CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP012040	Cyclobacterium amurskyense strain KCTC 12363 chromosome, complete genome	1 crisprs	DEDDh,PrimPol,csa3,WYL,cas3,PD-DExK,Cas9_archaeal,RT	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012040_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012040_1

635288-635382

Orphan

Consensus_repeat	Method
AAATAACGTGGGACATTTTGGGACA	CRISPRCasFinder

1 spacers

PrimPol

The CRISPR arrays of NZ_CP012040_1

>merge|NZ_CP012040|1|635288-635382|CRISPRCasFinder
AAATAACGTGGGACATTTTGGGACACGTTCTGAAAACGTGAGACAATTTATACCTTTTTAGGACACGTTATAAAAACGTGGGACATTTTGGGACA

>NZ_CP012040|1|1|635288-635382|CRISPRCasFinder
AAATAACGTGGGACATTTTGGGACA	CGTTCTGAAAACGTGAGACAATTTATACCTTTTTAGGACACGTTA
TAAAAACGTGGGACATTTTGGGACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012040.1\|WP_048640452.1\|623844_625089_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277331
NZ_CP012040.1\|WP_048640463.1\|643217_643463_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|198034
NZ_CP012040.1\|WP_048640462.1\|642903_643227_-\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	unknown	unknown	gnl\|CDD\|367091
NZ_CP012040.1\|WP_157470598.1\|644968_646003_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350108
NZ_CP012040.1\|WP_048640459.1\|639059_639410_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012040.1\|WP_048640460.1\|640029_642174_-\|right-handed-parallel-beta-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|379079
NZ_CP012040.1\|WP_048640458.1\|635396_635714_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012040.1\|WP_048640465.1\|644033_644351_-\|type-II-toxin-antitoxin-system-HigB-family-toxin	unknown	unknown	gnl\|CDD\|378301
NZ_CP012040.1\|WP_048640454.1\|628483_629557_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP012040.1\|WP_048640453.1\|625435_628480_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP012040.1\|WP_053086633.1\|646234_647758_+\|sulfatase	unknown	unknown	gnl\|CDD\|293763
NZ_CP012040.1\|WP_048640449.1\|621128_622109_+\|alpha-E-domain-containing-protein	unknown	unknown	gnl\|CDD\|377234
NZ_CP012040.1\|WP_048644313.1\|635830_638689_+\|DEAD/DEAH-box-helicase-family-protein	PrimPol	COG4951_PrimPol_CAS-I:CAS-III	gnl\|CDD\|223989
NZ_CP012040.1\|WP_048640456.1\|631676_632561_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|379138
NZ_CP012040.1\|WP_048640457.1\|632573_633992_-\|SLC13-family-permease	unknown	unknown	gnl\|CDD\|223547
NZ_CP012040.1\|WP_048640448.1\|619686_621114_+\|circularly-permuted-type-2-ATP-grasp-protein	unknown	unknown	gnl\|CDD\|379601
NZ_CP012040.1\|WP_048640464.1\|643681_644056_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227786
NZ_CP012040.1\|WP_048640455.1\|629948_631499_-\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_CP012040.1\|WP_048640451.1\|622889_623747_+\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|224224
NZ_CP012040.1\|WP_048640450.1\|622105_622846_+\|peptidase	unknown	unknown	gnl\|CDD\|239734

Protein	Function_ID	Function_description	E-value
NZ_CP012040.1\|WP_048640452.1\|623844_625089_+\|metallophosphoesterase	gnl\|CDD\|277331	cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain. YkuE is an uncharacterized Bacillus subtilis protein with a C-terminal metallophosphatase domain and an N-terminal twin-arginine (RR) motif. An RR-signal peptide derived from the Bacillus subtilis YkuE protein can direct Tat-dependent secretion of agarase in Streptomyces lividans. This is an indication that YkuE is transported by the Bacillus subtilis Tat (Twin-arginine translocation) pathway machinery. YkuE belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.2991e-48
NZ_CP012040.1\|WP_048640463.1\|643217_643463_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|198034	smart00966, SpoVT_AbrB, SpoVT / AbrB like domain. This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation. AbrB is thought to interact directly with the transcription initiation regions of genes under its control. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator. DNA-binding activity in this AbrB homologue requires hexamerisation. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins.	0.00473042
NZ_CP012040.1\|WP_048640462.1\|642903_643227_-\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	gnl\|CDD\|367091	pfam02452, PemK_toxin, PemK-like, MazF-like toxin of type II toxin-antitoxin system. PemK is a growth inhibitor in E. coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. This family represents the toxin molecule of a typical bacterial toxin-antitoxin system pairing. The family includes a number of different toxins, such as MazF, Kid, PemK, ChpA, ChpB and ChpAK.	2.97046e-26
NZ_CP012040.1\|WP_157470598.1\|644968_646003_+\|hypothetical-protein	gnl\|CDD\|350108	cd08994, GH43_62_32_68_117_130-like, Glycosyl hydrolase families: GH43, GH62, GH32, GH68, GH117, CH130. Members of the glycosyl hydrolase families 32, 43, 62, 68, 117 and 130 (GH32, GH43, GH62, GH68, GH117, GH130) all possess 5-bladed beta-propeller domains and comprise clans F and J, as classified by the carbohydrate-active enzymes database (CAZY). Clan F consists of families GH43 and GH62. GH43 includes beta-xylosidases (EC 3.2.1.37), beta-xylanases (EC 3.2.1.8), alpha-L-arabinases (EC 3.2.1.99), and alpha-L-arabinofuranosidases (EC 3.2.1.55), using aryl-glycosides as substrates, while family GH62 contains alpha-L-arabinofuranosidases (EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose sidechains from xylans. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Clan J consists of families GH32 and GH68. GH32 comprises sucrose-6-phosphate hydrolases, invertases (EC 3.2.1.26), inulinases (EC 3.2.1.7), levanases (EC 3.2.1.65), eukaryotic fructosyltransferases, and bacterial fructanotransferases while GH68 consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10); beta-fructofuranosidase (EC 3.2.1.26); inulosucrase (EC 2.4.1.9), while GH68 consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10); beta-fructofuranosidase (EC 3.2.1.26); inulosucrase (EC 2.4.1.9), all of which use sucrose as their preferential donor substrate. Members of this clan are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) that catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. Structures of all families in the two clans manifest a funnel-shaped active site that comprises two subsites with a single route for access by ligands. Also included in this superfamily are GH117 enzymes that have exo-alpha-1,3-(3,6-anhydro)-l-galactosidase activity, removing terminal non-reducing alpha-1,3-linked 3,6-anhydro-l-galactose residues from their neoagarose substrate, and GH130 that are phosphorylases and hydrolases for beta-mannosides, involved in the bacterial utilization of mannans or N-linked glycans.	3.14335e-113
NZ_CP012040.1\|WP_048640460.1\|640029_642174_-\|right-handed-parallel-beta-helix-repeat-containing-protein	gnl\|CDD\|379079	pfam13229, Beta_helix, Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.	2.30737e-13
NZ_CP012040.1\|WP_048644313.1\|635830_638689_+\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	9.33818e-53
NZ_CP012040.1\|WP_048640465.1\|644033_644351_-\|type-II-toxin-antitoxin-system-HigB-family-toxin	gnl\|CDD\|378301	pfam09907, HigB_toxin, HigB_toxin, RelE-like toxic component of a toxin-antitoxin system. HigB_toxin is a family of RelE-like prokaryotic proteins that function as mRNA interferases. HigB cleaves translated mRNA only, and cleavage depended on translation of the target RNAs. HigB belongs to the RelE super-family of RNases. The toxin-antitoxin gene-pair is induced by environmental stress factors.	9.1498e-33
NZ_CP012040.1\|WP_048640454.1\|628483_629557_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.28601e-37
NZ_CP012040.1\|WP_048640453.1\|625435_628480_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	7.06817e-176
NZ_CP012040.1\|WP_053086633.1\|646234_647758_+\|sulfatase	gnl\|CDD\|293763	cd16144, ARS_like, uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	4.81904e-162
NZ_CP012040.1\|WP_048640449.1\|621128_622109_+\|alpha-E-domain-containing-protein	gnl\|CDD\|377234	pfam04168, Alpha-E, A predicted alpha-helical domain with a conserved ER motif. An uncharacterized alpha helical domain containing a highly conserved ER motif and typically found as a tandem duplication. Contextual analysis suggests that it functions in a distinct peptide synthesis/modification system comprising of a transglutaminase, a peptidase of the NTN-hydrolase superfamily, an active and inactive circularly permuted ATP-grasp domains and a transglutaminase fused N-terminal to a circularly permuted COOH-NH2 ligase domain.	8.17905e-133
NZ_CP012040.1\|WP_048640456.1\|631676_632561_-\|serine-hydrolase	gnl\|CDD\|379138	pfam13354, Beta-lactamase2, Beta-lactamase enzyme family. This family is closely related to Beta-lactamase, pfam00144, the serine beta-lactamase-like superfamily, which contains the distantly related pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	9.36338e-53
NZ_CP012040.1\|WP_048640457.1\|632573_633992_-\|SLC13-family-permease	gnl\|CDD\|223547	COG0471, CitT, Di- and tricarboxylate transporters [Inorganic ion transport and metabolism].	7.22071e-49
NZ_CP012040.1\|WP_048640448.1\|619686_621114_+\|circularly-permuted-type-2-ATP-grasp-protein	gnl\|CDD\|379601	pfam14403, CP_ATPgrasp_2, Circularly permuted ATP-grasp type 2. Circularly permuted ATP-grasp prototyped by Roseiflexus RoseRS_2616 that is associated in gene neighborhoods with a GCS2-like COOH-NH2 ligase, alpha/beta hydrolase fold peptidase, GAT-II -like amidohydrolase, and M20 peptidase. Members of this family are predicted to be involved in the biosynthesis of small peptides.	0
NZ_CP012040.1\|WP_048640464.1\|643681_644056_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227786	COG5499, COG5499, Predicted transcription regulator containing HTH domain [Transcription].	2.3283e-30
NZ_CP012040.1\|WP_048640455.1\|629948_631499_-\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.4509e-129
NZ_CP012040.1\|WP_048640451.1\|622889_623747_+\|transglutaminase-family-protein	gnl\|CDD\|224224	COG1305, COG1305, Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism].	1.47619e-25
NZ_CP012040.1\|WP_048640450.1\|622105_622846_+\|peptidase	gnl\|CDD\|239734	cd03765, proteasome_beta_bacterial, Bacterial proteasome, beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.	1.92251e-38

>NZ_CP012040.1|WP_048640457.1|632573_633992_-|SLC13-family-permease
MFDADSRSGARILYRKLKLNWIFSTSSFIGNFLIALLVTYFFSKIGYDPPVNFVFFISILAIGLWISEALPPFAVGIFIIATLLLGFSTDFFFDKTMPPELYVSTWTSNVIWLLLGGFFLAKAMSLVELDQQLFQFTVKKFGHKPEGLLLGMMMTTAVASMVMSNTATTAMMISSIIPLVRLIGKDSPYGKSLLIAIPAAASVGGIGTIIGSTPNAIAVGALQEKGISITFIDWMVVGFPTGLLLVWLFWKFLCKTRDFSDVKLDLSLLPKGKGNVGRFEKNAVIFTLFITVMMWLTESLHGIPVAATSAIPIVLLTMTQVIHSEHVRSLPWDTLMLVAGGLALGIALVEVGLAEIVMGKINALPLPKVFIAIIFCLIAVLLSNVMSNTAAASILVPLSLALPGIYGIAGPVMVAISCSCSLLLPVSTPANAIAFATGMVQQKDFRTGGIFFIVLGPILAFLAVMVWVLVLL
>NZ_CP012040.1|WP_048640456.1|631676_632561_-|serine-hydrolase
MKGQLILFLLLLLSCTPAKEDNQLKQLENEIRNLMDSVEGDFGLAFRLLDDADKELFINEKEVFHAASTMKTPVMIELFKQEKAGNFSLQDSIVIRNEFKSILDGSTFSMDLSVDSQEALYSRIGEKGSIYELMYEMIVNSSNLATNLLIEMVAAENVNQTMRDLGANDIQVLRGVEDLKAYDAGLSNTTTALDMMLVMEAIAENKVIGAKNMMEILSDQHFNGLIPKYLPKTAKVAHKTGSITGVQHDAAIVDLEDGSRYVLVVLSKNLQDEEAGKACIARVSQLIYAYVTEH
>NZ_CP012040.1|WP_048640455.1|629948_631499_-|SulP-family-inorganic-anion-transporter
MTQAFYNLFKPKEANLKDEVLSGLTVALALVPEAVAFSLIAGVSPLVGLYTAFIIGLITSILGGRPGMISGATGAIAVVVVALVVDKGVEYLFAAVVLMGLIQILVGVLKLGKLIRLVPHPVMFGFVNGLAIIIFTAQFSQFKTVNSQGVEEWMTGTPLYLMLGLVLVTMVIIKYLPKLTKVVPSALAAILTVTLIVIFGGLDTRTVGDMASISGGLPKFHIPLVSLSMETFWIILPYSAIMAGVGLIESLLTLTLVDEITETRGSGNKECIAQGVANVTTGFFGGMGGCAMIGQSLINVNAGGRNRLSGIVAALGLLTFILFFSSYIEMVPMAALVGLMFMVAIGTFEWASLRVFRKVPKSDVLVMILVTLVTVFLHNLALAVLIGVIIAALVFAWKNSKMIRARKRIDEKGVKHYDIFGPLFFASVTAFGEKFDPLNDPDEIIIDFEESRIVDHSGLEAVHKVTERYNKLGKTVYIRHLDTSSKALLHKASPIIHVNYTEDDPEFVHSDEKTLK
>NZ_CP012040.1|WP_048640454.1|628483_629557_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MNKTLLFCSLIFFFSCGVETQEIEEIPMETFRDEVKATPVKVGQSQRKSFDYLINASGKIEAENQVMSIVERSGYLIELKVEEGQQVKKGDIIALLDKTDSELEWEKAQVSLRTASAEYESLKIVSSVETTFSENLDKNSRDEFWRASSGLLAAQIAVREAENNLAKTEVKAPITGAIADLKIKKGSLVNAGDEICLVLSTRSLEMKVKVLESDISYVKKGQKTEVYPVSGTSDSEREKITGTVTSINPKVDENGLVQVTIKLSAGGSLLSGMNARAVIRAPQNNNLVVPKEAVVYRSGRPVVFTIDNNEAIWNYIEVGKDNGREIEVLDGLEADKTVIVSNNVQLGHQAAVQITTD
>NZ_CP012040.1|WP_048640453.1|625435_628480_-|efflux-RND-transporter-permease-subunit
MVKFLLSRPIAVGMTFLALLIFSIILFRTLPISLLPPIDVPQIVIKVNYPNSSPESIEQNVLSPIREGMVTLNGLQDLESKAGSEVGDVRLTFDFQTRMELAYIEVNEKIDRLTNNLPQDMPRPQVVRINSNDIPIVRLQVIPKEGVDFAEVSLLTENVIKKRLEQLEGVALVDINGRQEKVITVTPNKPLMSGLGLREADLIRAINDGNSELPGISVEDGQFRYFLRLASKLETAEDVGNLPVHGPSGNIVTLSKVATVEHTLSKPTGFHLFQDKEGLVVTVHKQTSAKMNETMPLIYEAVELFKVDYPQVDFELTQDQSSLLNAGINNLQTSLLFGGLFAFAILFVFMGNYRTPIIIGISLPSSLVISFMVFYFFDISINVISLSGLALGLGMLIDNAIIVLDNINRKREEGLPLFEACVSGVNEVQSALISSVLTTLAVFVPLVFLSGVAGALFYDQAVSVAAILCVSLLVAFILLPLLYFLLFKNKEKSAAKEDSRLFKGLLKGYKKVFQGLFAHPGWSLMFLFLLIPLLLGTVKFLKVEGLPPIEKFDVLISLDWNEPIDASQNKDRIQSLLAQLEGNFTVTESDLGLRQFILYEGENAIQQADLYLMFADDEAKESVSRQLKRFFRQNYPQASLAINDAPNAFDQLFNSNRPYYEVRLKNLESKRPIKASQMNQWMEQFPVETWTKGPGLQEGSSVIFKTDLEKLALYGLEVNQLITSIEQLFGNYLITDIRQFGEIIPIQLRNDQLDFQTLLKSNYIYGEEGIAYSLNEFITYSYDSHYKYVTSDRYGIYQSLNLDVSEPTKHEADIRSWGTERDLAVDFAGQYFQDQETIKQLMGILMISILLLYFILAAQFESFLQPLIVVFTLPLGVGGAFLVLWLTGTSLNVMSAIGLVVMLGIMVNDAILKIDTINRLRAIYQTKDGMETRVALTMALYHAGEIRLKPIVMTSITTILALIPVVFSAGLGADLQRPLVFSVIGGLTIGTFTALYFVPLAYWFLSGQRGAIKF
>NZ_CP012040.1|WP_048640452.1|623844_625089_+|metallophosphoesterase
MKKVGGTLFIITLLSIVIFLDWYVYQGIKAILPADYLTLGKTTYWILTGAIAVWLGFTFYTIMQEGKISPSSQQSLNLFLVILVTQLTVIVFLFGEDLIRVIGTVYSYATGATNENGSLMASRRKFISQIAFAVAAIPMTGFIYGIIKGKYDFRTIKKTLYFKDLPEAFDGFTITQLSDIHAGSFKDYAAVKKGADMAAAQQSDLFVFTGDLVNHKADEIDPMIDIFSQIKAPYGQFSILGNHDYGDYTSWPSPEAKAQNLQSLKGKHKMMGFDLLLDENRIIEKDGQRISLLGVENWGLGFQSKGDLEKSLVDVPDDAFKVLLSHDPTHWDEQVKNHPKNIHLTLSGHTHGMQIGIETPFIRWSPAQYRYTNWAGIAEQAGKYLYVNRGFGFHAFAGRVGIWPEITVIELKKG
>NZ_CP012040.1|WP_048640451.1|622889_623747_+|transglutaminase-family-protein
MRLKIQHTTTYEYQKSVRLNPHHFYLKPLQRNYLEINAYKLDIDPKPEGVNERYSIEGNPYYQAWFTGETENMVIKVDFEVNTSHFNPFLFLMDQWFLQNFNPEADIPFSYQQKNLPILQPYLTHSNNNLLKSYALEKLRTKDPIQFLTQLNAAIHADWHHIIREEENLWSAARTFAAGKGSCRDLSFMLIEMLRHVGLAARFVSGYAFNPELEEGHELHAWVETYLPGAGWVGLDPSLGLMADEHYIPLAASFLPENTLPVHGSFGGENLKPSTLHTTLSIHPF
>NZ_CP012040.1|WP_048640450.1|622105_622846_+|peptidase
MTFCIGIKTKHGIVGLSDTRITSGNETTTSKKVYTVNRKNHSFFIMTSGLRSVRDKAITYFGELIEKNDASYDKLYKAVNGFADQVKRVAGEDMASLENSGFTFNLFSIIGGQLEEDKEPKLYLLYPQGNWIEIRTGTPFVIIGNTGFGNPVLRRSLKYDEPLLLALKSAFLAFDATRISANDVDYPIDTVILENDTYNVVENRFEQHELNHLSEFWNDSLKEAIHNLPTEVLEKAFSPKEFEKSE
>NZ_CP012040.1|WP_048640449.1|621128_622109_+|alpha-E-domain-containing-protein
MLSRVANSIYWLGRYMERAENYARFINVNFNLMLDLPPDLKEQWEPLIMATGDHELYTSRNNSYKMKEVIYFLAFDHSNPNSIISSVSQARENARMIRENLTKETWEKLNETYHFVNKASESKVWKKEDPRDFFEEVKSKILLLYGLADNTVARTEGWYFRQLGQYLERADKTSRILDVKYHILLPSAEEVGSPLDFLHWMALLKSVTAFNTYRRLYGNISPSGVVEFLVLNKFFPRSVFFCLKEAEQCLYKISKSNGEGYSNSAEKAMGELRSKLEFDDVNDIISSGLHEYIEQLQIKINNVSNKINDNYFQIKDNFASQTMDQE
>NZ_CP012040.1|WP_048640448.1|619686_621114_+|circularly-permuted-type-2-ATP-grasp-protein
MNVNHEPQHSFYDEMYDEHQTLREHYSSLGAFIENTSAKKLNQLQFSADKAQMAMGMTFNVYHDKEGLEKILHLDIIPRIIPGKEWHTINEGLKQRITALNLFLQDIYNDQKILKDKIVPTDLILGSKDFLKPCMGLTPPKGIWCHITGTDLVRDNNGEFYILEDNLRCPSGVSYMLESREIIKRAYPDLFNKLGVRPVSDYPTKLLDMLQFLSDKPKPVIGVLTPGVYNSAYFEHSYLAQQMGAELVSGMDLIVKDKKVYMQTTQGLEQIDVLYRRIDDTFLDPQVFNPNSMLGIPGLFEAYKAGNIAMANAPGTGVADDKAVYAYVPKIIKYYLDQDPILHNVPTYLCREEKDRNHVLENISDLVVKETNAAGGYGMMIGPKADAKEHEKFRQLIKSNPTNYIAQPTLSLSTVPSIVDNKTIEGRHVDLRPYVLYGNEVEVIPGALTRVALKKGSLVVNSSQGGGSKDTWVLY
>NZ_CP012040.1|WP_048640458.1|635396_635714_+|hypothetical-protein
MDTDDLSIPTYKGIISEAEKFNHDLTLQFGVLASSCKDDDDYLNQAEALIKDWLQMNDFEDIIDGIFFGQKVNENAFRKTLNITLSNIAEIRKTPMEQREFEDWG
>NZ_CP012040.1|WP_048644313.1|635830_638689_+|DEAD/DEAH-box-helicase-family-protein
MPAYFYDPYRLRVHKMNGGTFQNFTEKSYLKFTDEQIQKHLDGFHHIGIYPLLQDNTIWFLAADFDKTNWQDEAVTFLNACKEKEIPAYLEHSRSGNGGHVWIFFDKPYPAIRSRKIFISILEQSGAFSMFDKSSSFDRLFPNQDFLSGKGFGNLIALPLFKPTFEKGNNCFIDPETFEQFTDQWDFLKNIQRVSTDFLDEQCKTLSPDVPKIKSQPINGKLSISLNNTIRISRNGLTPTLTHFLKEELNFANSEFFIKKKSGRNTFETVRYFKLIEESESEIFIPRGFIGRLLRFCKKSQIGFGFVDERKLKPTIPFVFNVALRNHQLGVIEAVSKKDYGVIVAPPGSGKTVIGLKIIGDKGQPALIIVHRKQLLDQWTERIEAFLGIPKRDIGVIGQGKSKIGKQITVATIQSLPKQIESVENQFGTIIVDECHHVPAETFRKTIEKLQAYYLYGLTATPFRKYNDGKMIFTHLGEIIANIQPTEIENYKQAKIIIRNTALNVPYNSKTDSFETLSKILVHDTARNKLIWEDVKTELNQGKKAVIITERKEHIDTLYLFLKQSYEAITLSGEDSETSKKAKWKTLQEGNFQVLITTGQYFGEGTDLQNISCLFLVYPFSFEGKLIQYIGRVQRSEINPTIYDYRDYKIDYLNKLFLKRNTYYRKIDKQATLFDEPKDEITTSKHVLTIEKKIKVPIEELEFHYGSLAFKYAVVEMNTELQFQVENIEIRPEFEVLKPYFIKRLKSKNITVELLAEFENGKLVSQLALSTDIDRINKEVVEGVKFQFLNKSLLKQFSTKNQNILTSDELQEQDKIYSNAEEVLTEILKNKQYKHSQHIQYLAERHESSIMKIRFVLNPFSFVFLLAGDQSYFIVLETLDTEEATYIWHAPKNKSSLIEEVKQIDSQLSTIRKKGRQAFLENNPEKFTRIMHDYSDNKKGFIIWKSALEEIV
>NZ_CP012040.1|WP_048640459.1|639059_639410_+|hypothetical-protein
MKIYKVKPLLFFLLLIFSCENNVGPNREGTAEVAISVASRGGYQFLIEFDGDLYFPENLPEEFRVVSQEPIPVNIKFQIQDNKEDILQPAPNDVPIFLMSVPVITIISIEKIKSIP
>NZ_CP012040.1|WP_048640460.1|640029_642174_-|right-handed-parallel-beta-helix-repeat-containing-protein
MNHMKISSAIGLLLVFLIYVTPMAYATANQVKENGRTIYVAPNGDDKSEGTIDQPLASLIGARDWIRKHKKNNGATGPVTILIRGGEYEMLAPLELNPGDGGSEEAPVVYKAYPNEKPVFSGGKKLSGFKVNELGIWELELHESRYYKWRFDQLYVNGKRATLARTPNEGFMHIGAVKQNDWIKGTGRAVEKAQHVFSFDEENFSHLKGIADEDLENVRLRAYHKWNFTMRYLDKLDKDSAQVYTSGGGMPPWNPIKEGGRIVFENFAAALDEAGEWYLNSKGILYYIPLPGEHPENAEVIAPVLDNLVLVKGDAANGKPVEHVRFEGLSFMHCHYAVPPSGAEPSQAATMINAAVMLEGANHVDFVDCEISKTGQHALWYGKGCHNSTIERSYLHDLGGGGIYLGETRAHEGVNHTSHIKLHNNIIQTGGLEYPTAVGVWVGHSSDNEISHNDIGDFYYTGISVGWVWGYAESNAKRNTIVYNHIHHIGWTLLSDMAAVYTLGKSEGTVISNNIVHHVHAYSYGGWGLYTDEGSTGIVMENNLVYSTKTGGFHQHYGENNTIRNNIFAYAKMYQAQCTRVEEHRSFDFMNNIIVFDKGAVLQGAWEKIDIAMDNNMYWNTGGEKYDFNGKSFAEWQKFGHDQHSRIMNPRFKDPENFNFEFSSKKTIRRIGFKPFDLDASGVYGEEAWKEKAKLPESILAAFDREVKVNMEKE
>NZ_CP012040.1|WP_048640462.1|642903_643227_-|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin
MEIDQYQIILVNQDPTIGSEIKKTRPCVIIYPNEMNKYLRTLVIAPMTTSSKNYPTRIEVKHDNKIGWIVLDQIRTVDKGRIIRPLGRLSKPEIKELKAIIKETFVD
>NZ_CP012040.1|WP_048640463.1|643217_643463_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MEISVVKIGNSKGIRLSKTLIERYNIKGRIDLILEKDQIVLRPLATPRKGWEKAFKEMNENGDDKLLIDDVFEDDHLDEWK
>NZ_CP012040.1|WP_048640464.1|643681_644056_-|helix-turn-helix-domain-containing-protein
MLKPIKTSKDHDNYLARAYELMQLDLKPNSKESDELEVLSILIEAYEKTKYPIESPNPIEAILFRIDQLGMSKSELSKLLGSRSRASEILKGKRKLSITMIRKLNQELGISAQTLIQDYEMVDG
>NZ_CP012040.1|WP_048640465.1|644033_644351_-|type-II-toxin-antitoxin-system-HigB-family-toxin
MRVIAVNTIREYWVKYPNTEQALKSWLQEIEQSNWETPQDLKVKYRNASIITGKRTVFNINGNKYRLIVDIEYRLKIVFIVWFGTHAEYDLINSKTVTYVKANKD
>NZ_CP012040.1|WP_157470598.1|644968_646003_+|hypothetical-protein
MLFLLHLQATKAQTSQKIKGQLQAISEDNIFLSEDYFNWGGSILKGEDGMYHLFYSRWPKSSQFTGWLLYSEIAHAVSTKPSGPWKYQATVLKGRGKGHWDAITAHNPKIKNFNGKYYLYYISTNMGENESYSDKELQETSTTGYSHPNWKILRPNQRTGVAVAESLDGPWERSDKPLIEPSGPISTLTVNPAIDRGKDGKYYLIVKGDKPNDENFVRNQAMAIGDSPTGPFIIQPKPVIDYMDTEDMSLWYDQTSEKYYGIFHSHTFIGLVSSEDGIHWDKAEEYEIMTKAIPTQKGEDIKPDRMERPFVYQEKGVVKVLGLACKLENESFIVTIPVKENIQY
>NZ_CP012040.1|WP_053086633.1|646234_647758_+|sulfatase
MIKQSVKIFLLGLLVGMSFSKVRGSDIPKKNKQPNIVFFFVGDMGWLDTSVPFYKEVTALNERYHTPNMERLAREGMKFTQAYASAVCTPSRVSLMTGVNAARHKVTNWTLIKDESPDNDDEVVKSPDWNLNGLSPIPNIPHTFFHPENLPLLLSQNEYRTIHVGKAHFGALGTPGENPLNLGFDLNIGGNAAGGPGSYLGIHNFSSTWKGSGNTLLDLPGLEAYHGEAIYLTEALTREGLKAVSKAVEDDKPFYLYLSHYANHPPREKDERFYQNYIDQGLNELEATYASMIEGMDNSLGDIMDHLEKLGVNDNTIVVFMSDNGPHPQVPQNLPLRGHKLGPYEGGIRVPLLVKWPTVTLPGTVSEDCIIIEDIFPTFLEMAGLNSLVNKSIDGQSFVPILKGEPSKSADRPLLWHFPNTYFSPPYSAVRKGNWKLIYYHVDQKFELFNLKDDIGESTELSNTNKIKTKEMAELMTKLLKETGAQMPTIIATGRFVPYPDQVYSLH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4228498 : 4315610

Leptospira_phage(28.57%)

integrase,protease,transposase

attL 4243224:4243256|attR 4289679:4289711

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157470520.1\|4228498_4229422_-\|transposase	transposase	NA	NA	NA	NA
WP_048643034.1\|4229819_4230059_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	2.0e-10	44.2
WP_084011855.1\|4230110_4230758_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	1.6e-09	29.4
WP_157470524.1\|4231074_4231632_+	hypothetical protein	NA	NA	NA	NA
WP_048643037.1\|4232133_4233498_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	1.7e-80	41.0
WP_048643038.1\|4233544_4234294_+	hypothetical protein	NA	NA	NA	NA
WP_048643039.1\|4234464_4235001_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_048643040.1\|4235075_4235621_+	hypothetical protein	NA	NA	NA	NA
WP_048643041.1\|4235610_4236039_+	hypothetical protein	NA	NA	NA	NA
WP_048643042.1\|4236706_4237957_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-26	31.0
WP_157470526.1\|4238228_4238501_-	hypothetical protein	NA	NA	NA	NA
WP_048640356.1\|4238876_4240397_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	5.8e-58	31.4
WP_014019612.1\|4240472_4240820_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_048643043.1\|4240823_4241126_-	hypothetical protein	NA	NA	NA	NA
WP_048643044.1\|4241388_4241670_+	hypothetical protein	NA	NA	NA	NA
WP_048643045.1\|4241991_4242462_+	winged helix DNA-binding protein	NA	NA	NA	NA
WP_048643047.1\|4242663_4243143_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
4243224:4243256	attL	NA	NA	NA	NA
WP_048643048.1\|4243574_4244354_-	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_048643049.1\|4246311_4246566_+	hypothetical protein	NA	NA	NA	NA
WP_048643050.1\|4246930_4247263_+	hypothetical protein	NA	NA	NA	NA
WP_048643051.1\|4247622_4248072_+	hypothetical protein	NA	NA	NA	NA
WP_084011857.1\|4248560_4249700_+	PKD domain-containing protein	NA	NA	NA	NA
WP_048643054.1\|4250148_4251180_+	serine hydrolase	NA	NA	NA	NA
WP_157470528.1\|4251503_4251947_-	hypothetical protein	NA	NA	NA	NA
WP_169786497.1\|4251984_4253592_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_048643057.1\|4253611_4257139_-	TonB-dependent receptor	NA	NA	NA	NA
WP_048643058.1\|4257277_4257985_-	DUF4974 domain-containing protein	NA	NA	NA	NA
WP_048643059.1\|4258635_4259415_+	hypothetical protein	NA	NA	NA	NA
WP_048643060.1\|4259448_4262664_-	CHAT domain-containing protein	NA	NA	NA	NA
WP_048643061.1\|4262660_4263383_-	hypothetical protein	NA	NA	NA	NA
WP_048643062.1\|4263375_4263945_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_048643063.1\|4264035_4266228_-	hypothetical protein	NA	NA	NA	NA
WP_048643064.1\|4266448_4267660_-	hypothetical protein	NA	NA	NA	NA
WP_048643066.1\|4269198_4270008_+\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	3.3e-36	35.3
WP_048643067.1\|4270007_4271183_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_048643068.1\|4271514_4273569_+	ATP-binding protein	NA	NA	NA	NA
WP_048643069.1\|4273573_4274575_+	hypothetical protein	NA	NA	NA	NA
WP_048642126.1\|4274894_4275167_-	hypothetical protein	NA	NA	NA	NA
WP_157470529.1\|4275252_4276029_+	hypothetical protein	NA	NA	NA	NA
WP_048643071.1\|4276170_4276851_+	hypothetical protein	NA	NA	NA	NA
WP_048643042.1\|4277504_4278755_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-26	31.0
WP_048643072.1\|4278875_4279400_+	hypothetical protein	NA	NA	NA	NA
WP_048643073.1\|4279475_4280372_+	hypothetical protein	NA	NA	NA	NA
WP_084011859.1\|4280673_4281072_-\|transposase	transposase	NA	NA	NA	NA
WP_048643075.1\|4281111_4281384_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_084011861.1\|4281339_4281642_-\|transposase	transposase	NA	NA	NA	NA
WP_048643076.1\|4281701_4281962_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_048643077.1\|4283536_4284943_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_048643078.1\|4285044_4285422_-\|transposase	transposase	NA	NA	NA	NA
WP_053086702.1\|4285710_4287657_+	pyrroloquinoline quinone-dependent dehydrogenase	NA	NA	NA	NA
WP_157470531.1\|4287866_4288133_-	hypothetical protein	NA	NA	NA	NA
WP_048643079.1\|4288154_4288448_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_048643080.1\|4288507_4288738_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_048643081.1\|4288982_4289582_+	hypothetical protein	NA	NA	NA	NA
WP_157470532.1\|4290557_4291217_+	hypothetical protein	NA	NA	NA	NA
4289679:4289711	attR	NA	NA	NA	NA
WP_048643083.1\|4291538_4291997_+	hypothetical protein	NA	NA	NA	NA
WP_053086703.1\|4292650_4293259_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_157470533.1\|4293374_4294379_+	FecR domain-containing protein	NA	NA	NA	NA
WP_048643085.1\|4294525_4297915_+	TonB-dependent receptor	NA	NA	NA	NA
WP_048643086.1\|4297927_4299409_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_048643087.1\|4299608_4302020_+	sodium/solute symporter	NA	NA	NA	NA
WP_048643088.1\|4302025_4302808_+	hypothetical protein	NA	NA	NA	NA
WP_048643089.1\|4302832_4304137_+	sialidase	NA	NA	NA	NA
WP_084011865.1\|4304269_4305085_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_048643091.1\|4305188_4307408_+	hypothetical protein	NA	NA	NA	NA
WP_048643092.1\|4307670_4308804_+	exo-alpha-sialidase	NA	NA	NA	NA
WP_048643093.1\|4309649_4311554_+	hypothetical protein	NA	NA	NA	NA
WP_157470534.1\|4312636_4313665_-	hypothetical protein	NA	NA	NA	NA
WP_048643097.1\|4313796_4314231_-	hypothetical protein	NA	NA	NA	NA
WP_048640497.1\|4314437_4315610_+\|transposase	IS4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage