	31.6

DBSCAN-SWA_144

2022866 : 2023580

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037218.1\|2022866_2023580_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	3.1e-14	37.1

DBSCAN-SWA_145

2027578 : 2031585

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699659.1\|2027578_2028862_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	2.4e-28	28.6
WP_003037233.1\|2028990_2030391_+	GABA permease	NA	NA	NA	NA
WP_003037236.1\|2030436_2031123_+	DNA-binding transcriptional regulator CsiR	NA	NA	NA	NA
WP_003037241.1\|2031135_2031585_-	peptidoglycan-binding protein LysM	A0A1V0DZX0	Clostridioides_phage	3.7e-05	38.2

DBSCAN-SWA_146

2037346 : 2042643

Lactobacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037270.1\|2037346_2037592_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.8e-12	42.5
WP_003037273.1\|2037588_2037999_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.6e-17	41.0
WP_044699668.1\|2037971_2040116_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	7.6e-197	48.6
WP_016150870.1\|2040126_2041086_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	5.0e-132	71.5
WP_003037282.1\|2041440_2042643_+	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.9e-27	38.1

DBSCAN-SWA_147

2057148 : 2062569

Vibrio_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000906486.1\|2057148_2057334_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
WP_003037323.1\|2057571_2060199_-\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	8.4e-81	38.8
WP_003037326.1\|2060327_2060828_-	recombination regulator RecX	NA	NA	NA	NA
WP_003037330.1\|2060914_2061979_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	4.0e-114	63.8
WP_003037333.1\|2062071_2062569_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.6e-31	51.0

DBSCAN-SWA_148

2068129 : 2069095

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037353.1\|2068129_2069095_+	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	1.8e-36	33.9

DBSCAN-SWA_149

2096921 : 2103259

Pithovirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840297.1\|2096921_2097737_+	iron/manganese ABC transporter ATP-binding protein SitB	W5SAS9	Pithovirus	1.2e-12	28.1
WP_044699710.1\|2097739_2098597_+	iron/manganese ABC transporter permease subunit SitC	NA	NA	NA	NA
WP_044699713.1\|2098593_2099445_+	iron/manganese ABC transporter permease subunit SitD	NA	NA	NA	NA
WP_044699716.1\|2100190_2100541_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_008322725.1\|2100537_2100867_+	multidrug efflux SMR transporter	E5EPE2	Acinetobacter_phage	4.2e-06	33.0
WP_044699720.1\|2100880_2103259_+\|holin	choline trimethylamine-lyase	A0A2C9CWX5	Yersinia_phage	8.1e-06	37.5

DBSCAN-SWA_150

2111834 : 2114396

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699723.1\|2111834_2114396_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	3.2e-32	20.9

DBSCAN-SWA_151

2117870 : 2121574

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000081498.1\|2117870_2118863_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6
WP_003840324.1\|2118925_2120053_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	5.0e-06	34.6
WP_003034172.1\|2120192_2120819_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.4e-36	50.6
WP_044699730.1\|2120812_2121574_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.9e-57	46.7

DBSCAN-SWA_152

2124747 : 2126780

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034157.1\|2124747_2125353_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.1e-27	37.9
WP_003840331.1\|2125352_2126780_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	7.9e-33	25.8

DBSCAN-SWA_153

2134129 : 2134801

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034139.1\|2134129_2134801_-	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	3.9e-14	24.6

DBSCAN-SWA_154

2138163 : 2141187

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034129.1\|2138163_2139462_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.4e-129	57.9
WP_003034127.1\|2139549_2141187_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.7e-153	50.6

DBSCAN-SWA_155

2144661 : 2152743

Erysipelothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032949930.1\|2144661_2145960_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.1e-36	27.9
WP_044699738.1\|2146017_2148774_+	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.0e-52	29.5
WP_044699741.1\|2148817_2149960_-	glycerate kinase	W6LM47	Streptococcus_phage	2.4e-48	41.0
WP_003034111.1\|2150041_2151382_-	glucarate dehydratase	NA	NA	NA	NA
WP_044699743.1\|2151402_2152743_-	glucarate dehydratase	Q6A202	Oenococcus_phage	1.6e-06	23.9

DBSCAN-SWA_156

2157268 : 2158117

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034084.1\|2157268_2158117_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.8e-40	37.3

DBSCAN-SWA_157

2163032 : 2163788

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840372.1\|2163032_2163788_+	flap endonuclease Xni	F8WQ40	Bacillus_phage	8.8e-07	28.7

DBSCAN-SWA_158

2170539 : 2172039

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034052.1\|2170539_2172039_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-15	26.3

DBSCAN-SWA_159

2180273 : 2182809

environmental_halophage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699753.1\|2180273_2181479_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	3.6e-71	36.2
WP_003840390.1\|2181478_2181925_+	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
WP_003846496.1\|2182002_2182809_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.2e-16	32.8

DBSCAN-SWA_160

2193228 : 2204427

Deep-sea_thermophilic_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937467.1\|2193228_2194482_-	N-acetylmuramoyl-L-alanine amidase AmiC	E5DV68	Deep-sea_thermophilic_phage	2.7e-13	28.4
WP_003034012.1\|2194715_2196047_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_032937466.1\|2196174_2198004_-	exodeoxyribonuclease V subunit alpha	A0A1P8DII4	Virus_Rctr197k	1.9e-18	34.4
WP_044699761.1\|2198000_2201546_-	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	3.4e-08	20.1
WP_044699762.1\|2201538_2204427_-	pitrilysin	A0A1V0SJA4	Klosneuvirus	4.5e-67	24.9

DBSCAN-SWA_161

2209907 : 2216730

Cronobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699772.1\|2209907_2210702_-	thymidylate synthase	R4IFY1	Cronobacter_phage	5.4e-116	61.7
WP_003846461.1\|2210708_2211584_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_003033984.1\|2211772_2214019_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	5.1e-10	24.6
WP_003033982.1\|2214031_2214562_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_003840955.1\|2215246_2215942_+	DNA mismatch repair endonuclease MutH	NA	NA	NA	NA
WP_003033961.1\|2216016_2216730_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	5.3e-46	47.3

DBSCAN-SWA_162

2223306 : 2224317

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846454.1\|2223306_2224317_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.6e-33	30.4

DBSCAN-SWA_163

2228078 : 2231516

Sodalis_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699781.1\|2228078_2228966_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.7e-68	45.8
WP_003033926.1\|2229021_2230440_-	arabinose-proton symporter AraE	O13311	Aichi_virus	5.1e-24	26.7
WP_003033923.1\|2230754_2231516_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-19	32.1

DBSCAN-SWA_164

2246816 : 2247422

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033877.1\|2246816_2247422_-	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	3.2e-07	26.9

DBSCAN-SWA_165

2259395 : 2261267

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699790.1\|2259395_2261267_-	hypothetical protein	A0A1Q1N989	Escherichia_phage	1.1e-53	29.5

DBSCAN-SWA_166

2264483 : 2265603

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087451024.1\|2264483_2265603_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_167

2269425 : 2280423

Bacillus_phage(28.57%)

tRNA,integrase

attL 2266997:2267010|attR 2270582:2270595

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2266997:2267010	attL	NA	NA	NA	NA
WP_044700788.1\|2269425_2270004_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6D2	Bacillus_phage	5.0e-10	26.3
WP_044700790.1\|2270097_2270295_+	hypothetical protein	NA	NA	NA	NA
WP_003838329.1\|2270291_2270585_+	hypothetical protein	NA	NA	NA	NA
WP_044700792.1\|2270660_2270930_+	hypothetical protein	NA	NA	NA	NA
2270582:2270595	attR	NA	NA	NA	NA
WP_044700793.1\|2270992_2271490_-	hypothetical protein	NA	NA	NA	NA
WP_080528468.1\|2271513_2272080_-	hypothetical protein	A0A1L5C2A2	Pseudoalteromonas_phage	8.0e-05	69.4
WP_016150941.1\|2272776_2273535_-	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	3.2e-09	37.3
WP_032948043.1\|2273701_2274256_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_003026911.1\|2274333_2275851_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.3e-86	36.9
WP_096878465.1\|2275860_2276959_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	1.8e-05	39.0
WP_044700800.1\|2277050_2278784_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	7.5e-62	28.5
WP_003026923.1\|2278789_2279503_-	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
WP_003026928.1\|2279526_2280423_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.5e-29	27.9

DBSCAN-SWA_168

2285122 : 2290329

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700805.1\|2285122_2286556_+	6-phospho-beta-glucosidase BglA	A0A0B5JD41	Pandoravirus	4.8e-30	26.1
WP_032937431.1\|2286650_2287394_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_044700806.1\|2287455_2290329_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	2.6e-261	51.1

DBSCAN-SWA_169

2298585 : 2299818

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003026984.1\|2298585_2299818_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.1e-102	47.6

DBSCAN-SWA_170

2317328 : 2317979

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700836.1\|2317328_2317979_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	5.6e-10	23.9

DBSCAN-SWA_171

2325092 : 2328041

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027071.1\|2325092_2326247_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.3e-128	63.2
WP_003027074.1\|2326646_2328041_+	galactose/proton symporter	O13311	Aichi_virus	1.4e-26	25.5

DBSCAN-SWA_172

2341407 : 2342493

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049001609.1\|2341407_2342493_+	membrane-bound lytic murein transglycosylase MltC	A0A0H3V0Q1	Geobacillus_virus	4.5e-12	39.0

DBSCAN-SWA_173

2360219 : 2361860

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700857.1\|2360219_2361860_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.5e-11	54.7

DBSCAN-SWA_174

2371559 : 2376805

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024520.1\|2371559_2372387_+	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.1e-63	46.0
WP_016150982.1\|2372575_2374030_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_003024529.1\|2374074_2374530_+	HIT family protein	Q5YEY9	Rock_bream_iridovirus	2.1e-19	34.7
WP_003024532.1\|2374633_2376805_-	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	1.3e-103	70.4

DBSCAN-SWA_175

2380913 : 2383689

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047715920.1\|2380913_2383172_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	7.5e-86	35.5
WP_003024544.1\|2383290_2383689_-	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	9.9e-18	43.9

DBSCAN-SWA_176

2392324 : 2400409

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024571.1\|2392324_2394217_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.0e-92	34.8
WP_003846314.1\|2394245_2394827_-	esterase YqiA	NA	NA	NA	NA
WP_003838143.1\|2394826_2395654_-	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
WP_003024582.1\|2395678_2396101_-	DUF1249 family protein	NA	NA	NA	NA
WP_047715921.1\|2396097_2396730_-	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	5.2e-21	34.7
WP_085951568.1\|2396929_2398408_+	outer membrane channel protein TolC	NA	NA	NA	NA
WP_003024591.1\|2398565_2399243_+	DUF1190 family protein	A0A173GEW8	Erwinia_phage	2.6e-34	45.0
WP_003024594.1\|2399248_2400409_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	5.0e-86	42.9

DBSCAN-SWA_177

2406100 : 2406754

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838130.1\|2406100_2406754_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.1e-45	44.3

DBSCAN-SWA_178

2410351 : 2411785

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700899.1\|2410351_2411785_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	1.3e-38	28.8

DBSCAN-SWA_179

2417035 : 2418277

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150993.1\|2417035_2418277_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.8e-94	49.3

DBSCAN-SWA_180

2429668 : 2448098

Moraxella_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024694.1\|2429668_2430682_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.4e-110	59.8
WP_001144069.1\|2430918_2431134_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_003024697.1\|2431368_2433114_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	8.4e-77	38.8
WP_003024699.1\|2433473_2435321_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
WP_044700921.1\|2435481_2436531_+	YncE family protein	NA	NA	NA	NA
WP_003846276.1\|2436541_2438539_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.9e-08	27.2
WP_044700923.1\|2438569_2439076_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
WP_047715922.1\|2439438_2439780_-	toxin	NA	NA	NA	NA
WP_032666156.1\|2439800_2440103_-	type IV toxin-antitoxin system YeeU family antitoxin	NA	NA	NA	NA
WP_047715924.1\|2440136_2440358_-	DUF987 domain-containing protein	NA	NA	NA	NA
WP_047715925.1\|2440366_2440843_-	RadC family protein	NA	NA	NA	NA
WP_032666161.1\|2440858_2441317_-	antirestriction protein	A0A2D0W9W4	Bordetella_phage	7.7e-14	36.2
WP_032666162.1\|2441419_2441659_-	DUF905 domain-containing protein	NA	NA	NA	NA
WP_032666163.1\|2441735_2442203_-	hypothetical protein	NA	NA	NA	NA
WP_032666164.1\|2442226_2442670_-	hypothetical protein	NA	NA	NA	NA
WP_001144029.1\|2442669_2442906_-	hypothetical protein	NA	NA	NA	NA
WP_032666165.1\|2442946_2443648_-	WYL domain-containing protein	NA	NA	NA	NA
WP_032666166.1\|2443864_2444686_-	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	3.0e-45	38.3
WP_032666167.1\|2444777_2445641_-	GTPase family protein	NA	NA	NA	NA
WP_032666168.1\|2445959_2448098_+	DNA methyltransferase	A0A2K5B255	Erysipelothrix_phage	2.9e-15	26.0

DBSCAN-SWA_181

2457286 : 2458603

Klebsiella_phage(100.0%)

integrase

attL 2456556:2456569|attR 2459874:2459887

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2456556:2456569	attL	NA	NA	NA	NA
WP_042998205.1\|2457286_2458603_-\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	3.5e-35	30.2
WP_042998205.1\|2457286_2458603_-\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	3.5e-35	30.2
2459874:2459887	attR	NA	NA	NA	NA

DBSCAN-SWA_182

2472329 : 2484376

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846231.1\|2472329_2473484_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.6e-84	45.8
WP_003024755.1\|2473551_2474400_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016151014.1\|2474396_2475179_-	siderophore-interacting protein	NA	NA	NA	NA
WP_164845042.1\|2475415_2476093_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_047715928.1\|2476146_2477667_-	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	2.2e-33	50.0
WP_168150126.1\|2478097_2479477_+	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.6e-33	28.7
WP_003024768.1\|2479550_2479883_-\|tRNA	tRNA-binding protein	NA	NA	NA	NA
WP_003024771.1\|2480092_2481076_+	transcriptional regulator EbgR	NA	NA	NA	NA
WP_044700936.1\|2481283_2484376_+	beta-galactosidase subunit alpha	L0N6M2	Herpes_simplex_virus	7.7e-158	34.1

DBSCAN-SWA_183

2495397 : 2496366

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700964.1\|2495397_2496366_+	TerC family protein	A0A291LBC5	Escherichia_phage	7.7e-32	32.4

DBSCAN-SWA_184

2516890 : 2519185

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024871.1\|2516890_2519185_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	5.3e-156	40.4

DBSCAN-SWA_185

2525776 : 2539012

Stx2-converting_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042922212.1\|2525776_2526154_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.4e-58	90.4
WP_042922210.1\|2526153_2526501_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.8e-61	98.3
WP_042922208.1\|2526550_2528089_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-271	91.0
WP_032219323.1\|2528230_2528770_+	hypothetical protein	NA	NA	NA	NA
WP_071845176.1\|2528936_2529362_-	phase 1 flagellin transcriptional repressor	NA	NA	NA	NA
WP_087451024.1\|2529454_2530574_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_000079831.1\|2530755_2532027_-	flagellin FliC	NA	NA	NA	NA
WP_047715930.1\|2532468_2533047_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	8.4e-18	37.7
WP_044701292.1\|2533353_2534052_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_148116659.1\|2535004_2536232_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.5e-146	81.7
WP_044701293.1\|2537866_2539012_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	7.0e-48	40.2

DBSCAN-SWA_186

2547578 : 2548685

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701301.1\|2547578_2548685_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	W8CYL7	Bacillus_phage	7.0e-13	29.6

DBSCAN-SWA_187

2560538 : 2566627

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024942.1\|2560538_2561402_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.6e-50	43.6
WP_044701309.1\|2561465_2563517_+	penicillin-binding protein activator	NA	NA	NA	NA
WP_003024946.1\|2563474_2563870_+	YraN family protein	NA	NA	NA	NA
WP_003024948.1\|2563904_2564495_+	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	3.2e-12	31.8
WP_044701311.1\|2564504_2565080_+	divisome-associated lipoprotein YraP	NA	NA	NA	NA
WP_003024957.1\|2565173_2565809_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003839984.1\|2565846_2566275_-	YhbP family protein	NA	NA	NA	NA
WP_047715931.1\|2566327_2566627_+	GIY-YIG nuclease family protein	F2NZ06	Diadromus_pulchellus_ascovirus	3.2e-13	50.0

DBSCAN-SWA_188

2572293 : 2574222

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151048.1\|2572293_2574222_-	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	30.8

DBSCAN-SWA_189

2579812 : 2586457

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844847.1\|2579812_2582503_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	2.5e-24	26.4
WP_003024992.1\|2582527_2584015_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003024996.1\|2584043_2584496_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003024998.1\|2585113_2586457_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	4.8e-64	93.7

DBSCAN-SWA_190

2592282 : 2595164

Pandoravirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025010.1\|2592282_2593131_-	dihydropteroate synthase	S4VNV0	Pandoravirus	1.3e-19	31.2
WP_003025013.1\|2593229_2595164_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	4.1e-117	43.6

DBSCAN-SWA_191

2601857 : 2603337

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025033.1\|2601857_2602829_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	1.6e-08	26.2
WP_003839952.1\|2603052_2603337_+	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	6.0e-17	65.7

DBSCAN-SWA_192

2607441 : 2621568

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025057.1\|2607441_2608242_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	9.6e-20	30.6
WP_003839941.1\|2608457_2609435_+	calcium/sodium antiporter	NA	NA	NA	NA
WP_044701326.1\|2609448_2610435_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	6.7e-39	31.8
WP_044701327.1\|2610455_2611022_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	2.5e-54	76.3
WP_003025068.1\|2611018_2611594_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003025070.1\|2611562_2612111_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_003025073.1\|2612117_2612843_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-22	28.4
WP_003025074.1\|2612889_2614323_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003025078.1\|2614345_2614633_+	ribosome hibernation promoting factor	A0A0M7QCF2	Escherichia_phage	4.2e-10	43.2
WP_003025083.1\|2614716_2615208_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_044701328.1\|2615253_2616108_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
WP_003025086.1\|2616104_2616377_+	PTS phosphocarrier protein NPr	NA	NA	NA	NA
WP_003025087.1\|2616507_2617227_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_003839926.1\|2617223_2617877_-	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_003025089.1\|2618106_2620443_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	4.9e-40	30.8
WP_003839924.1\|2620638_2621568_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	6.7e-17	32.8

DBSCAN-SWA_193

2628343 : 2629426

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701329.1\|2628343_2629426_+	DUF1016 family protein	A0A0U2BZN7	Salmonella_phage	1.8e-74	89.3

DBSCAN-SWA_194

2633588 : 2635079

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701332.1\|2633588_2635079_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-08	23.9

DBSCAN-SWA_195

2638919 : 2688064

uncultured_Caudovirales_phage(50.0%)

tRNA,protease,integrase,transposase

attL 2676013:2676037|attR 2686922:2686946

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025130.1\|2638919_2639423_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.3e-26	54.8
WP_003025132.1\|2639428_2640067_-	stringent starvation protein A	NA	NA	NA	NA
WP_003025138.1\|2640383_2640776_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_003025141.1\|2640791_2641220_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_044701335.1\|2641438_2642566_-	cell division protein ZapE	NA	NA	NA	NA
WP_003025147.1\|2642758_2643157_+	DUF1043 family protein	NA	NA	NA	NA
WP_044701337.1\|2643325_2644693_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-20	25.6
WP_003025154.1\|2644782_2645850_+	outer membrane-stress sensor serine endopeptidase DegS	NA	NA	NA	NA
WP_003025158.1\|2645906_2646842_-	malate dehydrogenase	NA	NA	NA	NA
WP_003025162.1\|2647278_2647749_+	transcriptional regulator ArgR	NA	NA	NA	NA
WP_003025165.1\|2648125_2648392_+	peroxide/acid stress response protein YhcN	NA	NA	NA	NA
WP_003025168.1\|2648449_2648728_-	hypothetical protein	NA	NA	NA	NA
WP_003025171.1\|2648847_2650815_-	p-hydroxybenzoic acid efflux pump subunit AaeB	NA	NA	NA	NA
WP_003025174.1\|2650820_2651753_-	p-hydroxybenzoic acid efflux pump subunit AaeA	NA	NA	NA	NA
WP_003025177.1\|2651760_2651964_-	AaeX family protein	NA	NA	NA	NA
WP_003839896.1\|2652148_2653078_+	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
WP_044701339.1\|2653164_2654610_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_044701342.1\|2654771_2658587_-	AsmA2 domain-containing protein	NA	NA	NA	NA
WP_003025190.1\|2658698_2660168_-	ribonuclease G	NA	NA	NA	NA
WP_003839891.1\|2660157_2660751_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003025196.1\|2660758_2661247_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003844819.1\|2661247_2662270_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000913396.1\|2662336_2663380_-	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3
WP_153752135.1\|2663357_2663678_+	hypothetical protein	NA	NA	NA	NA
WP_044701343.1\|2663686_2665627_-	RNase E specificity factor CsrD	NA	NA	NA	NA
WP_016151069.1\|2665852_2666827_+	oxidoreductase	NA	NA	NA	NA
WP_044701347.1\|2666946_2667951_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_003839882.1\|2667951_2668551_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_003025210.1\|2668943_2669414_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_003025213.1\|2669424_2670774_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_003025216.1\|2670881_2671124_+	YhdT family protein	NA	NA	NA	NA
WP_016151072.1\|2671113_2672565_+	sodium/pantothenate symporter	NA	NA	NA	NA
WP_016151073.1\|2672576_2673458_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_044701349.1\|2673585_2674362_+	carbonic anhydrase family protein	NA	NA	NA	NA
WP_003025224.1\|2674660_2675626_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_000462905.1\|2675651_2675948_+	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
2676013:2676037	attL	NA	NA	NA	NA
WP_100216202.1\|2676254_2677422_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.4e-166	89.5
WP_044067013.1\|2678756_2678951_-	hypothetical protein	NA	NA	NA	NA
WP_047715934.1\|2679102_2679816_+	HEPN domain-containing protein	NA	NA	NA	NA
WP_047715935.1\|2680011_2681385_-	AAA family ATPase	A0A2H4JFA4	uncultured_Caudovirales_phage	6.4e-173	67.7
WP_047715937.1\|2681381_2681750_-	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	1.7e-56	89.3
WP_024153894.1\|2681746_2681971_-	hypothetical protein	A0A2H4JBA1	uncultured_Caudovirales_phage	2.3e-16	75.9
WP_047715939.1\|2681963_2682236_-	host cell division inhibitor Icd-like protein	A0A2H4JGW3	uncultured_Caudovirales_phage	6.1e-35	76.7
WP_047715942.1\|2683418_2683619_-	AlpA family transcriptional regulator	A0A2H4JB58	uncultured_Caudovirales_phage	2.7e-24	83.3
WP_131935741.1\|2683713_2684148_-	hypothetical protein	NA	NA	NA	NA
WP_087451024.1\|2684169_2685289_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_052941160.1\|2685316_2685670_-	hypothetical protein	NA	NA	NA	NA
WP_047715943.1\|2685666_2686890_-\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	1.1e-219	88.0
WP_016151075.1\|2687179_2688064_+	adenine-specific DNA-methyltransferase	M4QNN5	Ostreococcus_lucimarinus_virus	2.8e-28	32.8
2686922:2686946	attR	NA	NA	NA	NA

DBSCAN-SWA_196

2694670 : 2698826

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701355.1\|2694670_2695696_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	5.3e-71	39.8
WP_044701356.1\|2695765_2696947_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_044701358.1\|2696956_2698060_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003025300.1\|2698067_2698826_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-20	31.7

DBSCAN-SWA_197

2709277 : 2710749

Synechococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031159.1\|2709277_2709787_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.6e-18	40.3
WP_003845229.1\|2709801_2710749_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-08	39.8

DBSCAN-SWA_198

2730648 : 2736220

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031109.1\|2730648_2731833_-	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_003023659.1\|2731902_2734017_-	elongation factor G	E4ZFJ7	Streptococcus_phage	6.2e-58	27.1
WP_003023657.1\|2734113_2734584_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_003023654.1\|2734679_2735054_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_003023651.1\|2735179_2735467_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.4e-05	39.2
WP_003837966.1\|2735474_2735834_-	sulfurtransferase complex subunit TusC	NA	NA	NA	NA
WP_003023646.1\|2735833_2736220_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	6.7e-19	40.6

DBSCAN-SWA_199

2741982 : 2747270

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701446.1\|2741982_2743884_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.5e-74	33.9
WP_044701444.1\|2743993_2745484_-	nicotinate phosphoribosyltransferase	A0A218KC49	Bacillus_phage	2.4e-141	52.2
WP_003023622.1\|2745498_2746359_-	ribose-phosphate pyrophosphokinase	G0X553	Salmonella_phage	5.6e-50	40.6
WP_044701441.1\|2746550_2747270_+	NUDIX hydrolase	G3MA14	Bacillus_virus	5.6e-19	27.5

DBSCAN-SWA_200

2751005 : 2755055

environmental_Halophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837947.1\|2751005_2753093_+	FUSC family protein	H9YQA8	environmental_Halophage	4.2e-67	89.9
WP_003847953.1\|2753188_2754406_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	9.7e-32	28.0
WP_003847954.1\|2754491_2755055_-	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	6.0e-61	56.5

DBSCAN-SWA_201

2774057 : 2774894

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023558.1\|2774057_2774894_-	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	8.4e-67	49.1

DBSCAN-SWA_202

2791856 : 2796399

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701411.1\|2791856_2793479_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	3.1e-142	52.3
WP_003847996.1\|2793601_2793919_+	hypothetical protein	NA	NA	NA	NA
WP_003837894.1\|2793971_2794268_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003837891.1\|2794324_2795677_-	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	4.3e-12	23.6
WP_135953044.1\|2795673_2796399_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	3.5e-29	34.7

DBSCAN-SWA_203

2809666 : 2812060

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701404.1\|2809666_2812060_-	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	3.6e-14	40.2

DBSCAN-SWA_204

2819404 : 2821852

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023492.1\|2819404_2821852_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	3.6e-33	82.1

DBSCAN-SWA_205

2845809 : 2847620

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701384.1\|2845809_2846553_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	6.4e-10	25.3
WP_032950429.1\|2846549_2847620_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	4.4e-20	32.0

DBSCAN-SWA_206

2851399 : 2852898

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003827581.1\|2851399_2852113_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	3.7e-15	30.1
WP_003023438.1\|2852130_2852898_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	W6JKT0	Anomala_cuprea_entomopoxvirus	3.7e-13	25.1

DBSCAN-SWA_207

2858641 : 2861471

Salicola_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023425.1\|2858641_2859496_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	7.0e-45	41.9
WP_003837835.1\|2859751_2860810_-	cell division protein FtsX	NA	NA	NA	NA
WP_003023420.1\|2860802_2861471_-	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	27.6

DBSCAN-SWA_208

2866805 : 2870878

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846172.1\|2866805_2867432_+	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	2.3e-29	60.2
WP_044701374.1\|2867506_2869705_+	Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA	E4ZFI9	Streptococcus_phage	2.3e-116	37.4
WP_003023404.1\|2869798_2870044_-	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	4.7e-10	83.3
WP_044701371.1\|2870212_2870878_+	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	2.8e-57	54.4

DBSCAN-SWA_209

2875470 : 2879695

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837806.1\|2875470_2875746_-	type II toxin-antitoxin system HicA family toxin	R4JMD3	Burkholderia_phage	3.2e-15	47.6
WP_003837801.1\|2875823_2876948_-	ABC transporter permease	NA	NA	NA	NA
WP_044701369.1\|2876947_2879695_-	ribosome-associated ATPase/putative transporter RbbA	W6JKT0	Anomala_cuprea_entomopoxvirus	1.9e-19	32.6

DBSCAN-SWA_210

2882721 : 2887966

Stx2-converting_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042922208.1\|2882721_2884260_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-271	91.0
WP_042922210.1\|2884309_2884657_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.8e-61	98.3
WP_042922212.1\|2884656_2885034_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.4e-58	90.4
WP_000723069.1\|2885236_2885671_-	copper resistance system metallochaperone PcoE	NA	NA	NA	NA
WP_001211180.1\|2885888_2887289_-	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	3.2e-18	26.6
WP_001188930.1\|2887285_2887966_-	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4

DBSCAN-SWA_211

2893060 : 2893798

Listeria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000287501.1\|2893060_2893798_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.0e-12	41.0

DBSCAN-SWA_212

2903694 : 2907023

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702707.1\|2903694_2904375_+	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	1.0e-30	35.6
WP_000555736.1\|2904367_2905849_+	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.8e-27	30.1
WP_000790485.1\|2906093_2906525_+	silver-binding protein SilE	NA	NA	NA	NA
WP_000647570.1\|2906672_2907023_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	8.1e-16	61.4

DBSCAN-SWA_213

2926187 : 2928230

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702794.1\|2926187_2928230_-	oligopeptidase A	A0A1V0SD92	Indivirus	9.9e-45	23.1

DBSCAN-SWA_214

2959233 : 2961218

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024319.1\|2959233_2960238_-	dipeptide ABC transporter ATP binding subunit DppF	G3M9Y6	Bacillus_virus	2.5e-17	29.9
WP_032950483.1\|2960234_2961218_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-14	31.2

DBSCAN-SWA_215

2971024 : 2973358

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700390.1\|2971024_2973358_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	3.7e-72	30.7

DBSCAN-SWA_216

2978768 : 2981675

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151146.1\|2978768_2979743_+	glyoxylate/hydroxypyruvate reductase GhrB	M1HST2	Paramecium_bursaria_Chlorella_virus	6.4e-18	27.0
WP_003837709.1\|2979801_2980512_-	DUF3053 domain-containing protein	NA	NA	NA	NA
WP_003024273.1\|2980892_2981183_+	HTH-type transcriptional regulator	NA	NA	NA	NA
WP_000014594.1\|2981462_2981675_+	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	2.7e-22	72.9

DBSCAN-SWA_217

2986082 : 2987078

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700501.1\|2986082_2987078_+	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	4.5e-11	25.2

DBSCAN-SWA_218

3016853 : 3018698

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700429.1\|3016853_3018698_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	3.1e-13	25.5

DBSCAN-SWA_219

3036000 : 3045372

Rhizobium_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844542.1\|3036000_3036252_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	2.2e-15	53.4
WP_003024148.1\|3036304_3036736_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_044700439.1\|3036985_3038530_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_003837638.1\|3038539_3039823_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	1.8e-07	34.3
WP_003024138.1\|3039826_3040762_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_044700441.1\|3040762_3041800_-	glycosyltransferase	NA	NA	NA	NA
WP_003024132.1\|3041992_3043018_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8
WP_003837635.1\|3043027_3044224_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	4.1e-35	29.1
WP_003827312.1\|3044439_3045372_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.0e-36	37.1

DBSCAN-SWA_220

3050766 : 3051711

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937171.1\|3050766_3051711_+	glycosyl transferase family 8	A0ZYL4	Archaeal_BJ1_virus	2.9e-15	26.3

DBSCAN-SWA_221

3057452 : 3062014

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024099.1\|3057452_3057932_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.3e-27	43.2
WP_003024097.1\|3057970_3058780_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	3.1e-26	31.6
WP_003024094.1\|3058878_3059046_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_003024071.1\|3059066_3059303_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_003837605.1\|3059521_3060187_-	DNA repair protein RadC	NA	NA	NA	NA
WP_088169059.1\|3060357_3061578_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	7.2e-43	34.8
WP_006687626.1\|3061555_3062014_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	1.6e-48	60.1

DBSCAN-SWA_222

3066095 : 3071123

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700505.1\|3066095_3067775_-	NAD-dependent DNA ligase LigB	F8SJM3	Pseudomonas_phage	6.0e-24	22.4
WP_003024042.1\|3068036_3068660_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	2.2e-19	35.6
WP_000135058.1\|3068714_3068990_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_003024038.1\|3069008_3071123_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5

DBSCAN-SWA_223

3075383 : 3076775

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024026.1\|3075383_3076775_+	xanthine/proton symporter XanP	H9YQ34	environmental_Halophage	2.5e-68	95.9

DBSCAN-SWA_224

3091588 : 3094414

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700471.1\|3091588_3094414_-	intestinal colonization autotransporter adhesin MisL	A0A2L1IV18	Escherichia_phage	7.9e-101	48.4

DBSCAN-SWA_225

3103105 : 3104044

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700477.1\|3103105_3104044_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.3e-68	52.2

DBSCAN-SWA_226

3126481 : 3131322

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151213.1\|3126481_3128170_-	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	2.2e-58	30.4
WP_003827118.1\|3128277_3128376_-	ilvB operon leader peptide IvbL	NA	NA	NA	NA
WP_003840643.1\|3128897_3128987_+	type I toxin-antitoxin system toxin TisB	NA	NA	NA	NA
WP_032937131.1\|3129110_3129944_+	EamA family transporter	NA	NA	NA	NA
WP_003023905.1\|3130137_3131322_+	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	5.0e-17	25.1

DBSCAN-SWA_227

3139442 : 3140377

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840609.1\|3139442_3139871_-	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	2.7e-13	36.4
WP_003023882.1\|3139963_3140377_-	heat shock chaperone IbpA	A0A1D8KSJ6	Synechococcus_phage	4.6e-18	35.2

DBSCAN-SWA_228

3144435 : 3151944

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023868.1\|3144435_3146850_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.8e-114	34.1
WP_003844434.1\|3146878_3147952_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003023863.1\|3148090_3149191_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.1e-53	35.0
WP_003023861.1\|3149195_3150599_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_003023858.1\|3151205_3151346_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_003844432.1\|3151363_3151723_+	ribonuclease P protein component	NA	NA	NA	NA
WP_003023846.1\|3151686_3151944_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7

DBSCAN-SWA_229

3158919 : 3169528

Moraxella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840586.1\|3158919_3160257_-	adenine permease AdeP	A0A0R6PHV4	Moraxella_phage	9.6e-65	38.0
WP_003840584.1\|3160424_3161090_+	6-phosphogluconate phosphatase	NA	NA	NA	NA
WP_003023824.1\|3161174_3161900_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_003023821.1\|3161914_3162688_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
WP_003023819.1\|3162734_3163625_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003023817.1\|3163624_3164584_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_003023814.1\|3164728_3165769_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.0e-46	35.8
WP_003023813.1\|3166103_3167933_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.1e-122	41.4
WP_044700491.1\|3168157_3169528_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	4.3e-36	38.0

DBSCAN-SWA_230

3181810 : 3182803

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003827009.1\|3181810_3182803_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	3.8e-50	37.7

DBSCAN-SWA_231

3186077 : 3190071

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671079.1\|3186077_3187946_+	low affinity potassium transporter Kup	M1I6H8	Paramecium_bursaria_Chlorella_virus	4.2e-66	30.5
WP_003023766.1\|3188138_3188558_+	D-ribose pyranase	NA	NA	NA	NA
WP_003023764.1\|3188565_3190071_+	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	1.7e-17	21.9

DBSCAN-SWA_232

3205424 : 3207071

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841174.1\|3205424_3207071_+	acetolactate synthase 2 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.3e-65	31.8

DBSCAN-SWA_233

3216196 : 3221625

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003829018.1\|3216196_3218218_+	DNA helicase Rep	A7KV33	Bacillus_phage	2.2e-113	37.8
WP_003017996.1\|3218265_3219747_-	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
WP_003017994.1\|3219883_3221152_-	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	8.3e-42	31.2
WP_001280776.1\|3221295_3221625_+	thioredoxin TrxA	A0A1V0SD63	Indivirus	4.2e-14	38.5

DBSCAN-SWA_234

3225669 : 3229868

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032948215.1\|3225669_3226800_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.9e-26	26.8
WP_016151230.1\|3226796_3228059_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HFY9	Paramecium_bursaria_Chlorella_virus	1.2e-24	27.7
WP_032938460.1\|3228055_3228733_+	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
WP_044702221.1\|3228737_3229868_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	1.1e-18	41.7

DBSCAN-SWA_235

3246287 : 3250133

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841210.1\|3246287_3247190_+	tyrosine recombinase XerC	A0A142F1N9	Bacillus_phage	1.9e-24	29.5
WP_003017925.1\|3247189_3247906_+	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
WP_003017922.1\|3247970_3250133_+	DNA helicase II	A7KV33	Bacillus_phage	7.8e-117	37.6

DBSCAN-SWA_236

3254051 : 3257488

Catovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003017915.1\|3254051_3255881_+	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	2.5e-84	38.5
WP_003828942.1\|3255944_3256565_+	threonine export protein RhtC	NA	NA	NA	NA
WP_032950636.1\|3256603_3257488_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	5.7e-66	52.0

DBSCAN-SWA_237

3269333 : 3272653

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702239.1\|3269333_3270974_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	7.4e-43	29.5
WP_003017888.1\|3271052_3271307_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_003841235.1\|3271310_3271859_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_003017884.1\|3271861_3272653_+	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	6.8e-26	31.5

DBSCAN-SWA_238

3283602 : 3284217

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841252.1\|3283602_3284217_+	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	2.1e-19	45.7

DBSCAN-SWA_239

3296409 : 3299196

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701808.1\|3296409_3299196_+	DNA polymerase I	A8E2B3	Enterococcus_phage	4.9e-47	30.3

DBSCAN-SWA_240

3303108 : 3305578

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028633.1\|3303108_3304518_-	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	9.0e-05	28.7
WP_003028636.1\|3304528_3305578_-	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	2.6e-09	26.6

DBSCAN-SWA_241

3318286 : 3321083

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008323155.1\|3318286_3319183_-	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	4.6e-63	93.8
WP_044701814.1\|3319349_3320246_+	sugar kinase	NA	NA	NA	NA
WP_003847907.1\|3320279_3321083_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	4.9e-24	29.6

DBSCAN-SWA_242

3324224 : 3325133

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701816.1\|3324224_3325133_-	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	7.0e-27	31.2

DBSCAN-SWA_243

3328464 : 3331515

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088169089.1\|3328464_3331515_-	formate dehydrogenase-N subunit alpha	A0A077SK27	Escherichia_phage	6.5e-08	23.7

DBSCAN-SWA_244

3349311 : 3349932

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840480.1\|3349311_3349932_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	1.0e-61	57.4

DBSCAN-SWA_245

3352975 : 3355044

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840485.1\|3352975_3354349_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.1e-15	25.9
WP_003028763.1\|3354345_3355044_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	1.5e-05	29.5

DBSCAN-SWA_246

3368527 : 3369373

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028793.1\|3368527_3369373_-	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.8e-16	29.5

DBSCAN-SWA_247

3372755 : 3374087

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028803.1\|3372755_3374087_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	2.6e-46	29.2

DBSCAN-SWA_248

3395251 : 3395914

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847840.1\|3395251_3395914_-	fructose-6-phosphate aldolase	A0A0E3F0E2	Synechococcus_phage	3.2e-29	32.7

DBSCAN-SWA_249

3411921 : 3413760

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701858.1\|3411921_3413760_+	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	6.9e-13	30.7

DBSCAN-SWA_250

3422542 : 3443078

uncultured_Mediterranean_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031107.1\|3422542_3423493_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	8.7e-28	32.0
WP_003031109.1\|3424440_3425625_+	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_003033128.1\|3425855_3426239_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003033125.1\|3426240_3426786_+	transcription termination/antitermination protein NusG	A0A291AUS6	Sinorhizobium_phage	1.1e-14	29.6
WP_003033122.1\|3426940_3427369_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_044702700.1\|3427372_3428080_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_001207203.1\|3428494_3428992_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003033114.1\|3429058_3429424_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_003033111.1\|3429744_3433773_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	1.6e-22	29.4
WP_003033107.1\|3433849_3438073_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	1.0e-67	27.4
WP_003033104.1\|3438184_3438502_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003033102.1\|3438506_3438812_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003033098.1\|3439904_3440117_+	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	2.2e-24	78.6
WP_003845330.1\|3440248_3441370_-	2-iminoacetate synthase ThiH	NA	NA	NA	NA
WP_003842025.1\|3441366_3442137_-	thiazole synthase	NA	NA	NA	NA
WP_003033088.1\|3442138_3442339_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_003033085.1\|3442319_3443078_-	HesA/MoeB/ThiF family protein	A0A1V0SCZ9	Indivirus	3.5e-11	32.1

DBSCAN-SWA_251

3448445 : 3450209

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033072.1\|3448445_3449126_+	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	3.3e-21	30.1
WP_003842015.1\|3449159_3449750_+	YjaG family protein	NA	NA	NA	NA
WP_001044509.1\|3449936_3450209_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	5.5e-20	57.8

DBSCAN-SWA_252

3455700 : 3457290

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702690.1\|3455700_3457290_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.1e-66	47.1

DBSCAN-SWA_253

3470705 : 3474389

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702258.1\|3470705_3474389_+	methionine synthase	A0A140XBC7	Dickeya_phage	3.7e-26	90.2

DBSCAN-SWA_254

3477904 : 3478748

Brucella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702262.1\|3477904_3478183_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	2.5e-12	51.2
WP_003841416.1\|3478586_3478748_-	phage protein	A0A2H4JB52	uncultured_Caudovirales_phage	3.2e-07	52.1

DBSCAN-SWA_255

3496056 : 3496842

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702280.1\|3496056_3496842_+	nucleotidyltransferase domain-containing protein	A0A2D1GQQ2	Pseudomonas_phage	1.3e-50	47.2

DBSCAN-SWA_256

3512679 : 3513789

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031682.1\|3512679_3513789_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_257

3520972 : 3521581

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031703.1\|3520972_3521581_+	repressor LexA	Q9G0C2	Lactococcus_phage	1.0e-13	38.0

DBSCAN-SWA_258

3527380 : 3536374

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003826610.1\|3527380_3528796_+	replicative DNA helicase	O80281	Escherichia_phage	1.8e-199	77.9
WP_003031716.1\|3528812_3529892_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	3.1e-29	28.5
WP_044702292.1\|3530020_3531214_+	aromatic amino acid transaminase	NA	NA	NA	NA
WP_044702294.1\|3531462_3532176_+	acid phosphatase AphA	NA	NA	NA	NA
WP_003031719.1\|3532303_3532660_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_003031720.1\|3532775_3535598_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.6
WP_003826621.1\|3535849_3536374_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	1.1e-53	94.5

DBSCAN-SWA_259

3540457 : 3541807

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031735.1\|3540457_3541807_+	guanine/hypoxanthine transporter GhxP	A0A0R6PHV4	Moraxella_phage	8.8e-159	71.4

DBSCAN-SWA_260

3548726 : 3550685

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841063.1\|3548726_3550685_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.6e-92	41.3

DBSCAN-SWA_261

3567579 : 3569565

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702178.1\|3567579_3569565_-	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	7.9e-148	44.3

DBSCAN-SWA_262

3575374 : 3576898

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844755.1\|3575374_3576898_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-11	23.9

DBSCAN-SWA_263

3582755 : 3584284

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841104.1\|3582755_3583436_-	phosphonate C-P lyase system protein PhnL	F2Y2R6	Organic_Lake_phycodnavirus	8.4e-09	29.7
WP_003844769.1\|3583525_3584284_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	1.8e-15	28.2

DBSCAN-SWA_264

3590021 : 3590810

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841124.1\|3590021_3590810_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.5e-12	29.0

DBSCAN-SWA_265

3597382 : 3600199

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702152.1\|3597382_3598885_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	2.4e-56	31.5
WP_008321468.1\|3599042_3599132_+	LpxT activity modulator PmrR	NA	NA	NA	NA
WP_161799280.1\|3599125_3600199_-	two-component system sensor histidine kinase PmrB	W8CYF6	Bacillus_phage	4.4e-12	27.2

DBSCAN-SWA_266

3627024 : 3628686

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699204.1\|3627024_3628686_-	fatty acid--CoA ligase	Q75ZG1	Hepacivirus	1.9e-30	24.2

DBSCAN-SWA_267

3637385 : 3639369

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000027827.1\|3637385_3637679_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	1.2e-12	43.3
WP_003025464.1\|3637722_3639369_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.9e-188	68.1

DBSCAN-SWA_268

3644367 : 3644901

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844984.1\|3644367_3644901_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.6e-47	54.8

DBSCAN-SWA_269

3650803 : 3651781

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149440.1\|3650803_3651781_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	8.1e-29	29.1

DBSCAN-SWA_270

3659185 : 3659731

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839477.1\|3659185_3659731_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-28	41.0

DBSCAN-SWA_271

3663740 : 3666947

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699179.1\|3663740_3665072_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	1.1e-17	30.1
WP_003844967.1\|3665081_3666947_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.9e-61	42.4

DBSCAN-SWA_272

3672470 : 3677030

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025606.1\|3672470_3673769_+	adenylosuccinate synthase	W5S5V7	Pithovirus	2.9e-66	35.6
WP_003025609.1\|3673985_3674411_+	nitric oxide-sensing transcriptional repressor NsrR	NA	NA	NA	NA
WP_003025612.1\|3674567_3677030_+	ribonuclease R	Q0GXV6	Lactococcus_phage	9.4e-66	32.5

DBSCAN-SWA_273

3696420 : 3697974

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844953.1\|3696420_3697974_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-08	31.0

DBSCAN-SWA_274

3713848 : 3721601

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025726.1\|3713848_3714376_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.3e-56	63.3
WP_003025728.1\|3714685_3715642_+	galactofuranose ABC transporter substrate-binding protein YtfQ	NA	NA	NA	NA
WP_044699161.1\|3715745_3717248_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.4e-11	29.9
WP_008323019.1\|3717261_3718284_+	ABC transporter permease	NA	NA	NA	NA
WP_003025736.1\|3718270_3719272_+	sugar ABC transporter permease YjfF	NA	NA	NA	NA
WP_072213460.1\|3719375_3720488_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-14	34.0
WP_003025742.1\|3720602_3721601_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.1e-68	42.1

DBSCAN-SWA_275

3733510 : 3736740

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839576.1\|3733510_3733753_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	4.3e-16	52.5
WP_044699148.1\|3733742_3734027_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	6.6e-32	70.2
WP_032937736.1\|3734030_3734495_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	1.1e-52	57.7
WP_003025782.1\|3734601_3736740_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	2.0e-266	64.4

DBSCAN-SWA_276

3748458 : 3752504

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025788.1\|3748458_3749406_-	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	3.5e-13	21.8
WP_044699140.1\|3749795_3752504_+	magnesium-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	5.9e-45	27.5

DBSCAN-SWA_277

3756902 : 3757838

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025818.1\|3756902_3757838_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.4e-51	39.2

DBSCAN-SWA_278

3768750 : 3791064

Enterobacteria_phage(22.22%)

tRNA,integrase

attL 3761176:3761193|attR 3798894:3798911

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3761176:3761193	attL	NA	NA	NA	NA
WP_044699129.1\|3768750_3771606_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.1e-141	36.8
WP_003025862.1\|3771605_3772049_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_003025870.1\|3772167_3773679_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	7.1e-48	38.4
WP_003839630.1\|3773945_3775046_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_003025875.1\|3775045_3776128_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_003839633.1\|3776229_3777732_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	2.0e-82	44.3
WP_044699125.1\|3777879_3778899_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	1.9e-44	32.3
WP_023185880.1\|3779368_3780631_+\|integrase	integrase arm-type DNA-binding domain-containing protein	Q7M297	Enterobacteria_phage	2.8e-66	35.6
WP_044699122.1\|3780661_3781300_+	hypothetical protein	NA	NA	NA	NA
WP_044699119.1\|3781669_3781900_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_000190569.1\|3781996_3782182_-	hypothetical protein	NA	NA	NA	NA
WP_001118612.1\|3782372_3782549_+	host cell division inhibitor Icd-like protein	Q7M2A7	Enterobacteria_phage	4.2e-05	55.6
WP_044699117.1\|3782541_3782901_+	hypothetical protein	NA	NA	NA	NA
WP_044699116.1\|3782932_3783217_+	hypothetical protein	NA	NA	NA	NA
WP_044699115.1\|3783213_3783597_+	DUF5375 family protein	NA	NA	NA	NA
WP_044699113.1\|3783593_3786266_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.6e-58	34.4
WP_044699110.1\|3786667_3787429_+	septation initiation protein	NA	NA	NA	NA
WP_044699108.1\|3787428_3787701_+	ogr/Delta-like zinc finger family protein	A0A2I8TV89	Erwinia_phage	4.9e-08	43.9
WP_044699107.1\|3787720_3788533_+	hypothetical protein	NA	NA	NA	NA
WP_044699105.1\|3788826_3791064_+	AAA family ATPase	Q7Y4B3	Escherichia_virus	4.7e-08	23.7
3798894:3798911	attR	NA	NA	NA	NA

DBSCAN-SWA_279

3807130 : 3811563

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837172.1\|3807130_3808606_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	5.8e-47	31.6
WP_003033268.1\|3808738_3809512_+	Uxu operon transcriptional regulator	NA	NA	NA	NA
WP_008322159.1\|3810160_3810364_+	hypothetical protein	NA	NA	NA	NA
WP_008322158.1\|3810555_3811563_+	porin	Q1MVN1	Enterobacteria_phage	8.2e-85	49.7

DBSCAN-SWA_280

3830860 : 3832522

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699072.1\|3830860_3832522_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-08	72.3

DBSCAN-SWA_281

3835712 : 3838194

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837229.1\|3835712_3836735_+	zinc-binding alcohol dehydrogenase family protein	A0A2K9L7I1	Tupanvirus	3.9e-10	26.0
WP_016149507.1\|3836748_3838194_+	tagaturonate reductase	G8DCZ3	Micromonas_pusilla_virus	3.9e-19	26.0

DBSCAN-SWA_282

3841321 : 3842601

Shigella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019133.1\|3841321_3842059_-	DNA replication protein DnaC	V5UQI5	Shigella_phage	2.9e-63	51.2
WP_003019130.1\|3842061_3842601_-	primosomal protein DnaT	T1SA92	Salmonella_phage	4.9e-28	61.7

DBSCAN-SWA_283

3848942 : 3850019

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837249.1\|3848942_3850019_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-20	39.2

DBSCAN-SWA_284

3853842 : 3856647

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019086.1\|3853842_3855432_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	2.7e-29	24.8
WP_003837258.1\|3855740_3856358_+	molecular chaperone OsmY	NA	NA	NA	NA
WP_003019081.1\|3856485_3856647_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	2.8e-11	66.0

DBSCAN-SWA_285

3862189 : 3863512

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019040.1\|3862189_3863512_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	4.4e-78	39.3

DBSCAN-SWA_286

3870022 : 3875288

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019021.1\|3870022_3871252_+	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.5e-85	44.0
WP_003845630.1\|3871351_3873019_-	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	2.4e-41	26.4
WP_044699047.1\|3873350_3875288_+	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	1.6e-12	36.2

DBSCAN-SWA_287

3879246 : 3880671

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699045.1\|3879246_3880671_+	two-component system sensor histidine kinase CreC	Q8QKV7	Ectocarpus_siliculosus_virus	5.1e-08	21.4

DBSCAN-SWA_288

3891868 : 3892822

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018974.1\|3891868_3892822_+	transaldolase	A0A0E3G6C9	Synechococcus_phage	1.3e-10	34.4

DBSCAN-SWA_289

3897223 : 3906885

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018959.1\|3897223_3899146_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.4e-146	50.3
WP_003837322.1\|3899231_3900365_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.5e-29	34.6
WP_032941170.1\|3900717_3901482_+	membrane protein	NA	NA	NA	NA
WP_044699031.1\|3901502_3902996_+	sulfatase-like hydrolase/transferase	A0A2P0VMN7	Tetraselmis_virus	1.7e-30	30.1
WP_032941172.1\|3903098_3904289_+	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_003837330.1\|3904313_3905576_+	hypothetical protein	NA	NA	NA	NA
WP_003018952.1\|3905718_3906885_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.6e-90	51.5

DBSCAN-SWA_290

3913357 : 3916174

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149528.1\|3913357_3916174_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	3.0e-76	25.5

DBSCAN-SWA_291

3920621 : 3921770

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018918.1\|3920621_3921770_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.2e-49	32.4

DBSCAN-SWA_292

3927202 : 3932835

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699019.1\|3927202_3928756_-	crotonobetaine/carnitine-CoA ligase	A0A2K9KZV5	Tupanvirus	5.4e-19	22.3
WP_044699018.1\|3928817_3930035_-	L-carnitine CoA-transferase	NA	NA	NA	NA
WP_003018898.1\|3930140_3931283_-	crotonobetainyl-CoA dehydrogenase	NA	NA	NA	NA
WP_044699016.1\|3931317_3932835_-	L-carnitine/gamma-butyrobetaine antiport BCCT transporter	A0A2I7QNT1	Vibrio_phage	2.5e-08	22.1

DBSCAN-SWA_293

3941165 : 3942590

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018873.1\|3941165_3941645_+	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	3.0e-29	47.1
WP_044699010.1\|3941741_3942590_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A0A0YWI7	Pseudomonas_phage	6.4e-06	45.3

DBSCAN-SWA_294

3950321 : 3955711

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699006.1\|3950321_3953228_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	1.3e-21	38.5
WP_044699004.1\|3953359_3955711_-	DNA polymerase II	A0A1B2RW58	Lymphocystis_disease_virus	3.2e-15	25.1

DBSCAN-SWA_295

3962863 : 3963562

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937527.1\|3962863_3963562_-	thiamine ABC transporter ATP-binding protein ThiQ	G3M9Y6	Bacillus_virus	8.9e-22	38.2

DBSCAN-SWA_296

3980021 : 3981746

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845729.1\|3980021_3981746_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	3.0e-34	26.1

DBSCAN-SWA_297

4007765 : 4008809

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044698978.1\|4007765_4008809_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	2.0e-102	55.0

DBSCAN-SWA_298

4013111 : 4013675

Thiobacimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047715961.1\|4013111_4013675_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1B0T6G1	Thiobacimonas_phage	3.6e-13	33.1

DBSCAN-SWA_299

4024741 : 4026166

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018686.1\|4024741_4026166_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.6e-41	26.9

DBSCAN-SWA_300

4033655 : 4039694

Mamastrovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845765.1\|4033655_4035275_+	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	4.3e-19	55.3
WP_003837476.1\|4035459_4037115_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.3e-14	31.8
WP_003018658.1\|4037366_4037903_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.9e-17	33.1
WP_003018654.1\|4037996_4038659_-	carbonate dehydratase	NA	NA	NA	NA
WP_044698970.1\|4038767_4039694_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.1e-22	33.2

DBSCAN-SWA_301

4045142 : 4051965

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071524282.1\|4045142_4046561_-	polynucleotide adenylyltransferase PcnB	G3MAR3	Bacillus_virus	5.5e-26	35.9
WP_016149569.1\|4046611_4047508_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_003018625.1\|4047578_4048034_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_003837495.1\|4048211_4048916_-	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_003018620.1\|4048931_4049462_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_044698965.1\|4049535_4051965_+	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	1.3e-38	29.7

DBSCAN-SWA_302

4062610 : 4063408

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845793.1\|4062610_4063408_+	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	3.5e-14	27.4

DBSCAN-SWA_303

4069343 : 4069688

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018581.1\|4069343_4069688_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	5.9e-27	50.5

DBSCAN-SWA_304

4073690 : 4075124

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018567.1\|4073690_4075124_+\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.1e-25	29.8

DBSCAN-SWA_305

4086548 : 4087307

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018543.1\|4086548_4087307_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	7.2e-25	41.5

DBSCAN-SWA_306

4096126 : 4100230

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044698940.1\|4096126_4096723_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.0e-26	39.8
WP_003018516.1\|4096747_4100230_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	5.9e-207	37.0

DBSCAN-SWA_307

4112250 : 4113282

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018468.1\|4112250_4113282_-	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_308

4119738 : 4120542

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044702527.1\|4119738_4120542_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	6.6e-37	35.0

DBSCAN-SWA_309

4124586 : 4128785

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031421.1\|4124586_4125945_-	murein transglycosylase D	A0A0A7NU10	Lactobacillus_phage	8.9e-10	28.6
WP_003031418.1\|4126016_4126772_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_003031413.1\|4126805_4127528_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003031412.1\|4127524_4127992_-	ribonuclease HI	J9Q745	Salmonella_phage	6.5e-53	60.1
WP_003031410.1\|4128056_4128785_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	3.1e-41	40.7

DBSCAN-SWA_310

4144378 : 4147661

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031390.1\|4144378_4144960_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	5.7e-14	30.8
WP_044702507.1\|4145071_4145839_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_003031387.1\|4145809_4146550_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_032937061.1\|4146899_4147661_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.0e-19	38.5

DBSCAN-SWA_311

4150689 : 4204103

Stx2-converting_phage(28.57%)

holin,integrase,transposase

attL 4172799:4172847|attR 4204286:4204334

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001395480.1\|4150689_4151721_-\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_003031382.1\|4152162_4153218_+	DNA polymerase IV	NA	NA	NA	NA
WP_044702503.1\|4153318_4154776_-	cytosol nonspecific dipeptidase	NA	NA	NA	NA
WP_003031380.1\|4155037_4155496_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_044702502.1\|4155596_4156841_+	esterase FrsA	NA	NA	NA	NA
WP_003031376.1\|4156898_4157300_+	sigma factor-binding protein Crl	NA	NA	NA	NA
WP_003843783.1\|4157356_4158412_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.5e-116	59.5
WP_003031373.1\|4158701_4159805_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.6e-60	39.6
WP_003031370.1\|4159816_4161070_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.9e-99	47.5
WP_044702490.1\|4161340_4162060_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_003031365.1\|4162655_4163243_+	fimbrillin MatB	NA	NA	NA	NA
WP_003031363.1\|4163295_4163973_+	hypothetical protein	NA	NA	NA	NA
WP_008324497.1\|4164031_4166524_+	CS1-pili formation C-terminal domain-containing protein	NA	NA	NA	NA
WP_044702486.1\|4166528_4168145_+	hypothetical protein	NA	NA	NA	NA
WP_003031358.1\|4168141_4168837_+	molecular chaperone	NA	NA	NA	NA
WP_044702485.1\|4168981_4169713_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044702484.1\|4169687_4170161_+	hypothetical protein	NA	NA	NA	NA
WP_044702495.1\|4170502_4171951_+	EAL domain-containing protein	NA	NA	NA	NA
WP_044702482.1\|4172142_4172607_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
4172799:4172847	attL	NA	NA	NA	NA
WP_003031349.1\|4173236_4173578_-	type IV toxin-antitoxin system toxin YkfI	NA	NA	NA	NA
WP_003031347.1\|4173598_4173916_-	type IV toxin-antitoxin system YeeU family antitoxin	NA	NA	NA	NA
WP_003031346.1\|4173933_4174155_-	DUF987 domain-containing protein	NA	NA	NA	NA
WP_003031345.1\|4174163_4174640_-	RadC family protein	NA	NA	NA	NA
WP_003031344.1\|4174655_4175117_-	antirestriction protein	A0A1S5R3R9	Pseudomonas_phage	3.7e-08	32.3
WP_016245729.1\|4175825_4177823_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	2.6e-21	26.2
WP_003036928.1\|4177887_4179165_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_003036925.1\|4179440_4179791_+	Morphinone reductase	NA	NA	NA	NA
WP_003029616.1\|4180889_4181330_-	hypothetical protein	NA	NA	NA	NA
WP_003029614.1\|4181319_4181565_-	hypothetical protein	NA	NA	NA	NA
WP_003029611.1\|4181605_4182307_-	WYL domain-containing protein	NA	NA	NA	NA
WP_003029610.1\|4182523_4183345_-	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.8e-45	38.3
WP_003029608.1\|4183436_4184300_-	GTPase family protein	NA	NA	NA	NA
WP_032933065.1\|4184762_4185668_+	WYL domain-containing protein	NA	NA	NA	NA
WP_003029596.1\|4187137_4188289_+\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	8.9e-43	35.6
WP_164847251.1\|4188364_4188880_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	S5FNT8	Shigella_phage	1.9e-90	94.0
WP_003029591.1\|4189068_4190073_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003029589.1\|4190102_4191503_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	2.0e-20	26.1
WP_000345204.1\|4191502_4192873_-	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_003029587.1\|4193010_4194528_-	carbohydrate porin	NA	NA	NA	NA
WP_003029584.1\|4194693_4195617_-	aminoimidazole riboside kinase	NA	NA	NA	NA
WP_077258089.1\|4195845_4196016_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042922212.1\|4196479_4196857_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.4e-58	90.4
WP_042922210.1\|4196856_4197204_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.8e-61	98.3
WP_042922208.1\|4197253_4198792_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-271	91.0
WP_003029582.1\|4198975_4199284_+	maltose O-acetyltransferase	NA	NA	NA	NA
WP_003029581.1\|4199312_4199969_+	hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	6.2e-09	82.1
WP_003029579.1\|4200024_4200645_-	inovirus Gp2 family protein	NA	NA	NA	NA
WP_003029576.1\|4201106_4201871_-	hypothetical protein	NA	NA	NA	NA
WP_003847740.1\|4202005_4202227_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_044699238.1\|4202223_4202673_-	hypothetical protein	NA	NA	NA	NA
WP_044699239.1\|4202795_4204103_-\|integrase	integrase family protein	A0A221SAN4	Ralstonia_phage	3.1e-07	29.1
4204286:4204334	attR	NA	NA	NA	NA

DBSCAN-SWA_312

4229711 : 4234040

Phormidium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699269.1\|4229711_4234040_-	AAA family ATPase	U5XJW0	Phormidium_phage	4.3e-66	33.2

DBSCAN-SWA_313

4238866 : 4239979

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699274.1\|4238866_4239979_-	agmatine deiminase family protein	M1H3B1	Paramecium_bursaria_Chlorella_virus	1.1e-53	35.2

DBSCAN-SWA_314

4248074 : 4248980

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699286.1\|4248074_4248980_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.2e-14	25.0

DBSCAN-SWA_315

4255713 : 4256541

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937018.1\|4255713_4256541_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.8e-17	29.0

DBSCAN-SWA_316

4270110 : 4278320

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699308.1\|4270110_4271997_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.1e-53	29.8
WP_003021330.1\|4272087_4272699_-	galactoside O-acetyltransferase	NA	NA	NA	NA
WP_044699309.1\|4272727_4273981_-	MFS transporter	NA	NA	NA	NA
WP_044699310.1\|4274032_4277116_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	81.2
WP_044699311.1\|4277237_4278320_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.7e-160	82.3

DBSCAN-SWA_317

4289080 : 4291041

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699322.1\|4289080_4290031_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	3.1e-33	36.3
WP_003021379.1\|4290027_4291041_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	3.2e-44	31.1

DBSCAN-SWA_318

4295029 : 4296076

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699326.1\|4295029_4296076_-	ferric ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-34	38.2

DBSCAN-SWA_319

4304136 : 4304904

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838608.1\|4304136_4304904_+	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	3.3e-25	38.6

DBSCAN-SWA_320

4321545 : 4322661

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085954043.1\|4321545_4322661_+	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	5.3e-16	34.6

DBSCAN-SWA_321

4326412 : 4336265

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021479.1\|4326412_4327324_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.7e-103	64.3
WP_044699335.1\|4327415_4328324_+	fructokinase	NA	NA	NA	NA
WP_032937081.1\|4328331_4329504_-	MFS transporter AraJ	NA	NA	NA	NA
WP_044699338.1\|4329696_4332840_-	exonuclease subunit SbcC	G3MAB6	Bacillus_virus	1.7e-11	26.4
WP_032936985.1\|4332836_4334039_-	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	2.0e-08	25.6
WP_003021496.1\|4334229_4334919_+	phosphate response regulator transcription factor PhoB	W8CYM9	Bacillus_phage	2.0e-37	38.9
WP_016149692.1\|4334969_4336265_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.4e-28	30.3

DBSCAN-SWA_322

4348511 : 4358119

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021535.1\|4348511_4349639_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-89	46.3
WP_003021544.1\|4349661_4349994_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
WP_071681428.1\|4350021_4351869_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_003021550.1\|4351879_4352851_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.4e-44	37.8
WP_044699354.1\|4353019_4353385_+	VOC family protein	NA	NA	NA	NA
WP_003835974.1\|4353408_4354101_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	4.5e-18	30.1
WP_003021561.1\|4354146_4355010_-	nucleoside-specific channel-forming protein Tsx	NA	NA	NA	NA
WP_044699517.1\|4355308_4355848_-	DUF3251 domain-containing protein	NA	NA	NA	NA
WP_003021571.1\|4356001_4356451_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_003021573.1\|4356454_4357558_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.4e-52	35.5
WP_003021575.1\|4357648_4358119_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.8e-30	47.4

DBSCAN-SWA_323

4380758 : 4385803

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021624.1\|4380758_4381382_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.9e-64	63.9
WP_003831013.1\|4381508_4382783_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.9e-131	56.4
WP_003021627.1\|4382967_4385322_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.6
WP_003021629.1\|4385530_4385803_+	DNA-binding protein HU-beta	A7KV42	Bacillus_phage	1.5e-20	58.4

DBSCAN-SWA_324

4389084 : 4389780

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835948.1\|4389084_4389780_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	6.5e-89	68.4

DBSCAN-SWA_325

4394190 : 4397734

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835940.1\|4394190_4395963_+	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.1e-47	29.7
WP_032936971.1\|4395955_4397734_+	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-41	27.8

DBSCAN-SWA_326

4410057 : 4413207

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021736.1\|4410057_4413207_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	9.5e-55	23.7

DBSCAN-SWA_327

4420126 : 4428756

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021759.1\|4420126_4420678_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	7.0e-30	46.6
WP_003021761.1\|4420888_4422820_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	1.3e-43	41.5
WP_003021764.1\|4422877_4423207_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003021767.1\|4423206_4423812_+	recombination protein RecR	NA	NA	NA	NA
WP_003021770.1\|4423922_4425797_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	2.0e-113	36.4
WP_003021773.1\|4426029_4426674_+	adenylate kinase	NA	NA	NA	NA
WP_003021775.1\|4426837_4427800_+	ferrochelatase	NA	NA	NA	NA
WP_044699378.1\|4427796_4428756_-	acetyl esterase	A0A167RJ59	Powai_lake_megavirus	1.9e-14	29.0

DBSCAN-SWA_328

4436940 : 4440360

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699386.1\|4436940_4439442_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	2.9e-115	38.4
WP_044699387.1\|4439589_4440360_-	heme ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.2e-15	27.9

DBSCAN-SWA_329

4451912 : 4452590

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835797.1\|4451912_4452590_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	3.1e-27	35.2

DBSCAN-SWA_330

4455740 : 4456427

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699413.1\|4455740_4456427_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.1e-31	34.2

DBSCAN-SWA_331

4461323 : 4462340

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835783.1\|4461323_4462340_+	virulence-associated ABC transporter ATP-binding protein SfbB	G9BWD6	Planktothrix_phage	1.5e-33	38.6

DBSCAN-SWA_332

4468831 : 4470060

Shigella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148116659.1\|4468831_4470060_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.5e-146	81.7

DBSCAN-SWA_333

4478504 : 4479653

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699430.1\|4478504_4479653_+	glycerate 3-kinase	W6LM47	Streptococcus_phage	5.0e-46	40.6

DBSCAN-SWA_334

4491048 : 4494256

Moumouvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003831109.1\|4491048_4492434_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.6e-46	35.4
WP_003835753.1\|4492525_4493050_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_044699447.1\|4493175_4493388_-	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_003021887.1\|4493389_4494256_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.2e-28	36.5

DBSCAN-SWA_335

4504234 : 4514137

Hokovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071681432.1\|4504234_4507000_-	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	4.0e-33	31.3
WP_044699462.1\|4507082_4508114_+	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_003021912.1\|4508086_4508779_-	two-component system response regulator TorR	W8CYM9	Bacillus_phage	4.9e-20	28.9
WP_003021915.1\|4508910_4510089_+	pentaheme c-type cytochrome TorC	NA	NA	NA	NA
WP_044699463.1\|4510078_4512619_+	trimethylamine-N-oxide reductase TorA	A0A077SK27	Escherichia_phage	1.1e-72	30.2
WP_032936924.1\|4512615_4513230_+	molecular chaperone TorD	NA	NA	NA	NA
WP_003835732.1\|4513708_4514137_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	7.4e-27	49.3

DBSCAN-SWA_336

4520515 : 4522640

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847479.1\|4520515_4521967_-	Cu(+)/Ag(+) sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.5e-10	26.8
WP_003021940.1\|4521956_4522640_-	copper response regulator transcription factor CusR	W8CYM9	Bacillus_phage	6.0e-31	35.6

DBSCAN-SWA_337

4525978 : 4531590

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699469.1\|4525978_4529122_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	5.9e-57	21.9
WP_044699470.1\|4529173_4530028_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_044699473.1\|4530264_4531590_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	3.8e-106	45.8

DBSCAN-SWA_338

4535482 : 4544821

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047715968.1\|4535482_4544821_-	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.3e-11	24.5

DBSCAN-SWA_339

4552718 : 4553699

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835685.1\|4552718_4553699_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	8.4e-26	31.5

DBSCAN-SWA_340

4565379 : 4573468

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699489.1\|4565379_4569270_+	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	1.6e-64	29.9
WP_044699491.1\|4569497_4570631_+	LPS O-antigen length regulator	NA	NA	NA	NA
WP_003022023.1\|4570677_4571475_-	iron-enterobactin ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	6.4e-08	23.0
WP_003022026.1\|4571471_4572464_-	iron-enterobactin ABC transporter permease	NA	NA	NA	NA
WP_003835646.1\|4572460_4573468_-	Fe(3+)-siderophore ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.2e-13	26.0

DBSCAN-SWA_341

4585894 : 4587720

uncultured_marine_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847426.1\|4585894_4586512_-	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	1.1e-52	50.3
WP_003835626.1\|4586496_4587720_-	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	5.9e-61	33.1

DBSCAN-SWA_342

4590832 : 4598962

Escherichia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835619.1\|4590832_4592398_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	1.1e-43	34.0
WP_044699507.1\|4592621_4593176_+	molecular chaperone TorD family protein	NA	NA	NA	NA
WP_044699509.1\|4593172_4595443_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	8.4e-45	25.0
WP_003022094.1\|4595439_4595997_+	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	6.2e-26	37.7
WP_044700970.1\|4595996_4596764_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003022101.1\|4596833_4597262_-	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	1.1e-17	38.5
WP_003022104.1\|4597445_4597856_-	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_044700974.1\|4598131_4598962_+	alpha/beta hydrolase	W8EHU1	Mycobacterium_phage	7.1e-18	31.7

DBSCAN-SWA_343

4612795 : 4613440

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000034825.1\|4612795_4613005_+	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	2.7e-22	78.1
WP_016149775.1\|4613056_4613440_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.8e-23	52.6

DBSCAN-SWA_344

4617047 : 4619511

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022711.1\|4617047_4618259_-	D-alanyl-D-alanine carboxypeptidase DacA	B6DZZ7	Stx2-converting_phage	9.8e-101	47.9
WP_044700988.1\|4618401_4619511_-	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	2.1e-09	56.5

DBSCAN-SWA_345

4627676 : 4632851

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108961715.1\|4627676_4630259_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	9.5e-186	42.6
WP_003022748.1\|4630494_4630977_+	zinc ribbon-containing protein	NA	NA	NA	NA
WP_003847389.1\|4631073_4632009_-	pyrimidine-specific ribonucleoside hydrolase RihA	NA	NA	NA	NA
WP_003022754.1\|4632125_4632851_-	glutamate/aspartate ABC transporter ATP binding protein GltL	G9BWD6	Planktothrix_phage	1.1e-30	38.1

DBSCAN-SWA_346

4638811 : 4639858

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022776.1\|4638811_4639858_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	3.2e-47	46.6

DBSCAN-SWA_347

4644448 : 4646113

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835552.1\|4644448_4646113_-	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	2.1e-85	39.5

DBSCAN-SWA_348

4650912 : 4667815

Vibrio_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149786.1\|4650912_4652862_+	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.1e-08	48.6
WP_003835546.1\|4653048_4654716_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.0
WP_003835544.1\|4655151_4656558_+	chitoporin	NA	NA	NA	NA
WP_003022817.1\|4656607_4656940_+	hypothetical protein	NA	NA	NA	NA
WP_003835542.1\|4656991_4658287_-	MFS transporter	Q6JIH2	Burkholderia_virus	9.0e-60	34.4
WP_044701000.1\|4658340_4659480_-	tricarballylate utilization 4Fe-4S protein TcuB	NA	NA	NA	NA
WP_044701001.1\|4659466_4660870_-	FAD-dependent tricarballylate dehydrogenase TcuA	A0A2P0ZL82	Lactobacillus_phage	1.0e-08	25.9
WP_044701004.1\|4660967_4661894_-	tricarballylate utilization LysR family transcriptional regulator TcuR	NA	NA	NA	NA
WP_003022836.1\|4662023_4662470_-	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_049259739.1\|4662462_4662549_-	ryhB-regulated fur leader peptide	NA	NA	NA	NA
WP_003022839.1\|4662759_4663290_-	flavodoxin FldA	NA	NA	NA	NA
WP_003022842.1\|4663445_4663733_-	LexA regulated protein	NA	NA	NA	NA
WP_044701063.1\|4663861_4664635_-	esterase	A0A1J0GVH7	Mycobacterium_phage	3.1e-07	37.2
WP_003022848.1\|4664829_4665372_+	replication initiation negative regulator SeqA	NA	NA	NA	NA
WP_044701007.1\|4665396_4667037_+	alpha-D-glucose phosphate-specific phosphoglucomutase	NA	NA	NA	NA
WP_003022856.1\|4667137_4667815_-	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.6e-26	32.0

DBSCAN-SWA_349

4671081 : 4673130

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022864.1\|4671081_4673130_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.7e-31	24.7

DBSCAN-SWA_350

4676497 : 4680523

Hokovirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701018.1\|4676497_4677916_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	1.7e-64	33.8
WP_016149795.1\|4678076_4678991_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.1e-67	48.0
WP_003847348.1\|4679041_4680523_-	dipeptide permease DtpD	A0A0P0IY73	Acinetobacter_phage	1.3e-43	27.5

DBSCAN-SWA_351

4686314 : 4687106

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701028.1\|4686314_4687106_+	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	2.2e-08	31.1

DBSCAN-SWA_352

4729980 : 4733496

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022990.1\|4729980_4730700_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	5.8e-24	33.6
WP_003022992.1\|4730696_4731638_-	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	3.7e-23	27.5
WP_003022994.1\|4731751_4732126_-	hypothetical protein	NA	NA	NA	NA
WP_003837108.1\|4732443_4733496_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4VUY9	Pandoravirus	1.7e-80	47.3

DBSCAN-SWA_353

4737791 : 4744357

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837100.1\|4737791_4738808_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.3e-77	45.1
WP_032938578.1\|4739025_4740498_-	molybdate ABC transporter ATP-binding protein ModF	W5SAS9	Pithovirus	1.0e-11	27.1
WP_003023018.1\|4740565_4741354_-	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_003023026.1\|4741484_4741634_+	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_044701075.1\|4741833_4742607_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003023032.1\|4742606_4743296_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_003837092.1\|4743298_4744357_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	2.6e-20	33.8

DBSCAN-SWA_354

4758706 : 4762146

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837068.1\|4758706_4760227_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.7e-81	39.9
WP_044701085.1\|4760322_4760799_-	kinase inhibitor	NA	NA	NA	NA
WP_044701086.1\|4760856_4762146_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	1.5e-19	28.8

DBSCAN-SWA_355

4765812 : 4770357

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035181.1\|4765812_4766535_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-09	25.5
WP_003837055.1\|4767304_4769326_+	excinuclease ABC subunit B	NA	NA	NA	NA
WP_032938564.1\|4769448_4770357_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	2.7e-26	31.1

DBSCAN-SWA_356

4780075 : 4785042

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845404.1\|4780075_4781812_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-17	31.5
WP_032938552.1\|4781804_4782800_-	secretion protein HlyD	NA	NA	NA	NA
WP_047715970.1\|4782796_4783474_-	transcriptional regulator CecR	NA	NA	NA	NA
WP_003035219.1\|4783695_4785042_+	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.0e-53	34.0

DBSCAN-SWA_357

4789009 : 4795088

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837021.1\|4789009_4791160_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	2.8e-42	27.3
WP_003035227.1\|4791189_4792158_+	DNA-binding protein YbiB	NA	NA	NA	NA
WP_044701098.1\|4792320_4793406_+	malate/lactate/ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_003035231.1\|4793504_4793765_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_003035233.1\|4794068_4794335_-	DksA/TraR family C4-type zinc finger protein	A0A2C9CZU7	Yersinia_phage	3.6e-16	51.1
WP_003837014.1\|4794410_4795088_-	PKHD-type hydroxylase YbiX	Q5GQB0	Synechococcus_phage	2.6e-18	30.6

DBSCAN-SWA_358

4801460 : 4806650

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035246.1\|4801460_4802183_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	2.8e-34	41.1
WP_003035248.1\|4802179_4802839_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_003837002.1\|4802976_4803723_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_003035253.1\|4804088_4804592_-	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	5.5e-05	28.1
WP_003035255.1\|4804893_4805781_-	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_003035257.1\|4806134_4806650_+	outer membrane protein OmpX	A5LH44	Enterobacteria_phage	1.9e-16	33.7

DBSCAN-SWA_359

4811719 : 4819990

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035269.1\|4811719_4813315_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	8.5e-60	28.5
WP_044701107.1\|4813458_4814721_-	DUF1479 domain-containing protein	NA	NA	NA	NA
WP_044701108.1\|4814874_4815690_-	HAD family hydrolase	NA	NA	NA	NA
WP_044701109.1\|4815857_4818290_-	glycyl radical protein	A0A076YHZ7	Citrobacter_phage	2.3e-08	50.9
WP_032936389.1\|4818295_4819195_-	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_003836983.1\|4819327_4819990_+	fructose-6-phosphate aldolase	A0A1D8KKK9	Synechococcus_phage	2.2e-22	31.8

DBSCAN-SWA_360

4824169 : 4826041

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836972.1\|4824169_4826041_+	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	3.7e-14	27.2

DBSCAN-SWA_361

4831149 : 4834956

Shigella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_131138615.1\|4831149_4832317_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	6.4e-166	89.5
WP_003845471.1\|4832588_4832831_+	hypothetical protein	NA	NA	NA	NA
WP_003845473.1\|4832831_4833218_+	hypothetical protein	NA	NA	NA	NA
WP_071681817.1\|4834152_4834956_-	chaperonin	A0A0F7L9X0	Escherichia_phage	1.8e-79	52.3

DBSCAN-SWA_362

4845925 : 4847931

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035316.1\|4845925_4847128_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.9e-97	47.1
WP_003836960.1\|4847172_4847931_-	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	3.9e-15	28.8

DBSCAN-SWA_363

4856122 : 4869478

Salmonella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845517.1\|4856122_4857334_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	3.0e-190	90.2
WP_161799272.1\|4857689_4857791_+	hypothetical protein	NA	NA	NA	NA
WP_003035354.1\|4857806_4859492_-	aspartate:alanine antiporter	NA	NA	NA	NA
WP_003035356.1\|4859761_4860142_+	membrane protein	NA	NA	NA	NA
WP_003035358.1\|4860176_4860440_-	glutaredoxin, GrxA family	A0A2I7SAE2	Vibrio_phage	3.8e-26	67.9
WP_003845523.1\|4860612_4860903_+	YbjC family protein	NA	NA	NA	NA
WP_044701671.1\|4860886_4861609_+	nitroreductase NfsA	NA	NA	NA	NA
WP_003836932.1\|4861668_4862571_+	30S ribosomal protein S6--L-glutamate ligase	I3ULC9	Synechococcus_phage	2.0e-37	34.0
WP_003035368.1\|4862661_4863138_+	YbjN domain-containing protein	NA	NA	NA	NA
WP_003035370.1\|4863571_4864684_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
WP_003035373.1\|4864822_4865956_+	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	1.1e-29	34.9
WP_044701670.1\|4865965_4866919_+	putrescine ABC transporter permease PotH	NA	NA	NA	NA
WP_003035376.1\|4866915_4867761_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
WP_003035378.1\|4867820_4868309_+	YbjO family protein	NA	NA	NA	NA
WP_044701666.1\|4868350_4869478_+	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	1.6e-28	27.4

DBSCAN-SWA_364

4873014 : 4927431

Escherichia_phage(42.22%)

portal,capsid,tail,integrase,plate,tRNA,terminase,lysis,head

attL 4891471:4891487|attR 4929193:4929209

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032948928.1\|4873014_4873719_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_003035722.1\|4873763_4875485_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	W8CYL7	Bacillus_phage	1.4e-15	23.6
WP_044701662.1\|4875485_4877252_-	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	1.8e-23	26.2
WP_003035727.1\|4877366_4878335_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.9e-62	44.3
WP_002439523.1\|4878882_4879377_+	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_046155120.1\|4879511_4883495_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.8e-88	49.2
WP_003831898.1\|4883606_4884218_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_044701644.1\|4884228_4885572_+	replication-associated recombination protein RarA	G3MBE0	Bacillus_virus	1.1e-81	41.0
WP_003836908.1\|4885664_4886957_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.5e-94	46.1
WP_032948932.1\|4887193_4889638_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	3.5e-222	50.7
WP_003035741.1\|4889648_4890266_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	2.8e-75	59.1
WP_003035744.1\|4890267_4891131_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003035746.1\|4891240_4891867_-	hydrolase	NA	NA	NA	NA
4891471:4891487	attL	NA	NA	NA	NA
WP_003836902.1\|4892251_4893400_+	MFS transporter	NA	NA	NA	NA
WP_003035749.1\|4893613_4895035_+	amino acid permease	NA	NA	NA	NA
WP_044701640.1\|4895078_4895876_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.7e-21	26.6
WP_044701636.1\|4895907_4896903_-\|integrase	tyrosine-type recombinase/integrase	A0A0F7LBR0	Escherichia_phage	1.0e-167	87.6
WP_040090132.1\|4897045_4897345_-	helix-turn-helix transcriptional regulator	Q1JS29	Enterobacteria_phage	1.4e-32	73.7
WP_044701633.1\|4897448_4897805_+	hypothetical protein	A0A0F7LDH4	Escherichia_phage	3.8e-45	76.1
WP_164845066.1\|4897815_4897992_+	hypothetical protein	S4TNZ7	Salmonella_phage	2.1e-12	71.2
WP_044701632.1\|4897982_4898483_+	hypothetical protein	M1SV55	Escherichia_phage	7.4e-79	84.9
WP_044701629.1\|4898546_4898771_+	DUF2732 family protein	Q7Y4C2	Escherichia_virus	1.6e-17	67.6
WP_044701628.1\|4898770_4899070_+	DUF5405 family protein	M1RZ07	Escherichia_phage	3.6e-20	57.7
WP_044701626.1\|4899069_4899345_+	DUF5405 family protein	M1TAP2	Escherichia_phage	4.7e-27	63.7
WP_044701624.1\|4899334_4901626_+	replication endonuclease	A0A0F7LBQ2	Escherichia_phage	0.0e+00	74.4
WP_044701622.1\|4901725_4902211_+	hypothetical protein	NA	NA	NA	NA
WP_044701651.1\|4902226_4903318_-	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	7.0e-05	36.8
WP_023223238.1\|4903755_4904793_-\|portal	phage portal protein	Q6K1J0	Salmonella_virus	1.2e-163	79.3
WP_044701619.1\|4904792_4906562_-\|terminase	terminase ATPase subunit family protein	Q9T0R3	Escherichia_phage	8.5e-287	81.0
WP_044701617.1\|4906726_4907590_+\|capsid	GPO family capsid scaffolding protein	A0A218M4L9	Erwinia_phage	3.7e-102	66.6
WP_044701616.1\|4907621_4908782_+\|capsid	phage major capsid protein, P2 family	A0A0M4R4W2	Salmonella_phage	4.3e-130	63.1
WP_047715974.1\|4908785_4909544_+\|terminase	terminase endonuclease subunit	Q94MJ2	Enterobacteria_phage	3.0e-79	66.3
WP_000177982.1\|4909641_4910142_+\|head	head completion/stabilization protein	U5N0S3	Enterobacteria_phage	3.8e-59	68.5
WP_001100637.1\|4910141_4910345_+\|tail	tail protein X	U5N3E7	Enterobacteria_phage	8.9e-23	76.1
WP_000524754.1\|4910335_4910557_+	hypothetical protein	A0A218M4L5	Erwinia_phage	8.7e-24	71.2
WP_044701612.1\|4910540_4911050_+	lysozyme	A0A218M4K3	Erwinia_phage	1.9e-77	83.8
WP_044701609.1\|4911046_4911460_+\|lysis	LysB family phage lysis regulatory protein	O80310	Escherichia_phage	1.9e-35	59.9
WP_044701608.1\|4911567_4912035_+\|tail	phage tail protein	U5N0S7	Enterobacteria_phage	9.7e-57	70.3
WP_044701606.1\|4912027_4912483_+	phage virion morphogenesis protein	O80313	Escherichia_phage	1.3e-50	69.1
WP_047715975.1\|4912496_4913240_+	hypothetical protein	NA	NA	NA	NA
WP_044701601.1\|4913314_4913956_+\|plate	phage baseplate assembly protein V	Q6K1H6	Salmonella_virus	4.5e-97	83.6
WP_023223227.1\|4913952_4914300_+	GPW/gp25 family protein	A0A0F7LDQ1	Escherichia_phage	9.5e-41	71.3
WP_044701599.1\|4914304_4915213_+\|plate	baseplate assembly protein	Q37840	Escherichia_phage	5.2e-139	84.4
WP_044701597.1\|4915205_4915736_+\|tail	phage tail protein I	Q37841	Escherichia_phage	5.6e-101	97.2
WP_044701594.1\|4917590_4918118_+\|tail	tail assembly chaperone	Q2A0A8	Sodalis_phage	7.5e-13	28.6
WP_044701591.1\|4918247_4919435_+\|tail	phage tail sheath protein	A0A0F7LBW9	Escherichia_phage	1.1e-189	82.8
WP_023223221.1\|4919447_4919966_+\|tail	phage major tail tube protein	A0A0F7LDZ1	Escherichia_phage	2.0e-71	75.6
WP_044701589.1\|4920028_4920310_+\|tail	phage tail assembly protein	A0A0F7LBN9	Escherichia_phage	4.7e-30	79.1
WP_000763326.1\|4920342_4920462_+\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	3.7e-13	84.6
WP_044701587.1\|4920454_4922884_+\|tail	phage tail tape measure protein	S4TP64	Salmonella_phage	3.9e-266	76.0
WP_044701585.1\|4922895_4923360_+\|tail	phage tail protein	A0A0F7LBX3	Escherichia_phage	7.6e-62	74.8
WP_044701584.1\|4923362_4924556_+	phage late control D family protein	Q6K1G4	Salmonella_virus	2.1e-164	77.6
WP_052746971.1\|4924618_4924840_+	DNA-binding transcriptional regulator	S4TNZ3	Salmonella_phage	2.1e-25	72.6
WP_003035753.1\|4925148_4927431_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.8e-162	42.0
4929193:4929209	attR	NA	NA	NA	NA

DBSCAN-SWA_365

4931554 : 4932643

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847007.1\|4931554_4932643_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	5.9e-81	46.2

DBSCAN-SWA_366

4937697 : 4942238

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035780.1\|4937697_4937982_+	integration host factor subunit beta	A7KV42	Bacillus_phage	9.2e-10	39.1
WP_044701581.1\|4938188_4940453_+	ComEC family protein	NA	NA	NA	NA
WP_003035784.1\|4940489_4942238_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	2.4e-60	30.7

DBSCAN-SWA_367

4956976 : 4957525

Rhodobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035820.1\|4956976_4957525_+	YcbK family protein	A0A0K1LKR7	Rhodobacter_phage	3.5e-05	32.6

DBSCAN-SWA_368

4961307 : 4967796

Bandra_megavirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936329.1\|4961307_4962708_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	3.8e-80	35.9
WP_003836860.1\|4962875_4964078_-	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
WP_044701568.1\|4964344_4966957_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	1.6e-18	21.4
WP_032936311.1\|4967028_4967796_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-29	37.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011611

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14298 : 57579

Escherichia_phage(45.45%)

transposase,integrase

attL 26438:26497|attR 46208:47030

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016162063.1\|14298_15003_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	9.0e-139	99.6
WP_000557452.1\|15109_15970_+	aminoglycoside N-acetyltransferase AAC(3)-IIe	NA	NA	NA	NA
WP_002063889.1\|15982_16525_+	AAA family ATPase	NA	NA	NA	NA
WP_165587319.1\|16616_17772_+\|transposase	IS3 family transposase	A0A2P1JR32	Mycobacterium_phage	1.3e-17	30.6
WP_001067855.1\|17718_18423_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000845039.1\|18918_19932_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_063840321.1\|20223_20778_+	fluoroquinolone-acetylating aminoglycoside 6'-N-acetyltransferase AAC(6')-Ib-cr5	NA	NA	NA	NA
WP_001334766.1\|20908_21739_+	oxacillin-hydrolyzing class D beta-lactamase OXA-1	NA	NA	NA	NA
WP_000186237.1\|21876_22509_+	type B-3 chloramphenicol O-acetyltransferase CatB3	A0A2R8FE91	Brazilian_cedratvirus	4.1e-26	41.2
WP_001749986.1\|22593_23046_+	NAD(+)--rifampin ADP-ribosyltransferase Arr-3	NA	NA	NA	NA
WP_000679427.1\|23268_23616_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|23609_24449_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_047715689.1\|24576_25077_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001389365.1\|25583_26348_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
26438:26497	attL	NA	NA	NA	NA
WP_001067855.1\|26502_27207_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000027057.1\|27279_28140_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001235713.1\|28322_28880_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_004152391.1\|29994_31710_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_004152392.1\|31819_34849_+\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004199214.1\|34955_35981_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
WP_004152394.1\|35977_36757_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004199234.1\|37143_38025_+	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
WP_004152397.1\|38274_39594_-\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_001039466.1\|42105_43290_-	tetracycline efflux MFS transporter Tet(D)	NA	NA	NA	NA
WP_000113282.1\|43385_44042_+	tetracycline resistance transcriptional repressor TetR(D)	NA	NA	NA	NA
WP_001067855.1\|44053_44758_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001011939.1\|44901_45543_-	type A-2 chloramphenicol O-acetyltransferase CatII	G3CFL0	Escherichia_phage	7.3e-55	45.9
WP_001239317.1\|45692_46193_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|46272_46977_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001044210.1\|46982_47123_+	hypothetical protein	NA	NA	NA	NA
46208:47030	attR	NA	NA	NA	NA
WP_001446887.1\|47608_48346_+	recombinase family protein	NA	NA	NA	NA
WP_000743213.1\|48342_48567_+	hypothetical protein	NA	NA	NA	NA
WP_001120888.1\|48777_50271_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001445143.1\|50301_50553_+	hypothetical protein	NA	NA	NA	NA
WP_000251875.1\|50446_50749_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_047715692.1\|50835_51651_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
WP_000954592.1\|51980_52157_+	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
WP_000427619.1\|52338_53343_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_001138070.1\|53421_56388_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.9
WP_001067855.1\|56443_57148_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_165919943.1\|57138_57579_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.8e-21	43.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP011609

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13552 : 44126

Escherichia_phage(27.27%)

integrase,protease,transposase

attL 40091:40105|attR 46486:46500

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000845048.1\|13552_14566_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_003159191.1\|14729_15284_+	aminoglycoside N-acetyltransferase AAC(6')-Ib4	NA	NA	NA	NA
WP_047715652.1\|15353_16145_+	AadA family aminoglycoside 3''-O-nucleotidyltransferase	NA	NA	NA	NA
WP_000679427.1\|16308_16656_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|16649_17489_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|17893_19435_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_032491313.1\|19790_20270_+	trimethoprim-resistant dihydrofolate reductase DfrA3b	A0A0N9RSY5	Escherichia_phage	1.8e-10	30.7
WP_000654805.1\|20370_21339_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	7.7e-181	96.9
WP_032491180.1\|21459_22320_+	class A extended-spectrum beta-lactamase SHV-30	A0A077SL40	Escherichia_phage	1.7e-155	99.3
WP_002210513.1\|22340_23102_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_004206881.1\|23209_26107_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	2.5e-182	37.8
WP_000509966.1\|26201_26807_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_004206885.1\|27389_29477_-	conjugal transfer protein TrbC	NA	NA	NA	NA
WP_004206886.1\|29489_30440_-	DsbC family protein	NA	NA	NA	NA
WP_004206887.1\|30450_31713_-	hypothetical protein	NA	NA	NA	NA
WP_004187436.1\|31757_32153_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_004206889.1\|32257_32641_-	DUF1496 domain-containing protein	NA	NA	NA	NA
WP_004206890.1\|32720_33374_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_004187429.1\|33465_33723_+	type II toxin-antitoxin system antitoxin PemI	NA	NA	NA	NA
WP_147810693.1\|33691_34057_+	type II toxin-antitoxin system toxin endoribonuclease PemK	NA	NA	NA	NA
WP_004187425.1\|34149_34584_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.2e-29	55.3
WP_004187413.1\|35958_36168_-	hypothetical protein	NA	NA	NA	NA
WP_004187411.1\|36170_36389_-	hypothetical protein	NA	NA	NA	NA
WP_004206893.1\|36433_37117_-	hypothetical protein	NA	NA	NA	NA
WP_004206894.1\|37117_37375_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004206895.1\|37392_38667_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_004206896.1\|39194_39551_+	hypothetical protein	NA	NA	NA	NA
WP_015062853.1\|39528_40107_+	hypothetical protein	NA	NA	NA	NA
40091:40105	attL	NA	NA	NA	NA
WP_004206898.1\|40108_40516_+	hypothetical protein	NA	NA	NA	NA
WP_004206899.1\|40668_41214_-	hypothetical protein	NA	NA	NA	NA
WP_004206900.1\|41354_41825_+	hypothetical protein	NA	NA	NA	NA
WP_004187394.1\|41811_42060_+	helix-turn-helix transcriptional regulator	A0A248SLB9	Klebsiella_phage	1.6e-10	53.0
WP_004206901.1\|42052_42640_+	restriction endonuclease	NA	NA	NA	NA
WP_004187390.1\|42636_43122_+	hypothetical protein	NA	NA	NA	NA
WP_020316874.1\|43163_43367_+	hypothetical protein	NA	NA	NA	NA
WP_004187383.1\|43385_44126_+\|integrase	tyrosine-type recombinase/integrase	I3WFA4	Macacine_betaherpesvirus	9.5e-22	51.6
46486:46500	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011610

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011612

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP011611

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP011609

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection